Web Server Statistics for House Rabbit Society

Program started at Thu-31-Mar-2005 03:10.
Analysed requests from Tue-01-Mar-2005 00:06 to Tue-29-Mar-2005 09:59 (28.41 days).

General Summary

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report contains overall statistics.

Figures in parentheses refer to the 7-day period ending 31-Mar-2005 03:10.

Successful requests: 9,526,030 (2,104,841)
Average successful requests per day: 335,284 (300,691)
Successful requests for pages: 1,881,432 (431,641)
Average successful requests for pages per day: 66,220 (61,662)
Failed requests: 62,544 (10,729)
Redirected requests: 18,107 (4,550)
Distinct files requested: 15,020 (7,297)
Distinct hosts served: 287,269 (78,591)
Corrupt logfile lines: 139
Data transferred: 85.27 gigabytes (18.36 gigabytes)
Average data transferred per day: 3.00 gigabytes (2.62 gigabytes)

Monthly Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the activity in each month.

Each unit (+) represents 60,000 requests for pages or part thereof.

monthreqspages 
Mar 200595260301881432++++++++++++++++++++++++++++++++

Busiest month: Mar 2005 (1,881,432 requests for pages).

Daily Summary

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the total activity for each day of the week, summed over all the weeks in the report.

Each unit (+) represents 8,000 requests for pages or part thereof.

dayreqspages 
Sun1317012269241++++++++++++++++++++++++++++++++++
Mon1424400279797+++++++++++++++++++++++++++++++++++
Tue1448722287695++++++++++++++++++++++++++++++++++++
Wed1376134263494+++++++++++++++++++++++++++++++++
Thu1374252274278+++++++++++++++++++++++++++++++++++
Fri1353367262677+++++++++++++++++++++++++++++++++
Sat1232143244250+++++++++++++++++++++++++++++++

Hourly Summary

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the total activity for each hour of the day, summed over all the days in the report.

Each unit (+) represents 3,000 requests for pages or part thereof.

hourreqspages 
015808533206++++++++++++
114100130522+++++++++++
214832829960++++++++++
313408727533++++++++++
418831437275+++++++++++++
526089552825++++++++++++++++++
636215977103++++++++++++++++++++++++++
742462187345++++++++++++++++++++++++++++++
846126790474+++++++++++++++++++++++++++++++
9522651100465++++++++++++++++++++++++++++++++++
10570135113921++++++++++++++++++++++++++++++++++++++
11555076111512++++++++++++++++++++++++++++++++++++++
12570373124458++++++++++++++++++++++++++++++++++++++++++
13584451123267++++++++++++++++++++++++++++++++++++++++++
14546647110398+++++++++++++++++++++++++++++++++++++
1550093699892++++++++++++++++++++++++++++++++++
16528184100837++++++++++++++++++++++++++++++++++
1753203997598+++++++++++++++++++++++++++++++++
18561167100956++++++++++++++++++++++++++++++++++
1955336796310+++++++++++++++++++++++++++++++++
2045518380307+++++++++++++++++++++++++++
2131976160589+++++++++++++++++++++
2225660654126+++++++++++++++++++
2319069740553++++++++++++++

Domain Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the countries of the computers which requested files.

Listing domains, sorted by the amount of traffic.

reqs%bytesdomain
420357142.95%.net (Networks)
227788824.55%.com (Commercial)
139242813.63%[unresolved numerical addresses]
306342 3.36%.edu (USA Higher Education)
246279 3.10%.ca (Canada)
203406 1.99%.uk (United Kingdom)
137514 1.30%.au (Australia)
118657 1.24%.us (United States)
80626 0.81%.org (Non Profit Making Organisations)
25679 0.51%.fi (Finland)
33204 0.50%.jp (Japan)
41044 0.46%.nl (Netherlands)
30128 0.40%.hu (Hungary)
33337 0.39%.gov (USA Government)
16914 0.36%.fr (France)
28086 0.31%.mil (USA Military)
21910 0.29%.de (Germany)
28398 0.29%.nz (New Zealand)
26414 0.28%.sg (Singapore)
24794 0.27%.pl (Poland)
16166 0.26%.se (Sweden)
13970 0.23%.be (Belgium)
15159 0.21%.br (Brazil)
16289 0.19%.it (Italy)
10286 0.13%.mx (Mexico)
10133 0.12%.il (Israel)
7985 0.11%.tr (Turkey)
9583 0.10%.ar (Argentina)
7009 0.10%.ch (Switzerland)
7754 0.10%.no (Norway)
5901 0.09%.ee (Estonia)
7327 0.08%.gr (Greece)
6093 0.08%.th (Thailand)
5222 0.08%.dk (Denmark)
5286 0.07%[domain not given]
12781 0.07%.lu (Luxembourg)
6315 0.06%.at (Austria)
5959 0.06%.pt (Portugal)
4953 0.06%.hk (Hong Kong)
3912 0.04%.tw (Taiwan)
2728 0.04%.ru (Russia)
3411 0.04%.my (Malaysia)
2751 0.03%.es (Spain)
2091 0.03%.lt (Lithuania)
3289 0.03%.hr (Croatia)
2775 0.03%.is (Iceland)
2587 0.03%.ro (Romania)
1969 0.03%.pe (Peru)
2924 0.03%.arpa (Arpanet)
1252 0.03%.lv (Latvia)
3193 0.03%.tt (Trinidad and Tobago)
2641 0.03%.cz (Czech Republic)
3005 0.03%.ph (Philippines)
2063 0.02%.id (Indonesia)
1459 0.02%.bg (Bulgaria)
1977 0.02%.sk (Slovakia)
2322 0.02%.za (South Africa)
1758 0.02%[unknown domain]
1683 0.02%.sa (Saudi Arabia)
1740 0.02%.co (Colombia)
978 0.02%.yu (Former Yugoslavia)
1077 0.02%.cl (Chile)
2193 0.01%.in (India)
1800 0.01%.cc (Cocos (Keeling) Islands)
976 0.01%.eg (Egypt)
1041 0.01%.mt (Malta)
1589 0.01%.aw (Aruba)
811 0.01%.uy (Uruguay)
925 0.01%.cy (Cyprus)
736 0.01%.si (Slovenia)
1075 0.01%.ie (Ireland)
664 0.01%.ma (Morocco)
590 0.01%.nu (Niue)
497 0.01%.tv (Tuvalu)
338 0.01%.to (Tonga)
296 0.01%.aero (Air Transport Industry)
517 0.01%.do (Dominican Republic)
320 0.01%.mm (Myanmar)
314 0.01%.biz (Businesses)
388 .gt (Guatemala)
226 .ws (Samoa)
323 .ae (United Arab Emirates)
464 .bm (Bermuda)
283 .cr (Costa Rica)
324 .pk (Pakistan)
83 .al (Albania)
234 .py (Paraguay)
260 .om (Oman)
147 .ua (Ukraine)
232 .dm (Dominica)
106 .ge (Georgia)
189 .info (Informational)
108 .gh (Ghana)
167 .ba (Bosnia-Herzegovina)
324 .int (International Treaty Organisations)
99 .ve (Venezuela)
140 .lk (Sri Lanka)
155 .by (Belarus)
67 .jo (Jordan)
128 .hn (Honduras)
196 .lb (Lebanon)
106 .ir (Iran)
27 .am (Armenia)
160 .md (Moldova)
58 .coop (Co-operatives)
74 .jm (Jamaica)
153 .gi (Gibraltar)
75 .bs (Bahamas)
51 .kr (South Korea)
60 .zm (Zambia)
111 .cn (China)
70 .na (Namibia)
58 .tz (Tanzania)
75 .vi (Virgin Islands (USA))
75 .qa (Qatar)
105 .mu (Mauritius)
65 .cu (Cuba)
90 .zw (Zimbabwe)
141 .ky (Cayman Islands)
20 .ms (Montserrat)
36 .mz (Mozambique)
22 .ec (Ecuador)
37 .tg (Togo)
50 .bn (Brunei Darussalam)
16 .li (Liechtenstein)
67 .sy (Syria)
37 .ke (Kenya)
40 .np (Nepal)
30 .ml (Mali)
27 .ci (Ivory Coast)
35 .pr (Puerto Rico)
22 .an (Netherlands Antilles)
29 .im (Isle of Man)
32 .fj (Fiji)
31 .mv (Maldives)
19 .bw (Botswana)
16 .kg (Kyrgyzstan)
10 .ad (Andorra)
24 .fm (Micronesia)
31 .vn (Vietnam)
33 .pg (Papua New Guinea)
16 .gg (Guernsey)
4 .kn (Saint Kitts and Nevis)
5 .bz (Belize)
20 .mk (Macedonia (Former Yugoslav Republic))
5 .pf (French Polynesia)
11 .ac (Ascension Island)
12 .vu (Vanuatu)
9 .sh (Saint Helena)
17 .kz (Kazakhstan)
4 .gy (Guyana)
3 .su (Former USSR)
1 .st (Saint Tome and Principe)
1 .gl (Greenland)
4 .sc (Seychelles)

Organisation Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the organisations of the computers which requested files.

Listing the top 20 organisations by the number of requests, sorted by the number of requests.

reqs%bytesorganisation
805638 8.21%comcast.net
510814 5.30%rr.com
349083 3.81%cox.net
286770 3.75%aol.com
266992 2.95%pacbell.net
251116 2.57%verizon.net
169700 1.81%adelphia.net
156553 1.55%bellsouth.net
150977 1.54%optonline.net
142827 1.42%swbell.net
133752 1.34%charter.com
131759 1.27%ameritech.net
119334 1.13%qwest.net
104464 1.36%shawcable.net
102869 1.15%rogers.com
100650 1.00%attbi.com
97840 0.72%level3.net
94760 0.97%btcentralplus.com
84610 0.94%sympatico.ca
80906 0.88%mindspring.com
538461656.31%[not listed: 24,264 organisations]

Search Word Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists which words people used in search engines to find the site.

Listing the top 30 query words by the number of requests, sorted by the number of requests.

reqssearch term
50816rabbit
36058rabbits
27128easter
25438bunny
11953pictures
11419bunnies
9276language
9196body
8790of
8149care
6460house
6357baby
5280a
3868for
3827society
3817to
3345how
3095pet
2950the
2183facts
2005and
1977what
1926poem
1923in
1576wild
1455is
1374litter
1326history
1271about
1230cute
116938[not listed: 7,531 search terms]

Operating System Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the operating systems used by visitors.

Listing operating systems, sorted by the number of requests for pages.

no.reqspagesOS
188979311693881Windows
 66412441262180  Windows XP
 1136943225071  Windows 2000
 745067133222  Windows 98
 25478645905  Windows ME
 5038011430  Windows NT
 230465858  Windows 95
 244175046  Unknown Windows
 207745025  Windows Server 2003
 1249135  Windows CE
 259  Windows 3.1
242864496284Macintosh
35668442373Known robots
49190637540OS unknown
5302108480Unix
 268347072  Linux
 15271081  BSD
 1724318  SunOS
 913  IRIX
 233  Other Unix
 113  HP-UX
651431025WebTV
76325Symbian OS
8455OS/2
9202RISC OS
1032Amiga
1110BeOS

Status Code Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the HTTP status codes of all requests.

Listing status codes, sorted numerically.

reqsstatus code
8061642200 OK
25384206 Partial content
15758301 Document moved permanently
2349302 Document found elsewhere
1439004304 Not modified since last retrieval
427400 Bad request
120401 Authentication required
38403 Access forbidden
60164404 Document not found
400405 Method not allowed
1291408 Request timeout
40414 Requested filename too long
61416 Requested range not valid
3501 Request type not supported

File Size Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the sizes of files.

sizereqs%bytes
01478400 
1B- 10B120 
11B- 100B358328 0.02%
101B- 1kB1660414 0.62%
1kB- 10kB350686119.45%
10kB-100kB246167667.40%
100kB- 1MB6019912.46%
1MB- 10MB32 0.05%

File Type Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the extensions of files.

Listing extensions with at least 0.1% of the traffic, sorted by the amount of traffic.

reqs%bytesextension
171743147.41%.jpg [JPEG graphics]
508733715.69%.gif [GIF graphics]
146999115.49%.html [Hypertext Markup Language]
40639611.52%[directories]
119055 4.50%.JPG
438096 2.13%.cgi [CGI scripts]
13796 2.00%.pdf [Adobe Portable Document Format]
2925 0.36%.bmp
16662 0.31%.png [PNG graphics]
9653 0.14%.txt [Plain text]
164983 0.11%.js [JavaScript code]
79705 0.35%[not listed: 27 extensions]

Directory Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the directories from which files were requested. (The figures for each directory include all of its subdirectories.)

Listing directories with at least 0.01% of the traffic, sorted by the amount of traffic.

reqs%bytesdirectory
527839654.51%/graphics/
91726512.20%/chapters/
1049941 8.87%/fun/
449802 8.05%/rabbit-center/
286001 3.64%/journal/
140453 2.67%/faq/
439006 2.14%/cgi-bin/
152195 1.91%[root directory]
228305 1.71%/easter/
102751 1.49%/care/
29046 0.56%/hrs-info/
45198 0.48%/links/
38159 0.44%/behavior/
29809 0.43%/adoption/
17415 0.26%/health/
167516 0.11%/spam_vaccine/
761 0.09%/adopt-a-rabbit-month/
7688 0.08%/kids/
6540 0.06%/translations/
2907 0.05%/help/
4176 0.05%/vets/
27129 0.05%/styles/
2730 0.03%/opinion/
1336 0.02%/faqgerman/
2860 0.02%/postcard/
2677 0.02%/stories/
92013 0.02%/icons/
1771 0.01%/chat/
2184 0.03%[not listed: 14 directories]

Request Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the files on the site.

Listing files with at least 20 requests, sorted by the number of requests.

reqs%byteslast timefile
960684 7.79%29/Mar/05 09:59/fun/net-bunnies.html
360341 0.01%29/Mar/05 09:59/graphics/resources/pixel.gif
333585 0.82%29/Mar/05 09:59/graphics/logo-footer.gif
319822 0.03%29/Mar/05 09:59/graphics/foot-line.gif
310566 0.44%29/Mar/05 09:59/graphics/banners/top.gif
310533 0.17%29/Mar/05 09:59/graphics/banners/bottom.gif
291717 1.88%29/Mar/05 09:47/cgi-bin/chat/chat.cgi
3509 0.02% 7/Mar/05 21:12  /cgi-bin/chat/chat.cgi?action=chat&id=zrtdsudlyslgdidwhvdtjhqfpqahdq
3003 0.02% 9/Mar/05 23:28  /cgi-bin/chat/chat.cgi?action=chat&id=vxriozyyoawqxerkdtthugozxmhthi
2136 0.01%20/Mar/05 19:30  /cgi-bin/chat/chat.cgi?action=chat&id=fmeuppsadtpwrwofqbvyuteztiqkdj&pause=
2107 0.01%10/Mar/05 21:12  /cgi-bin/chat/chat.cgi?action=chat&id=zplyawyzfijbyqcknrfwtfhheehzva
2106 0.02%18/Mar/05 19:27  /cgi-bin/chat/chat.cgi?action=chat&id=hsnrofdjzdtfhjimgzwdvchgvylafc
2071 0.01%17/Mar/05 20:58  /cgi-bin/chat/chat.cgi?action=chat&id=oprbcpfwlawqblpghbyzjjfxnumfyf
2054 0.01% 6/Mar/05 19:43  /cgi-bin/chat/chat.cgi?action=chat&id=wsgcoadxkkupsvyhnffjdzjouuftbp
1889 0.01% 1/Mar/05 22:56  /cgi-bin/chat/chat.cgi?action=chat&id=ninoulcxenvgtugtefnnuqwpnvmfzj
1852 0.01% 3/Mar/05 20:35  /cgi-bin/chat/chat.cgi?action=chat&id=aincyaxpeoxbfkzamxqwrpjcletydc
1835 0.01%10/Mar/05 18:08  /cgi-bin/chat/chat.cgi?action=chat&id=zplyawyzfijbyqcknrfwtfhheehzva&pause=
1776 0.01% 4/Mar/05 20:03  /cgi-bin/chat/chat.cgi?action=chat&id=jvrpocomcxhwrcouoqcnesbfgrlpqo
1768 0.01% 4/Mar/05 20:31  /cgi-bin/chat/chat.cgi?action=chat&id=cxvzhizqvvyymaytaogbbygfaxuxnt
1731 0.01%18/Mar/05 18:37  /cgi-bin/chat/chat.cgi?action=chat&id=vfgvwjyafhyvvhhwrvjkrqseixorsj&pause=
1728 0.01% 5/Mar/05 20:41  /cgi-bin/chat/chat.cgi?action=chat&id=qftnksxddzyujcysywhztdaatyjifk&pause=
1606 0.01%25/Mar/05 20:20  /cgi-bin/chat/chat.cgi?action=chat&id=oenrzoxapavpjwfgkfvctjcnyuqmla
1596 0.01% 2/Mar/05 20:15  /cgi-bin/chat/chat.cgi?action=chat&id=ephdetvgumayaecdbpqhwsihpyznbk
1572 0.01%12/Mar/05 14:31  /cgi-bin/chat/chat.cgi?action=chat&id=knihqtsxwevjmhtbufjyqaslmlidpb
1518 0.01%11/Mar/05 18:50  /cgi-bin/chat/chat.cgi?action=chat&id=tvsordfvbhqxylwynzbjpcgqnnwpja
1487 0.01% 2/Mar/05 19:46  /cgi-bin/chat/chat.cgi?action=chat&id=iirrpcxfraldzpejkpzudcfsemiisx
1466 0.01%19/Mar/05 22:12  /cgi-bin/chat/chat.cgi?action=chat&id=iqrusrwrffspftelrmwcvwftcvlvuv
1425 0.01% 5/Mar/05 20:41  /cgi-bin/chat/chat.cgi?action=chat&id=hpvjtyeejryxdelwwjpfgeyomjccdq
1406 0.01%27/Mar/05 19:50  /cgi-bin/chat/chat.cgi?action=chat&id=gnqqalmzdfjlizvabavyddhrodtjnv
1405 0.01%25/Mar/05 18:04  /cgi-bin/chat/chat.cgi?action=chat&id=dbymtmaayxgixvecgaobosviyfgxlz&pause=
1404 0.01%20/Mar/05 19:10  /cgi-bin/chat/chat.cgi?action=chat&id=hwsbjqlisfhbvfgeumvwtcpocohobl&pause=
1351 0.01% 3/Mar/05 17:49  /cgi-bin/chat/chat.cgi?action=chat&id=aincyaxpeoxbfkzamxqwrpjcletydc&pause=
1312 0.01%11/Mar/05 20:10  /cgi-bin/chat/chat.cgi?action=chat&id=fdqyormkkijrzwluihiiqdwdkdwils
1304 0.01% 4/Mar/05 20:00  /cgi-bin/chat/chat.cgi?action=chat&id=lvrukcstvdoeaykmsyskgkalpvqqks&pause=
1303 0.01%17/Mar/05 17:50  /cgi-bin/chat/chat.cgi?action=chat&id=oprbcpfwlawqblpghbyzjjfxnumfyf&pause=
1286 0.01% 5/Mar/05 20:00  /cgi-bin/chat/chat.cgi?action=chat&id=bedvhlbdljtcnlheisxcpjjvjtrbwp
1252 0.01% 3/Mar/05 18:11  /cgi-bin/chat/chat.cgi?action=chat&id=xjlsuemvrqdzkqlbotcvpobaijzonb
1250 0.01% 6/Mar/05 00:14  /cgi-bin/chat/chat.cgi?action=chat&id=bhfxnfqhfuavedbfcpjlnpxkjbsudj
1204 0.01% 2/Mar/05 19:56  /cgi-bin/chat/chat.cgi?action=chat&id=gywteocvahpiqavhglowxuosjgurkm&pause=
1201 0.01%13/Mar/05 19:20  /cgi-bin/chat/chat.cgi?action=chat&id=eqrtodhwyhujpixtwwinmslvkeqdfh
1190 0.01% 8/Mar/05 19:09  /cgi-bin/chat/chat.cgi?action=chat&id=bzfrfsgqvujolwsvpxlkrpmkytplvz
1178 0.01%12/Mar/05 21:50  /cgi-bin/chat/chat.cgi?action=chat&id=hjatbkulnfviwkonpcjnecbtvqjfgg
1177 0.01%19/Mar/05 22:05  /cgi-bin/chat/chat.cgi?action=chat&id=huyaiekoezahvqgocqohqtqayjdzso&pause=
1170 0.01%25/Mar/05 14:58  /cgi-bin/chat/chat.cgi?action=chat&id=oztgjpctfbxytsbdtklosrohgxdjrr
1147 0.01% 6/Mar/05 19:15  /cgi-bin/chat/chat.cgi?action=chat&id=fajfrrtfkawoukxryhzxdpcfmuzidl
1131 0.01% 9/Mar/05 19:40  /cgi-bin/chat/chat.cgi?action=chat&id=kwltcoizhlyrxshvaftclmsxlhrstf&pause=
1125 0.01%22/Mar/05 18:02  /cgi-bin/chat/chat.cgi?action=chat&id=wklxuveeuemwtdbdasjrvirgmmnlbr&pause=
1121 0.01%23/Mar/05 17:53  /cgi-bin/chat/chat.cgi?action=chat&id=jvqukmoqdkpfgkokegpxutdrovuspf&pause=
1033 0.01% 4/Mar/05 20:35  /cgi-bin/chat/chat.cgi?action=chat&id=svjnpelclwjkxgmyjdvxqcskbwiyup&pause=
1024 0.01% 9/Mar/05 18:38  /cgi-bin/chat/chat.cgi?action=chat&id=jbollhrtzimsbxirflmzurbxeqmzzx&pause=
1024 0.01%26/Mar/05 17:10  /cgi-bin/chat/chat.cgi?action=chat&id=qdjxabrvimcgajqywzqiyzaqzheexh&pause=
1015  6/Mar/05 16:01  /cgi-bin/chat/chat.cgi?action=chat&id=alywxsfnkplwqvumbllbmmxqnurxls&pause=
1004 0.01%21/Mar/05 19:15  /cgi-bin/chat/chat.cgi?action=chat&id=lujtqozdbefduaevraxqjdmbqunrbj&pause=
970 0.01%17/Mar/05 20:22  /cgi-bin/chat/chat.cgi?action=chat&id=wjmcfdrauscmidjmxldedqdqydaugc&pause=
967 15/Mar/05 13:09  /cgi-bin/chat/chat.cgi?action=chat&id=mhjnisnuohmoszphbwqsnpyaaayaju&pause=
960 0.01%12/Mar/05 21:52  /cgi-bin/chat/chat.cgi?action=chat&id=ifkpxbsqqizohbquiosaqfzrmrhfmu&pause=
957 0.01%19/Mar/05 20:55  /cgi-bin/chat/chat.cgi?action=chat&id=jevwbitssgngozecqnlxtcvputubgf&pause=
953 0.01%16/Mar/05 20:13  /cgi-bin/chat/chat.cgi?action=chat&id=yqihhsvshbmrsymeigczpbbnittxsr
949 21/Mar/05 18:43  /cgi-bin/chat/chat.cgi?action=chat&id=zyutvmqgeetlddwsbszmjqfmkjakdy&pause=
929 0.01%25/Mar/05 19:27  /cgi-bin/chat/chat.cgi?action=chat&id=dbymtmaayxgixvecgaobosviyfgxlz
928 0.01% 4/Mar/05 20:32  /cgi-bin/chat/chat.cgi?action=chat&id=utrulvfonmmclsiskadgajhzgfxurf
926 0.01% 7/Mar/05 19:51  /cgi-bin/chat/chat.cgi?action=chat&id=xieilhvbwlwgfyrndguxuxfhxpbxbt&pause=
924 0.01% 6/Mar/05 17:48  /cgi-bin/chat/chat.cgi?action=chat&id=yovyhsifrrylprkplmqnozxmsphwjp
886 0.01% 1/Mar/05 20:52  /cgi-bin/chat/chat.cgi?action=chat&id=iltygagqesvrrnglhfumqaamiqsrst
872 0.01%26/Mar/05 20:06  /cgi-bin/chat/chat.cgi?action=chat&id=zleuqfsjyzqmjgcnmdrjryemukuixu&pause=
869 0.01% 3/Mar/05 19:45  /cgi-bin/chat/chat.cgi?action=chat&id=ozuugvqkndlvoxhnhguvkupnisqlph
868 0.01% 5/Mar/05 15:02  /cgi-bin/chat/chat.cgi?action=chat&id=zstniwzzyzazvenbsseobzhwyvapgq&pause=
861 0.01% 5/Mar/05 15:07  /cgi-bin/chat/chat.cgi?action=chat&id=qljgzrdoaeukqsptdvilmsueucbaob&pause=
852 0.01% 6/Mar/05 19:53  /cgi-bin/chat/chat.cgi?action=chat&id=hixdrspvfisbguusyawvurqajyvaty&pause=
851 0.01%16/Mar/05 20:34  /cgi-bin/chat/chat.cgi?action=chat&id=njfjjxcrpkapvlfhoztzbrtzxeqlie
849 0.01%28/Mar/05 12:49  /cgi-bin/chat/chat.cgi?action=chat&id=qgxbkemnzlcogcthhxatqjocecfpyk
845 0.01% 8/Mar/05 17:31  /cgi-bin/chat/chat.cgi?action=chat&id=luyclivadzjoqwvwwhixvladbtqwno
843 0.01% 1/Mar/05 21:51  /cgi-bin/chat/chat.cgi?action=chat&id=kpuaciifklicwdiykrpvinduzxvixv
838 0.01%14/Mar/05 20:57  /cgi-bin/chat/chat.cgi?action=chat&id=bzusjhjtvuupdwjlynbalzcjrqhdta&pause=
837 0.01%17/Mar/05 20:58  /cgi-bin/chat/chat.cgi?action=chat&id=jmqjzwilzrrcjrvnfmrqpnpkvnveud&pause=
836 0.01% 5/Mar/05 19:19  /cgi-bin/chat/chat.cgi?action=chat&id=tsgpqfqnavirstzyzjxetfjsbgqlcm
819 0.01%12/Mar/05 15:45  /cgi-bin/chat/chat.cgi?action=chat&id=sxrucxibjhthyqmkzuzifdwuuhedlx
815 0.01% 1/Mar/05 20:52  /cgi-bin/chat/chat.cgi?action=chat&id=vklscgzfrxmdntkebmazzpkwsypvxc&pause=
814 0.01%22/Mar/05 20:41  /cgi-bin/chat/chat.cgi?action=chat&id=lhiiqoatfncebapsvvmnkjvygjnndj
813 15/Mar/05 18:42  /cgi-bin/chat/chat.cgi?action=chat&id=svttdxaxqgtbnfdmmmrjchzyyvrcii&pause=
808 0.01% 3/Mar/05 18:38  /cgi-bin/chat/chat.cgi?action=chat&id=jlrzwotozxzalwfpuffltpsclmixoy
800 0.01%16/Mar/05 17:14  /cgi-bin/chat/chat.cgi?action=chat&id=skzbjmcgmkjmjgneetuqnuikymtxkp
799 0.01% 1/Mar/05 19:53  /cgi-bin/chat/chat.cgi?action=chat&id=fcadknodbabxjaatdslmweyznevdrk
795 0.01% 7/Mar/05 18:32  /cgi-bin/chat/chat.cgi?action=chat&id=cwqbfjwdxkwgijhwjnbqqkabvvwzle&pause=
793 0.01% 5/Mar/05 23:35  /cgi-bin/chat/chat.cgi?action=chat&id=wdaftszkjiojgwjmaukexvnhkctyil
781 0.01% 2/Mar/05 20:04  /cgi-bin/chat/chat.cgi?action=chat&id=qfpnllrsyjibgzzbuafjlbtotpfarj&pause=
774 0.01%14/Mar/05 21:41  /cgi-bin/chat/chat.cgi?action=chat&id=koydffiiclxuhlhajsazbepkkonesn&pause=
753 0.01%11/Mar/05 20:14  /cgi-bin/chat/chat.cgi?action=chat&id=ahregkimuugknyiosdbrdlehaijdua&pause=
752 0.01%20/Mar/05 20:36  /cgi-bin/chat/chat.cgi?action=chat&id=whoejzwitcbtemidhbymykjfqpowjm&pause=
752 0.01%19/Mar/05 20:36  /cgi-bin/chat/chat.cgi?action=chat&id=uxanqezpwwhbawmjxvidkkmmyyiymx&pause=
747 0.01%12/Mar/05 14:27  /cgi-bin/chat/chat.cgi?action=chat&id=fzavmwtqanrmoiizeselzvtmhlbllm&pause=
743 0.01%18/Mar/05 20:32  /cgi-bin/chat/chat.cgi?action=chat&id=fqxddynlxvrhgsgefhmmdfnenpvics&pause=
741  1/Mar/05 19:10  /cgi-bin/chat/chat.cgi?action=chat&id=bfykkxzfrivyefqhmeaaayfiyfrvst&pause=
738 0.01%20/Mar/05 20:36  /cgi-bin/chat/chat.cgi?action=chat&id=fmeuppsadtpwrwofqbvyuteztiqkdj
733 0.01% 3/Mar/05 17:38  /cgi-bin/chat/chat.cgi?action=chat&id=yeaxukiodtedtjlnxoqwokhkolrfiv
723 14/Mar/05 17:41  /cgi-bin/chat/chat.cgi?action=chat&id=tomfppeczqbiwznmcwrjdmcoplrqvw
719 15/Mar/05 20:35  /cgi-bin/chat/chat.cgi?action=chat&id=nrtzgmcsoibazafzhxvgebbwnzqwok&pause=
715  2/Mar/05 18:09  /cgi-bin/chat/chat.cgi?action=chat&id=tebztwdajeupyayrxjnjoikuehgrjq&pause=
710 0.01%10/Mar/05 20:49  /cgi-bin/chat/chat.cgi?action=chat&id=lgcdgrslzgkrgnddpywozzfzerolej
710 0.01%26/Mar/05 16:56  /cgi-bin/chat/chat.cgi?action=chat&id=nurjesygryzqriyetfpmvlvavimnqv
704  8/Mar/05 19:36  /cgi-bin/chat/chat.cgi?action=chat&id=vhlbkyqxqmkcwcxvusioycqgijgyvd&pause=
703 11/Mar/05 19:32  /cgi-bin/chat/chat.cgi?action=chat&id=iycaiijifbirbzcmfkswtowjysmkfw&pause=
703 15/Mar/05 18:00  /cgi-bin/chat/chat.cgi?action=chat&id=iiwutrvrhasvczxtjyypqzarnrfupp&pause=
699 0.01% 1/Mar/05 18:33  /cgi-bin/chat/chat.cgi?action=chat&id=wxbnmdhngmialtpqaluvdswjpwqxcp
694 25/Mar/05 17:44  /cgi-bin/chat/chat.cgi?action=chat&id=idjulnhbnpbpxqjxotqrarnmrrmtkk
688 25/Mar/05 14:21  /cgi-bin/chat/chat.cgi?action=chat&id=mgkcjpxibqgaocynopsdxgajmvamho
687 0.01% 1/Mar/05 20:09  /cgi-bin/chat/chat.cgi?action=chat&id=ettyctoapddmmehvushtyfbyqjdeuh
687  7/Mar/05 22:32  /cgi-bin/chat/chat.cgi?action=chat&id=aciocjvjgzqdlxwpxllulbqohawpzm
686  8/Mar/05 20:04  /cgi-bin/chat/chat.cgi?action=chat&id=nahzyxxdrltsjzwvfbljbguajippnn
682 12/Mar/05 20:59  /cgi-bin/chat/chat.cgi?action=chat&id=wwqvkjvvnzwzhszfedftjtbmduyswq&pause=
671  6/Mar/05 20:00  /cgi-bin/chat/chat.cgi?action=chat&id=jlfvdmbtvypcsmedkzcdocbzqvario&pause=
671 12/Mar/05 16:00  /cgi-bin/chat/chat.cgi?action=chat&id=ncwlugfbsckfejocrymshzfnggimim&pause=
670  7/Mar/05 20:11  /cgi-bin/chat/chat.cgi?action=chat&id=npryjquixhutzkqwgfbrdzfrrehggw
670 25/Mar/05 15:01  /cgi-bin/chat/chat.cgi?action=chat&id=gscxixpccgicdmvdppahaezjcazqap&pause=
669 26/Mar/05 17:08  /cgi-bin/chat/chat.cgi?action=chat&id=oukeedrcsrbhssncbclhfuujkarjgh
656 0.01%22/Mar/05 19:26  /cgi-bin/chat/chat.cgi?action=chat&id=uodbkauexpfyvspxagbzyqtlmcftpb
643  3/Mar/05 19:52  /cgi-bin/chat/chat.cgi?action=chat&id=yunqnslqgvkpmwdhlmaywcwiieigvr&pause=
642  7/Mar/05 21:28  /cgi-bin/chat/chat.cgi?action=chat&id=auyidioxvroqrxoufseuybclqoionz&pause=
641 19/Mar/05 19:55  /cgi-bin/chat/chat.cgi?action=chat&id=zipjmgfotxoxtnnzrcyribkwlrgfrj&pause=
641 25/Mar/05 20:07  /cgi-bin/chat/chat.cgi?action=chat&id=qcdmgaetvuqecbqctcbpitqnyxukwv
637 19/Mar/05 22:10  /cgi-bin/chat/chat.cgi?action=chat&id=yoepufqdumqregiibeyajfqaacnssg
631 19/Mar/05 20:16  /cgi-bin/chat/chat.cgi?action=chat&id=zkmkojcygbdxxauuqjsqahkinwghhs
626 10/Mar/05 18:13  /cgi-bin/chat/chat.cgi?action=chat&id=prnpohiwbcmrjyuqhucbfotuxntnut&pause=
626 19/Mar/05 20:15  /cgi-bin/chat/chat.cgi?action=chat&id=dkkifcffhvzlhnxeknktwfrjyrapjx&pause=
623 17/Mar/05 20:32  /cgi-bin/chat/chat.cgi?action=chat&id=hdqcstwisdjwbvwhqpsbptegtfncjj
623 22/Mar/05 19:46  /cgi-bin/chat/chat.cgi?action=chat&id=uapenimepifmladkkmapetjvrzrnma&pause=
619 27/Mar/05 18:22  /cgi-bin/chat/chat.cgi?action=chat&id=kiorlgnoefpdvzctljpiyuzqudhmus
618 14/Mar/05 20:10  /cgi-bin/chat/chat.cgi?action=chat&id=rvhlxgdkgvknqhsyzwbpxhzlwagcsv&pause=
617 10/Mar/05 20:10  /cgi-bin/chat/chat.cgi?action=chat&id=pzdpaahzfavbvixpzhipvslabdevmq
615 18/Mar/05 20:32  /cgi-bin/chat/chat.cgi?action=chat&id=ohubvjowiwbdjlhgmwsukabwhgxchn&pause=
615  4/Mar/05 20:03  /cgi-bin/chat/chat.cgi?action=chat&id=igbszostmpvovuzcgfxoftadjurdjp&pause=
611 13/Mar/05 17:41  /cgi-bin/chat/chat.cgi?action=chat&id=wnhvmzoywvkjnypksrwbgbltoqrzvq&pause=
611 11/Mar/05 20:56  /cgi-bin/chat/chat.cgi?action=chat&id=vphbmgpdxfnstdzwjtcnummetrrqmf&pause=
610  6/Mar/05 17:32  /cgi-bin/chat/chat.cgi?action=chat&id=sxrynlseardvwqscytscnlbtifxqhx
609  5/Mar/05 20:03  /cgi-bin/chat/chat.cgi?action=chat&id=mvpamyiohiupvficyjsmqzirlipyal
600 17/Mar/05 19:29  /cgi-bin/chat/chat.cgi?action=chat&id=yscjsamdonpugcyurzlqqvszzaztwi&pause=
598 14/Mar/05 19:57  /cgi-bin/chat/chat.cgi?action=chat&id=lhyrnhohlehgwpvabmdthtbylaahhc&pause=
594  1/Mar/05 20:49  /cgi-bin/chat/chat.cgi?action=chat&id=zdxhrsawzftqclywayxjuzmjwnakgs
594  1/Mar/05 22:55  /cgi-bin/chat/chat.cgi?action=chat&id=foiyhorwirzxayncooxdgutjryhqre
585  2/Mar/05 17:58  /cgi-bin/chat/chat.cgi?action=chat&id=ephdetvgumayaecdbpqhwsihpyznbk&pause=
584 27/Mar/05 19:50  /cgi-bin/chat/chat.cgi?action=chat&id=zhsqnplogtqmigwcaefyykewramgfg&pause=
583 19/Mar/05 20:35  /cgi-bin/chat/chat.cgi?action=chat&id=sflvhvtkyiqwytfiinhrhltzcmpqih
582 11/Mar/05 19:02  /cgi-bin/chat/chat.cgi?action=chat&id=nsqltfbegulxfjmmaptxucpvecafam&pause=
580 13/Mar/05 17:24  /cgi-bin/chat/chat.cgi?action=chat&id=rklqrcnnwretkledvlvtldifszctig&pause=
574 18/Mar/05 19:57  /cgi-bin/chat/chat.cgi?action=chat&id=cyefavtmlsylchoctcqfrfdhrytusg&pause=
572 18/Mar/05 19:41  /cgi-bin/chat/chat.cgi?action=chat&id=odlipkmugpbrojhhaoeezdeajovpye
569 12/Mar/05 20:05  /cgi-bin/chat/chat.cgi?action=chat&id=hjatbkulnfviwkonpcjnecbtvqjfgg&pause=
568  7/Mar/05 20:14  /cgi-bin/chat/chat.cgi?action=chat&id=urgdovbkoincuscvuhdljarzmqkklm&pause=
567  7/Mar/05 18:50  /cgi-bin/chat/chat.cgi?action=chat&id=fjwgvxpreojjmdfhsnkrokfuesjtjo
566 10/Mar/05 14:05  /cgi-bin/chat/chat.cgi?action=chat&id=izdxetpjmkfqucerikdlvctulmyzjs
565 16/Mar/05 18:51  /cgi-bin/chat/chat.cgi?action=chat&id=qswszxsplolyltsjxhwnxzxeeglsjy&pause=
564 25/Mar/05 20:11  /cgi-bin/chat/chat.cgi?action=chat&id=zxrrghjjljqnrrxohwgpiccvdmxafg&pause=
563 21/Mar/05 19:51  /cgi-bin/chat/chat.cgi?action=chat&id=otvzpvswnifpbdbzckzntsfdrzxfqs&pause=
559 12/Mar/05 20:08  /cgi-bin/chat/chat.cgi?action=chat&id=jporuzuzptrgsrfscoansmdvvwxnkq&pause=
557  6/Mar/05 19:57  /cgi-bin/chat/chat.cgi?action=chat&id=xudklqcfxglqfxjigetwywsnnzcobn&pause=
556 16/Mar/05 20:07  /cgi-bin/chat/chat.cgi?action=chat&id=wtgucfuigcticrtogzdrdsyyztdlfn
552 12/Mar/05 17:21  /cgi-bin/chat/chat.cgi?action=chat&id=sxrucxibjhthyqmkzuzifdwuuhedlx&pause=
551 27/Mar/05 18:57  /cgi-bin/chat/chat.cgi?action=chat&id=esbotvambysnimopzvfflntcqkryzo
548 13/Mar/05 18:34  /cgi-bin/chat/chat.cgi?action=chat&id=bpsnfsgfctnzklhtjnbursvqmmtgmf&pause=
548 12/Mar/05 15:54  /cgi-bin/chat/chat.cgi?action=chat&id=frgqlcuvoujhocjgkulvbkcivcqmhu
542  3/Mar/05 16:59  /cgi-bin/chat/chat.cgi?action=chat&id=zjqrcscubjqifktpvugypxlkynyeyp
537 14/Mar/05 21:33  /cgi-bin/chat/chat.cgi?action=chat&id=qfeyqbsxkqheglhezlnbbbozkmqdxs
537 22/Mar/05 19:03  /cgi-bin/chat/chat.cgi?action=chat&id=mygkqzzoscwjlzagocmtgclokhpczb&pause=
529  5/Mar/05 19:44  /cgi-bin/chat/chat.cgi?action=chat&id=dkrpxuikyudmcqmizaswdqrypcyqkw&pause=
527 18/Mar/05 18:08  /cgi-bin/chat/chat.cgi?action=chat&id=kbhkhwhaoxphhpkzfgveqyeuttrcxq
525 16/Mar/05 17:13  /cgi-bin/chat/chat.cgi?action=chat&id=ubfygxvmzhleozklnalvpqlbushuno
524  9/Mar/05 19:52  /cgi-bin/chat/chat.cgi?action=chat&id=hjrkfixsptqqrtyenkiuxagafaedpt
522 11/Mar/05 20:59  /cgi-bin/chat/chat.cgi?action=chat&id=mlugpmbjjwsgxlzotlesglwlboirvw
522  1/Mar/05 19:35  /cgi-bin/chat/chat.cgi?action=chat&id=qboiyrjyncjtlwpkttyaopofgdkerg
519 12/Mar/05 20:39  /cgi-bin/chat/chat.cgi?action=chat&id=vdcifchkuhseeucbpynfptezpsamdu&pause=
516  5/Mar/05 19:49  /cgi-bin/chat/chat.cgi?action=chat&id=ntjidcrwnfsokdbezjvvvzfgibffwq&pause=
509  3/Mar/05 16:12  /cgi-bin/chat/chat.cgi?action=chat&id=zjqrcscubjqifktpvugypxlkynyeyp&pause=
502 19/Mar/05 20:08  /cgi-bin/chat/chat.cgi?action=chat&id=lbpjjuohkvkvprbzkezlqpbrlptkcs&pause=
493  6/Mar/05 17:58  /cgi-bin/chat/chat.cgi?action=chat&id=vwwbshibtmfytqbmebhwsqmqttxqfe
491 15/Mar/05 20:17  /cgi-bin/chat/chat.cgi?action=chat&id=wpqiqexhqlmlsybpbzrvphkyxoptzn
490 22/Mar/05 20:09  /cgi-bin/chat/chat.cgi?action=chat&id=wgvyqwmpzwdfckeouurgqqdneftsxu&pause=
489 11/Mar/05 20:45  /cgi-bin/chat/chat.cgi?action=chat&id=lkminsvbbnuileisuizfennaqyhckp
488 20/Mar/05 14:47  /cgi-bin/chat/chat.cgi?action=chat&id=rrqvlgyfdhmagntucieezktxfiqxyt
487 26/Mar/05 20:10  /cgi-bin/chat/chat.cgi?action=chat&id=tjxikmjooidhyiykxlocnkjkialzdy
485 26/Mar/05 20:55  /cgi-bin/chat/chat.cgi?action=chat&id=czgruwfsrbmxfdkqrvfkajifglshgk
481 12/Mar/05 20:59  /cgi-bin/chat/chat.cgi?action=chat&id=yxrxmivrgiysajctyfdcvxewdwvdji&pause=
479 10/Mar/05 18:23  /cgi-bin/chat/chat.cgi?action=chat&id=nxnkqkvoiqsyrqxwwfxydmvbvuhgtw&pause=
479  5/Mar/05 23:11  /cgi-bin/chat/chat.cgi?action=chat&id=qwydmklaofpipdtpnesdipwytxnlxe
478  7/Mar/05 20:26  /cgi-bin/chat/chat.cgi?action=chat&id=jqrhezbtqtfwktnppywpaicjydrsxb
476  4/Mar/05 20:33  /cgi-bin/chat/chat.cgi?action=chat&id=vacxerzfxtprvoklqkfvykrnlardin
475  7/Mar/05 18:44  /cgi-bin/chat/chat.cgi?action=chat&id=bgsbnnmswsezekvsmzhbgtahjbuisw&pause=
475 12/Mar/05 17:21  /cgi-bin/chat/chat.cgi?action=chat&id=nnngfhozfiafgphbisiuxoppnliucy&pause=
474  8/Mar/05 20:05  /cgi-bin/chat/chat.cgi?action=chat&id=qldcvcqjwqoafmrnlsnnspkoqezkme
473 27/Mar/05 19:46  /cgi-bin/chat/chat.cgi?action=chat&id=ryosclreubjbcddyrtlpwsqtwrpaag
472 16/Mar/05 20:24  /cgi-bin/chat/chat.cgi?action=chat&id=oxqnmrwhdsfnfuxrwhzsrfmcueraaj&pause=
467 22/Mar/05 18:01  /cgi-bin/chat/chat.cgi?action=chat&id=gxrqidhddbewptlvyqgxiawexuitun
467 13/Mar/05 18:02  /cgi-bin/chat/chat.cgi?action=chat&id=loamwdiqyaeqbgeyuipccnezfcurrz
466  5/Mar/05 14:28  /cgi-bin/chat/chat.cgi?action=chat&id=kiabykestlrnzuinmkzfzpckxidqbi&pause=
466  1/Mar/05 19:31  /cgi-bin/chat/chat.cgi?action=chat&id=hqbcdyepvbmpuoqwcfvwbllambyucy
465  8/Mar/05 16:56  /cgi-bin/chat/chat.cgi?action=chat&id=jzfgjsckmjhpblwtutdugbycoxrrab&pause=
464 16/Mar/05 17:27  /cgi-bin/chat/chat.cgi?action=chat&id=skutwvxzynynjchprcykqqyfsokhbl
464  6/Mar/05 14:17  /cgi-bin/chat/chat.cgi?action=chat&id=fxiujttfsnlqersncwguudqfvsxxwx
462 14/Mar/05 23:10  /cgi-bin/chat/chat.cgi?action=chat&id=szjkfcblfldjmpxnxrwsvqnkhnaudo
459 15/Mar/05 20:34  /cgi-bin/chat/chat.cgi?action=chat&id=fobegtrvjuvshsqcygtoerxcygfytg&pause=
458 15/Mar/05 19:37  /cgi-bin/chat/chat.cgi?action=chat&id=bxkjitlhvzyxclpivhigoxhanjkhhc&pause=
456 15/Mar/05 19:32  /cgi-bin/chat/chat.cgi?action=chat&id=jvdpfalnrlwxdanpizjyujbkymxjyz&pause=
456 16/Mar/05 17:14  /cgi-bin/chat/chat.cgi?action=chat&id=doedkawfvtkpqpkzaiesjydodfivjn&pause=
453 20/Mar/05 19:56  /cgi-bin/chat/chat.cgi?action=chat&id=dxjpiovwdxaccdmyduxrjnfljjrdel&pause=
453  9/Mar/05 19:51  /cgi-bin/chat/chat.cgi?action=chat&id=ukzdagmxtahackexrwnmpxxlwyodit&pause=
452 25/Mar/05 20:11  /cgi-bin/chat/chat.cgi?action=chat&id=ezovoqhuzazrukkcauyionadkngdno&pause=
446  1/Mar/05 19:31  /cgi-bin/chat/chat.cgi?action=chat&id=awctgrnsbuqbcuejptjazcsvzoecly&pause=
443 14/Mar/05 19:06  /cgi-bin/chat/chat.cgi?action=chat&id=wvpmrawiqihtxbnuohdqahivglkjka&pause=
440 20/Mar/05 14:47  /cgi-bin/chat/chat.cgi?action=chat&id=yeonnakriygzdnhaslmlgelvoikxsi&pause=
439 11/Mar/05 20:44  /cgi-bin/chat/chat.cgi?action=chat&id=paawmahdaazxzuvjceiejxjajctxbk&pause=
437 11/Mar/05 17:13  /cgi-bin/chat/chat.cgi?action=chat&id=njpeqjlwuihawbnwzbmotnnhxebrlo&pause=
437 19/Mar/05 19:28  /cgi-bin/chat/chat.cgi?action=chat&id=cxvuqemydfwtwmxkglmyhujrdiwghj&pause=
432  4/Mar/05 16:46  /cgi-bin/chat/chat.cgi?action=chat&id=qbfuvhlxxkqxdzxljqkupdcsljusin&pause=
431 25/Mar/05 19:28  /cgi-bin/chat/chat.cgi?action=chat&id=ycfrlmrfftdujdwpevcshyfmjsjmho&pause=
424 14/Mar/05 20:07  /cgi-bin/chat/chat.cgi?action=chat&id=ndulaaosaqnleqyopcbstrfpwwnbuh
420  7/Mar/05 20:06  /cgi-bin/chat/chat.cgi?action=chat&id=cvixlvyoqmyjjydypqhbzikgdgdrax&pause=
420 11/Mar/05 18:47  /cgi-bin/chat/chat.cgi?action=chat&id=ocfhnbacfigefgcrjzpaintwcsfdlu&pause=
419 13/Mar/05 20:27  /cgi-bin/chat/chat.cgi?action=chat&id=abowrokbpcjzeebjqlhekytsfgmyvy
419 18/Mar/05 17:59  /cgi-bin/chat/chat.cgi?action=chat&id=zovgzmubhpiinnysixmzdkswowcnps
417 17/Mar/05 18:48  /cgi-bin/chat/chat.cgi?action=chat&id=krnlccfwjqvnlmttqhtpsqpogdzzbl&pause=
417 15/Mar/05 19:15  /cgi-bin/chat/chat.cgi?action=chat&id=qrpkniekxvlpookjdodojkqdzsbiry&pause=
416 23/Mar/05 19:51  /cgi-bin/chat/chat.cgi?action=chat&id=nzmrwxqfkmnawbqxxcgqxtqlorxlaq&pause=
415  6/Mar/05 18:14  /cgi-bin/chat/chat.cgi?action=chat&id=mjfedsulvkxiopqgjrvveokxldmukb&pause=
413  4/Mar/05 17:21  /cgi-bin/chat/chat.cgi?action=chat&id=blztkurpwchpcbnrqgfzondcdnctgl&pause=
412  9/Mar/05 21:33  /cgi-bin/chat/chat.cgi?action=chat&id=ugmcemydoorxgefhmqyarbsqecmmpp&pause=
412 14/Mar/05 21:34  /cgi-bin/chat/chat.cgi?action=chat&id=bzusjhjtvuupdwjlynbalzcjrqhdta
411  6/Mar/05 19:31  /cgi-bin/chat/chat.cgi?action=chat&id=qbqkrwqunvcduullmqafxeekjkkwud&pause=
410  6/Mar/05 16:32  /cgi-bin/chat/chat.cgi?action=chat&id=ksbxpytmjcgyyvrgzamxgnswdsvapv&pause=
408  5/Mar/05 20:02  /cgi-bin/chat/chat.cgi?action=chat&id=wsqcuoodkjchrzeskuootfwzmhvbus&pause=
407 17/Mar/05 17:11  /cgi-bin/chat/chat.cgi?action=chat&id=lipahtmwynfvwrepejgtfajnsyxpld
407 22/Mar/05 20:09  /cgi-bin/chat/chat.cgi?action=chat&id=arfgxjdhwmpusbvdfskyfdodeqqdqm
407  1/Mar/05 19:31  /cgi-bin/chat/chat.cgi?action=chat&id=hsdcuunewepkyuptkmveppnchlbvnx&pause=
405  7/Mar/05 16:10  /cgi-bin/chat/chat.cgi?action=chat&id=owevgitczrsictmwhhgxhauabgxeqt
401 27/Mar/05 19:51  /cgi-bin/chat/chat.cgi?action=chat&id=hbdtsczulaxoidwzkaxiaaradmomcw
400  8/Mar/05 17:01  /cgi-bin/chat/chat.cgi?action=chat&id=widmwxvsbzcwfbifnuiihiojixomxk
400 15/Mar/05 20:13  /cgi-bin/chat/chat.cgi?action=chat&id=oohzscziiyevqikvpracubtrumhzyw
399 19/Mar/05 20:00  /cgi-bin/chat/chat.cgi?action=chat&id=iqrusrwrffspftelrmwcvwftcvlvuv&pause=
398  3/Mar/05 16:41  /cgi-bin/chat/chat.cgi?action=chat&id=letarnycwgljykjmhqvogtmhmpafek&pause=
397 12/Mar/05 20:42  /cgi-bin/chat/chat.cgi?action=chat&id=hynpgicdjacyqlivglrjqxrvshomlw
396 23/Mar/05 17:59  /cgi-bin/chat/chat.cgi?action=chat&id=vfmdxmwppnxjanvvctlvfodcpocntc
392  2/Mar/05 17:55  /cgi-bin/chat/chat.cgi?action=chat&id=hdkexgqxmlitnilhmutofykvlbxptx&pause=
392  5/Mar/05 23:00  /cgi-bin/chat/chat.cgi?action=chat&id=pvsgrcvllnerzjwrsrclnhvgeucqku
391 22/Mar/05 19:13  /cgi-bin/chat/chat.cgi?action=chat&id=xktbwcfmgyeurfjlfbxznyxznnahuz
391  6/Mar/05 14:28  /cgi-bin/chat/chat.cgi?action=chat&id=ybmxomvpdrnpbhrwiuqhrchetqiuse&pause=
391  6/Mar/05 00:15  /cgi-bin/chat/chat.cgi?action=chat&id=njlyzdowqrqvxhnnrxirteinknppig
388 22/Mar/05 18:37  /cgi-bin/chat/chat.cgi?action=chat&id=wklxuveeuemwtdbdasjrvirgmmnlbr
388  3/Mar/05 19:08  /cgi-bin/chat/chat.cgi?action=chat&id=kdfmfvcsuyeaalitlrfputhgydltmf
386  3/Mar/05 20:06  /cgi-bin/chat/chat.cgi?action=chat&id=smbokmanbfihckuhaxjjrjmqgvjalf
385  7/Mar/05 20:53  /cgi-bin/chat/chat.cgi?action=chat&id=cvixlvyoqmyjjydypqhbzikgdgdrax
385 25/Mar/05 16:34  /cgi-bin/chat/chat.cgi?action=chat&id=qzewkfklsmaxilzzclmlrriwavxsrf
385  1/Mar/05 18:57  /cgi-bin/chat/chat.cgi?action=chat&id=sddnifeledgonzfxxjdyrptmtbbvkj
383  8/Mar/05 16:50  /cgi-bin/chat/chat.cgi?action=chat&id=cuvcchhiboduwkhcajcqdziarzvotq
382 17/Mar/05 18:49  /cgi-bin/chat/chat.cgi?action=chat&id=rhqgpooklilpjodalaeyjlfleqtyfl
381 10/Mar/05 20:25  /cgi-bin/chat/chat.cgi?action=chat&id=zkhcusizjzejgjipyfkhtkcycmrxtt
381 12/Mar/05 21:57  /cgi-bin/chat/chat.cgi?action=chat&id=tiwsmwkqncbloslrruziesminlcbfb&pause=
376 18/Mar/05 16:52  /cgi-bin/chat/chat.cgi?action=chat&id=arhlkmqetpsgszrnjuzggymgbejhab&pause=
371 11/Mar/05 12:29  /cgi-bin/chat/chat.cgi?action=chat&id=gtmrwgbfpoxghkuacpwgthhxuukrri&pause=
368 16/Mar/05 16:42  /cgi-bin/chat/chat.cgi?action=chat&id=wprqqyldwszpoubptftwfxvjihlvrp&pause=
368 17/Mar/05 18:57  /cgi-bin/chat/chat.cgi?action=chat&id=lqyhuklfdvrminqwopcoixytyuamsq&pause=
367 11/Mar/05 19:59  /cgi-bin/chat/chat.cgi?action=chat&id=zndnbymdrqzwjbmvulwwdwdyrwsspw&pause=
366  9/Mar/05 20:45  /cgi-bin/chat/chat.cgi?action=chat&id=qbkzsttozdcvyfplwsaoirjrupadxi
365  5/Mar/05 23:46  /cgi-bin/chat/chat.cgi?action=chat&id=zcgzxrykbzrlzetfmxunixubhegsaq&pause=
361 20/Mar/05 19:24  /cgi-bin/chat/chat.cgi?action=chat&id=gfwsrrhdmacydytrssmgahrizufnzh&pause=
361  6/Mar/05 17:39  /cgi-bin/chat/chat.cgi?action=chat&id=prdcqtpxxmvdlelgagohdrbaenrjhu
359 17/Mar/05 20:12  /cgi-bin/chat/chat.cgi?action=chat&id=icejabrggwwnstzphdayqkytwvmbic&pause=
359  2/Mar/05 20:39  /cgi-bin/chat/chat.cgi?action=chat&id=rqmvsrhdinzzxjrksocgrwvzlhzoxv&pause=
357 27/Mar/05 19:11  /cgi-bin/chat/chat.cgi?action=chat&id=rwrwwdlfalwebyjnfjpkzkyciwumgo&pause=
355 26/Mar/05 20:05  /cgi-bin/chat/chat.cgi?action=chat&id=jpvjblthnbnpdnpcxfstaldupprmcv&pause=
355  8/Mar/05 19:50  /cgi-bin/chat/chat.cgi?action=chat&id=rtmluzikunpkgdgyhhtdqiispijbtb&pause=
354  9/Mar/05 18:19  /cgi-bin/chat/chat.cgi?action=chat&id=rwkbrkoclfkkgeqactytjplecblkpf&pause=
350 16/Mar/05 19:31  /cgi-bin/chat/chat.cgi?action=chat&id=xpyabfudfulizvkiznqvohmdwjmgri&pause=
349  8/Mar/05 19:17  /cgi-bin/chat/chat.cgi?action=chat&id=gltudhumdcvywpnkyppvibipjiseij&pause=
348 19/Mar/05 20:00  /cgi-bin/chat/chat.cgi?action=chat&id=cterggruywajipqrtuldajwlbtgkzm&pause=
348  5/Mar/05 18:05  /cgi-bin/chat/chat.cgi?action=chat&id=bedvhlbdljtcnlheisxcpjjvjtrbwp&pause=
344 25/Mar/05 20:12  /cgi-bin/chat/chat.cgi?action=chat&id=dhrhgevxgjlebnfakhnifozuragxlh&pause=
344  5/Mar/05 19:29  /cgi-bin/chat/chat.cgi?action=chat&id=qmgknnegsacfgwiovnxtbmvvlsnohd&pause=
343 16/Mar/05 20:24  /cgi-bin/chat/chat.cgi?action=chat&id=xfawrsybuotbrlucbqcixwplazqtxm&pause=
343  1/Mar/05 16:14  /cgi-bin/chat/chat.cgi?action=chat&id=hltsqwjvuqfetcmxbggowhavlvescf&pause=
341 16/Mar/05 20:22  /cgi-bin/chat/chat.cgi?action=chat&id=jvjyydwpwebkynngobwitxuqkrtxdi
341  6/Mar/05 19:57  /cgi-bin/chat/chat.cgi?action=chat&id=ezaaoqlqnksxdcvdimbeolpnyceagl&pause=
338  6/Mar/05 00:12  /cgi-bin/chat/chat.cgi?action=chat&id=funaoolvdsatzzyqfgsdcjesqiphnb
337 18/Mar/05 19:21  /cgi-bin/chat/chat.cgi?action=chat&id=nbppfzlomtlhfwxctvhdzterhlzoen&pause=
337 18/Mar/05 18:43  /cgi-bin/chat/chat.cgi?action=chat&id=wtdtoougqiphcjljfaixxasqadqpba&pause=
337 11/Mar/05 18:35  /cgi-bin/chat/chat.cgi?action=chat&id=kavnqagwrqulruuqcisfjjrsoxbqqu
336 23/Mar/05 18:10  /cgi-bin/chat/chat.cgi?action=chat&id=vkjgakhvoinvsdqwozpucrjzknvmmf
336 25/Mar/05 18:25  /cgi-bin/chat/chat.cgi?action=chat&id=zuvegbmcowdqbshkgrojozdfnyjgob
336  6/Mar/05 18:32  /cgi-bin/chat/chat.cgi?action=chat&id=ijkbzdhghoougutmjyiimpjttlpijk
335 18/Mar/05 18:11  /cgi-bin/chat/chat.cgi?action=chat&id=kvilpvkepqicrppriqerpfsvueppvw
334 12/Mar/05 20:57  /cgi-bin/chat/chat.cgi?action=chat&id=byxbbllrmvpflkwhmgsxmrfipckarg
332 12/Mar/05 13:18  /cgi-bin/chat/chat.cgi?action=chat&id=xaetxousnslirzxldlpmbqidxcrtlq&pause=
331 14/Mar/05 17:43  /cgi-bin/chat/chat.cgi?action=chat&id=aqhalgzjdxpcexzyklwhpvbkskprzp&pause=
331  8/Mar/05 21:53  /cgi-bin/chat/chat.cgi?action=chat&id=gsxlafstghjxehpythnbzoypexguiq&pause=
330 16/Mar/05 20:18  /cgi-bin/chat/chat.cgi?action=chat&id=acgsrajwpvktbltxtkiswhdlrojknk
329  8/Mar/05 09:50  /cgi-bin/chat/chat.cgi?action=chat&id=vfeywxekxeuksdvpiiszhivxeeeoum
327 15/Mar/05 17:59  /cgi-bin/chat/chat.cgi?action=chat&id=ewqkymvlhzfhvctizlxgdrbjwrlals&pause=
326 13/Mar/05 19:48  /cgi-bin/chat/chat.cgi?action=chat&id=ieatvsiagiaenbnolmehzvtyunrozp&pause=
324  5/Mar/05 09:01  /cgi-bin/chat/chat.cgi?action=chat&id=wpsmwaqxgdlftswbaytyfjjobdjdcp
324  5/Mar/05 16:51  /cgi-bin/chat/chat.cgi?action=chat&id=uennlcqwyuwlwfdobwpprukbirainj&pause=
323 18/Mar/05 19:01  /cgi-bin/chat/chat.cgi?action=chat&id=vjxcpnhwwwcxkkcoqvehqlhjjfdthg
317 10/Mar/05 17:57  /cgi-bin/chat/chat.cgi?action=chat&id=fyyztgsqcqnjmkiidennegyveprtwi&pause=
316  4/Mar/05 20:34  /cgi-bin/chat/chat.cgi?action=chat&id=fgyujtjendipfvviqhwsmpxqisbbjl&pause=
315  1/Mar/05 15:58  /cgi-bin/chat/chat.cgi?action=chat&id=kvvvbykcvjlaikyqhkexvfzvuoygfs
314  9/Mar/05 12:38  /cgi-bin/chat/chat.cgi?action=chat&id=zkzsauyfdekeipmwfudxaundxgtqod&pause=
313 28/Mar/05 12:49  /cgi-bin/chat/chat.cgi?action=chat&id=dtymilngvkircdjnqaimaxomubvxek&pause=
311  5/Mar/05 20:40  /cgi-bin/chat/chat.cgi?action=chat&id=wslaybjbbcgapuoijjpysdoynwqsey&pause=
310 14/Mar/05 19:59  /cgi-bin/chat/chat.cgi?action=chat&id=edsqvoafqrywelrweybvyhredahikb
310 18/Mar/05 20:04  /cgi-bin/chat/chat.cgi?action=chat&id=nbppfzlomtlhfwxctvhdzterhlzoen
309  7/Mar/05 18:48  /cgi-bin/chat/chat.cgi?action=chat&id=hselizfjqsszwwenbmmkcazflkuxdr
308 17/Mar/05 20:23  /cgi-bin/chat/chat.cgi?action=chat&id=qguexkuopvpepwofsrpmnyvdbmyxqo
308 26/Mar/05 20:12  /cgi-bin/chat/chat.cgi?action=chat&id=lnheflqwkhapymoxzcnogmynyynmpb&pause=
308 12/Mar/05 12:24  /cgi-bin/chat/chat.cgi?action=chat&id=xaetxousnslirzxldlpmbqidxcrtlq
307 23/Mar/05 17:42  /cgi-bin/chat/chat.cgi?action=chat&id=pdlckkatrxxofjblkamozhakmbyiko&pause=
306  5/Mar/05 08:36  /cgi-bin/chat/chat.cgi?action=chat&id=zvcixjepwhyprgsnteqhwcsinwqiun&pause=
304 18/Mar/05 19:29  /cgi-bin/chat/chat.cgi?action=chat&id=akmmkjbfljvinjsgcskthdhddmwzzy
304  7/Mar/05 19:46  /cgi-bin/chat/chat.cgi?action=chat&id=hfaqjkzdbbuspqaozxekosdmjrpcwv
304 16/Mar/05 17:14  /cgi-bin/chat/chat.cgi?action=chat&id=gyintcfppwgmhmmtrarhtqscddxvvk
302  9/Mar/05 19:51  /cgi-bin/chat/chat.cgi?action=chat&id=fcpasfozosjtysjtdkpdsckdrzqmki&pause=
301 21/Mar/05 18:35  /cgi-bin/chat/chat.cgi?action=chat&id=njgjrtcvhgmvpqjnfuymsdesrjgrqy
298 14/Mar/05 19:27  /cgi-bin/chat/chat.cgi?action=chat&id=ajakhobbjosqjdbfbaherchswmcjbt
298 19/Mar/05 20:18  /cgi-bin/chat/chat.cgi?action=chat&id=oafkkqbtstkfvsigumqbornsowzyha
298  7/Mar/05 16:49  /cgi-bin/chat/chat.cgi?action=chat&id=jrhkvliybwxeosucfxdxgbudjbchyq&pause=
296 12/Mar/05 21:50  /cgi-bin/chat/chat.cgi?action=chat&id=wwqvkjvvnzwzhszfedftjtbmduyswq
296 20/Mar/05 18:50  /cgi-bin/chat/chat.cgi?action=chat&id=vzhlycunncnwaphtjrntuyerygwzcp&pause=
294 21/Mar/05 18:42  /cgi-bin/chat/chat.cgi?action=chat&id=jzdtzcevnfmvpwcqhxrkdhepnkqayk&pause=
294  6/Mar/05 14:30  /cgi-bin/chat/chat.cgi?action=chat&id=btsfzlgaamgemcdkgaklzuvxngrkgv
294  7/Mar/05 17:08  /cgi-bin/chat/chat.cgi?action=chat&id=xfwdvpuckxcrihvseymaxlhmvyimfr&pause=
294 13/Mar/05 20:26  /cgi-bin/chat/chat.cgi?action=chat&id=dhrewzsmlddfrauaxeatgggdahultk
294 23/Mar/05 19:45  /cgi-bin/chat/chat.cgi?action=chat&id=gpzvanzohfofrassswhcnagdpylfhv&pause=
293 26/Mar/05 11:48  /cgi-bin/chat/chat.cgi?action=chat&id=pxlmbsxasrjlenogooerwcsytexwhv
292  5/Mar/05 23:13  /cgi-bin/chat/chat.cgi?action=chat&id=lgijxqbjhmsukkuhirutcnbjejxhpr&pause=
292  4/Mar/05 20:41  /cgi-bin/chat/chat.cgi?action=chat&id=eddhogcnkivrdrlmexxjwufgjrlzra&pause=
289  6/Mar/05 16:55  /cgi-bin/chat/chat.cgi?action=chat&id=bmgipsmnehlujaospxmxhnpemoelyn&pause=
289  9/Mar/05 18:59  /cgi-bin/chat/chat.cgi?action=chat&id=kzpvpqrzboqjexftvlpunpyukmgmll
287 25/Mar/05 19:03  /cgi-bin/chat/chat.cgi?action=chat&id=vhjrdnejcqfkdimcgjhawprhjmuvof
287  3/Mar/05 18:24  /cgi-bin/chat/chat.cgi?action=chat&id=qtczbbgtycrcijottqygykhokuillc&pause=
287 17/Mar/05 18:49  /cgi-bin/chat/chat.cgi?action=chat&id=avwppmkfcmshoclvbvaclxdtidegbk
286 10/Mar/05 20:28  /cgi-bin/chat/chat.cgi?action=chat&id=haxnppcqhwiniskxksrgmibgzzxkkh&pause=
282 18/Mar/05 16:38  /cgi-bin/chat/chat.cgi?action=chat&id=cpgjfhlntlqhxcplhtbmlkquashymu&pause=
281 18/Mar/05 19:03  /cgi-bin/chat/chat.cgi?action=chat&id=ofdbfxlecqtjtvqcbhquqcesmaqbtu&pause=
281 26/Mar/05 19:41  /cgi-bin/chat/chat.cgi?action=chat&id=kmikzzagsqutngutbjgqntggrmulrm&pause=
280 17/Mar/05 17:57  /cgi-bin/chat/chat.cgi?action=chat&id=lqyhuklfdvrminqwopcoixytyuamsq
279  4/Mar/05 18:12  /cgi-bin/chat/chat.cgi?action=chat&id=pzxyyecluixotrkjjkzmftvmjtinyj&pause=
278  5/Mar/05 20:40  /cgi-bin/chat/chat.cgi?action=chat&id=edpkpjpnhdgdhnkeeotvlresadpudh
276 10/Mar/05 14:04  /cgi-bin/chat/chat.cgi?action=chat&id=wnrzpkxcshnwpepdsyvvadnvcnqrnh&pause=
275 27/Mar/05 18:41  /cgi-bin/chat/chat.cgi?action=chat&id=aufgsrjjomtirwizesemixxpfpaktc&pause=
275 13/Mar/05 18:45  /cgi-bin/chat/chat.cgi?action=chat&id=tcheautxivsnfcvxvrzsrypydyvfun&pause=
275 14/Mar/05 17:44  /cgi-bin/chat/chat.cgi?action=chat&id=bzstnjnwibbqvsbssscgbznwliapvl&pause=
274 25/Mar/05 14:00  /cgi-bin/chat/chat.cgi?action=chat&id=odrsvcfltvqalosgrybkvumbgxlddr
274  6/Mar/05 19:49  /cgi-bin/chat/chat.cgi?action=chat&id=mvcrqzgrxwuazrsyanmgttyltqldba
273  2/Mar/05 19:49  /cgi-bin/chat/chat.cgi?action=chat&id=rijocqsnjglcfhfnaafsoaufhfarbk&pause=
273 20/Mar/05 14:12  /cgi-bin/chat/chat.cgi?action=chat&id=mtxeuhrhzhevrhkyqmvpuuwlbrcqgp&pause=
272 12/Mar/05 21:48  /cgi-bin/chat/chat.cgi?action=chat&id=vcyzhihaiypymdxvpnygtbzvpbupod&pause=
272  7/Mar/05 20:43  /cgi-bin/chat/chat.cgi?action=chat&id=wmqklgzpcgavedpehifrtwyjsqmnwk&pause=
271 19/Mar/05 22:42  /cgi-bin/chat/chat.cgi?action=chat&id=npntorbmiqybxplidrimhufuuwvojz&pause=
270  7/Mar/05 17:38  /cgi-bin/chat/chat.cgi?action=chat&id=jrhkvliybwxeosucfxdxgbudjbchyq
270  6/Mar/05 16:02  /cgi-bin/chat/chat.cgi?action=chat&id=wpmylttogzeslcdcfgbtxoqmacosxj&pause=
269  1/Mar/05 16:14  /cgi-bin/chat/chat.cgi?action=chat&id=enosdxfbitqkoqtthqwlramokimibu&pause=
268 26/Mar/05 15:52  /cgi-bin/chat/chat.cgi?action=chat&id=nurjesygryzqriyetfpmvlvavimnqv&pause=
265  5/Mar/05 19:47  /cgi-bin/chat/chat.cgi?action=chat&id=gfpjqoivhahmykfbjooszietuarnna
265 25/Mar/05 20:24  /cgi-bin/chat/chat.cgi?action=chat&id=eshrfnailocjnflxigcynnaqxmjidx
263 22/Mar/05 19:45  /cgi-bin/chat/chat.cgi?action=chat&id=fglflzxfhvhskeqooopzqeaduxyghz
261  6/Mar/05 17:14  /cgi-bin/chat/chat.cgi?action=chat&id=bggqtjrwdolhaoeekvjcbamgerolku&pause=
261  3/Mar/05 16:42  /cgi-bin/chat/chat.cgi?action=chat&id=xdjkhcolmtavtdvetliodqzqvjweij
261 26/Mar/05 20:08  /cgi-bin/chat/chat.cgi?action=chat&id=dydimhvtpfpzpuybvesdjzokvvlmat&pause=
261 20/Mar/05 20:29  /cgi-bin/chat/chat.cgi?action=chat&id=bqazzunqazldrmybnfnywtgyedwxoy&pause=
260 17/Mar/05 20:22  /cgi-bin/chat/chat.cgi?action=chat&id=kggohtjlihjumgtvywpreheemibzka&pause=
260 26/Mar/05 15:51  /cgi-bin/chat/chat.cgi?action=chat&id=adrzblohmtwjlrgfpjpoewmdhhmniq&pause=
255 17/Mar/05 18:27  /cgi-bin/chat/chat.cgi?action=chat&id=yxwkbcsxrxfddaffryxftrhvtgmcib&pause=
253 28/Mar/05 12:27  /cgi-bin/chat/chat.cgi?action=chat&id=epohtigwfrlymjfawzxzouhaswrsrp&pause=
248  1/Mar/05 18:04  /cgi-bin/chat/chat.cgi?action=chat&id=qboiyrjyncjtlwpkttyaopofgdkerg&pause=
248  3/Mar/05 17:30  /cgi-bin/chat/chat.cgi?action=chat&id=wqhgalalabqqccjqdjpaulmjybwkie
247 23/Mar/05 17:11  /cgi-bin/chat/chat.cgi?action=chat&id=ucajsujmylowkyhqylibxtyliyizwy&pause=
247  4/Mar/05 11:48  /cgi-bin/chat/chat.cgi?action=chat&id=ytqnahqarwsxvsphtvimxujqyjcccg
247  4/Mar/05 18:43  /cgi-bin/chat/chat.cgi?action=chat&id=lyaagoqrjipkczsqcpcuyvhfmahazs&pause=
247 17/Mar/05 17:26  /cgi-bin/chat/chat.cgi?action=chat&id=hokdxcecttkytfsxjazqplwpuytkoi&pause=
246 11/Mar/05 20:55  /cgi-bin/chat/chat.cgi?action=chat&id=bngnzdzrtbnoettocaeslxgbmtmoaq
246  6/Mar/05 14:17  /cgi-bin/chat/chat.cgi?action=chat&id=mwnaalvsethxdjqewltfdtucxlslth&pause=
242 21/Mar/05 19:15  /cgi-bin/chat/chat.cgi?action=chat&id=dfqkazytxrpngmnpnclezlpxfdtkvo&pause=
242  5/Mar/05 08:40  /cgi-bin/chat/chat.cgi?action=chat&id=nfthlzjjbngkyhlnypcnbyjvvjduay
242 22/Mar/05 18:50  /cgi-bin/chat/chat.cgi?action=chat&id=wyosymjsvklfkntlowtnvsgncikkgk&pause=
241 14/Mar/05 20:57  /cgi-bin/chat/chat.cgi?action=chat&id=fxgpjqtbztdhsiqizmctdxivfbrydd
241 16/Mar/05 19:43  /cgi-bin/chat/chat.cgi?action=chat&id=smhmmrovpgcwcydriawqimyscduysy
241 21/Mar/05 18:25  /cgi-bin/chat/chat.cgi?action=chat&id=ylgigxzlqccavwasmshgbhnfollier&pause=
240 17/Mar/05 20:27  /cgi-bin/chat/chat.cgi?action=chat&id=pbakobzyvdpddbjjsorwzpdzosvguu&pause=
237  6/Mar/05 18:48  /cgi-bin/chat/chat.cgi?action=chat&id=mtfhjgbizsnuhtxklvovtdhthgvtbe&pause=
237  3/Mar/05 16:31  /cgi-bin/chat/chat.cgi?action=chat&id=dpesbucoynkpcatrxajraggfadgvrb&pause=
237  2/Mar/05 19:56  /cgi-bin/chat/chat.cgi?action=chat&id=ggqrgzfbqljxkhlrngwzgdfigxjntg&pause=
235 14/Mar/05 19:28  /cgi-bin/chat/chat.cgi?action=chat&id=mxbwhamzrewceiaxteftxmfibjhhoy&pause=
235 10/Mar/05 20:25  /cgi-bin/chat/chat.cgi?action=chat&id=jfpleiypahpzrxfdnvmyymnlqmkjwo&pause=
234  7/Mar/05 17:09  /cgi-bin/chat/chat.cgi?action=chat&id=meuvlvtrbprzipbkazenuszvvftebh
233  8/Mar/05 16:16  /cgi-bin/chat/chat.cgi?action=chat&id=luyclivadzjoqwvwwhixvladbtqwno&pause=
233 14/Mar/05 16:35  /cgi-bin/chat/chat.cgi?action=chat&id=tomfppeczqbiwznmcwrjdmcoplrqvw&pause=
232  9/Mar/05 20:37  /cgi-bin/chat/chat.cgi?action=chat&id=xtjalvufkanloqsohzykclqfsugmxb
230  1/Mar/05 21:08  /cgi-bin/chat/chat.cgi?action=chat&id=xlkvelwbwpyzivzdxdgebyrusjhgqr&pause=
230 26/Mar/05 15:53  /cgi-bin/chat/chat.cgi?action=chat&id=xmwuiqmawieezvsshqzhunwjgsedxk
230  4/Mar/05 17:53  /cgi-bin/chat/chat.cgi?action=chat&id=jozalxtxiejwbspafoublquhjnxnqi&pause=
229  1/Mar/05 18:10  /cgi-bin/chat/chat.cgi?action=chat&id=fcadknodbabxjaatdslmweyznevdrk&pause=
229 20/Mar/05 14:40  /cgi-bin/chat/chat.cgi?action=chat&id=xbywnztmkbnqtelzhsqbccovostens
229  7/Mar/05 20:54  /cgi-bin/chat/chat.cgi?action=chat&id=yuljzejhdqlclxrelyqhbfjjjkfbhw&pause=
228 11/Mar/05 17:49  /cgi-bin/chat/chat.cgi?action=chat&id=bvwyzxbgpwnutkujortwxqeflxylqa
227  7/Mar/05 22:32  /cgi-bin/chat/chat.cgi?action=chat&id=mvzfxcpodfthodxyzjzjbywhmagmbj&pause=
227  6/Mar/05 19:04  /cgi-bin/chat/chat.cgi?action=chat&id=qdwapitpuvuvvpzpmqqokbtpddtrkl&pause=
226 23/Mar/05 17:58  /cgi-bin/chat/chat.cgi?action=chat&id=kukqoiapvtpayttxoifwsnfhfufcpl
226  6/Mar/05 17:48  /cgi-bin/chat/chat.cgi?action=chat&id=tsrrwfbdnfsnzsbrvsaqosjgrvgbvn
225  5/Mar/05 13:52  /cgi-bin/chat/chat.cgi?action=chat&id=kzwlneznfcfyqkrinvtfcpcrilcqcw
224  6/Mar/05 18:04  /cgi-bin/chat/chat.cgi?action=chat&id=btmylgcsobfrbkpfcqotmlthrdsfky
224 13/Mar/05 17:41  /cgi-bin/chat/chat.cgi?action=chat&id=eqzeiskwoasvlsttmaefzgbhdhtoos&pause=
224 10/Mar/05 18:11  /cgi-bin/chat/chat.cgi?action=chat&id=okcfrknslsyvnxuwiungwzitbwmevx
224 13/Mar/05 19:49  /cgi-bin/chat/chat.cgi?action=chat&id=jfacdtqtvwswdpgjekffoghepmopts&pause=
223 11/Mar/05 16:34  /cgi-bin/chat/chat.cgi?action=chat&id=tvsordfvbhqxylwynzbjpcgqnnwpja&pause=
222  6/Mar/05 18:46  /cgi-bin/chat/chat.cgi?action=chat&id=abteeorriinesqojktnfvlcdnrppbq&pause=
222 19/Mar/05 19:46  /cgi-bin/chat/chat.cgi?action=chat&id=jngrpicrzwrlfczxhzurcevwigidqi
222 18/Mar/05 16:43  /cgi-bin/chat/chat.cgi?action=chat&id=hptfpxsokhgzvcqarbwiirveudhrrx&pause=
221  4/Mar/05 16:35  /cgi-bin/chat/chat.cgi?action=chat&id=izihsmdahpxgixdwtjbryjkmulxhgm
220 11/Mar/05 13:26  /cgi-bin/chat/chat.cgi?action=chat&id=cfmgkynsrqrzylobfmfndzyloxijwo&pause=
220  6/Mar/05 19:33  /cgi-bin/chat/chat.cgi?action=chat&id=fajfrrtfkawoukxryhzxdpcfmuzidl&pause=
219 16/Mar/05 19:56  /cgi-bin/chat/chat.cgi?action=chat&id=fhzcbqeoinyaiedohvzspnrzpyhszj&pause=
219 27/Mar/05 18:53  /cgi-bin/chat/chat.cgi?action=chat&id=qousauezedspxywjifsivhdmnsdqqu&pause=
218  1/Mar/05 21:29  /cgi-bin/chat/chat.cgi?action=chat&id=hgbyqcqcbzxmapkfeljhwmonzczzas&pause=
218  2/Mar/05 18:40  /cgi-bin/chat/chat.cgi?action=chat&id=elhkwrahcmodxdqytitciadkmzhzch&pause=
218  7/Mar/05 18:00  /cgi-bin/chat/chat.cgi?action=chat&id=hbndljvpxhnczghilqjqgehxfeuhnf&pause=
217 18/Mar/05 20:25  /cgi-bin/chat/chat.cgi?action=chat&id=aalplvxrnnshxvdyjokyqounsqzvgp
217  5/Mar/05 16:33  /cgi-bin/chat/chat.cgi?action=chat&id=pawwbnxruuftisjuvkaczguzozogey&pause=
215  2/Mar/05 20:12  /cgi-bin/chat/chat.cgi?action=chat&id=curhhynrdfhyxrtesgqldxupagcapy
214 22/Mar/05 18:37  /cgi-bin/chat/chat.cgi?action=chat&id=lhiiqoatfncebapsvvmnkjvygjnndj&pause=
214  3/Mar/05 16:27  /cgi-bin/chat/chat.cgi?action=chat&id=akqcxisskvbznxyenvgmdfxozhabvu
214 18/Mar/05 17:44  /cgi-bin/chat/chat.cgi?action=chat&id=wfjobdnpktkjstidaworkbaxryxake&pause=
214  8/Mar/05 18:12  /cgi-bin/chat/chat.cgi?action=chat&id=manbveuiinkdmufaoypaumblvhjefs&pause=
213 26/Mar/05 20:53  /cgi-bin/chat/chat.cgi?action=chat&id=skcgltbsrudumwredxgkyijylpvmrp
213  3/Mar/05 18:15  /cgi-bin/chat/chat.cgi?action=chat&id=pofzfpapdvntghfmklncjrgnsiqtjq&pause=
213 16/Mar/05 16:54  /cgi-bin/chat/chat.cgi?action=chat&id=zrpgmhytujkldceunlosglysmnrneq
213 10/Mar/05 21:12  /cgi-bin/chat/chat.cgi?action=chat&id=mjpoipzfmjxxlvuazbgisslhgqlkbb&pause=
212  9/Mar/05 19:41  /cgi-bin/chat/chat.cgi?action=chat&id=wkwnvozskkcddcdjrekplxcaezoajt
212 21/Mar/05 09:30  /cgi-bin/chat/chat.cgi?action=chat&id=ewuytvkvzgulpacfzszlqwqusugzjl&pause=
211 13/Mar/05 18:46  /cgi-bin/chat/chat.cgi?action=chat&id=jurpvfowbedxtsbbzvlranbeurgwvl
211 27/Mar/05 18:08  /cgi-bin/chat/chat.cgi?action=chat&id=esbotvambysnimopzvfflntcqkryzo&pause=
211 15/Mar/05 20:16  /cgi-bin/chat/chat.cgi?action=chat&id=wwrpvtwemrobjgjrxjmbzxkmtbupyq&pause=
210 14/Mar/05 19:13  /cgi-bin/chat/chat.cgi?action=chat&id=mfesnvkiprkdiisdorpxtylhlbtltt
209  1/Mar/05 18:51  /cgi-bin/chat/chat.cgi?action=chat&id=effnwzdjyhywxriqunlmerfrojjyqt
208 13/Mar/05 20:30  /cgi-bin/chat/chat.cgi?action=chat&id=hnkjnizciccucsfpcmmpjlpupngggd&pause=
206  2/Mar/05 18:30  /cgi-bin/chat/chat.cgi?action=chat&id=hdkexgqxmlitnilhmutofykvlbxptx
205 22/Mar/05 17:07  /cgi-bin/chat/chat.cgi?action=chat&id=zzajmplcawoidqqsztpoevrmfodzgf&pause=
205 14/Mar/05 16:01  /cgi-bin/chat/chat.cgi?action=chat&id=ywrlsknroqjlbtlzqlzafpkugsuryk&pause=
205  1/Mar/05 22:08  /cgi-bin/chat/chat.cgi?action=chat&id=pkiwwrkmictxopuzsmgzlpwxzjwgij&pause=
204 28/Mar/05 12:10  /cgi-bin/chat/chat.cgi?action=chat&id=cngimbylxbmelwekzmkmjjkvjehwxg&pause=
204 11/Mar/05 19:22  /cgi-bin/chat/chat.cgi?action=chat&id=puopkhvjlvcyxgtniqeonjaxcoboas
203 21/Mar/05 19:11  /cgi-bin/chat/chat.cgi?action=chat&id=jffmyrtvufztqzvnktlmgsqltzxzml
203  8/Mar/05 20:04  /cgi-bin/chat/chat.cgi?action=chat&id=ghanhrskdyasxzejvljvxtgyjhsbjl&pause=
202  8/Mar/05 18:26  /cgi-bin/chat/chat.cgi?action=chat&id=tpecaovrtldvwbpxtihnyrpqygadeu&pause=
202  3/Mar/05 05:19  /cgi-bin/chat/chat.cgi?action=chat&id=ionpjlqbftsiwoeiblwupgecepklvg
202  7/Mar/05 18:01  /cgi-bin/chat/chat.cgi?action=chat&id=xkrogcddmtjautwsjctyvpjgykixfy
201 12/Mar/05 13:21  /cgi-bin/chat/chat.cgi?action=chat&id=iicriwdjoywmghiutzbtayeganlzmx&pause=
201 21/Mar/05 18:45  /cgi-bin/chat/chat.cgi?action=chat&id=hjhmpnbsgpjovjdvnbeeptbpjundgc&pause=
200 23/Mar/05 19:35  /cgi-bin/chat/chat.cgi?action=chat&id=eexnqoeohfuokykobvumnoxpbniihg
200  3/Mar/05 20:52  /cgi-bin/chat/chat.cgi?action=chat&id=odebmlegitoeqsccwbeuzjmfeqkdbj
200  1/Mar/05 01:05  /cgi-bin/chat/chat.cgi?action=chat&id=wbxzwixnztltbxvoxhltnjwqmumlqt&pause=
199 18/Mar/05 17:27  /cgi-bin/chat/chat.cgi?action=chat&id=phzrftchfcafdhvpjbvahfzdzfsprl&pause=
199 16/Mar/05 16:13  /cgi-bin/chat/chat.cgi?action=chat&id=gyintcfppwgmhmmtrarhtqscddxvvk&pause=
199 26/Mar/05 22:59  /cgi-bin/chat/chat.cgi?action=chat&id=turnoaxxewhwrfvyscbhrhdbvkvgsi&pause=
198 11/Mar/05 17:39  /cgi-bin/chat/chat.cgi?action=chat&id=pxfgwbccuvnxrfcbcggqpyijgxxbuu
198 26/Mar/05 19:54  /cgi-bin/chat/chat.cgi?action=chat&id=wfgnesofuitcczgvqtrwfksfgscrag&pause=
197  6/Mar/05 14:57  /cgi-bin/chat/chat.cgi?action=chat&id=ydxsgqfhzcvgduddglvxegnayrxnue
195  5/Mar/05 20:00  /cgi-bin/chat/chat.cgi?action=chat&id=intywxfwqqbjhjdoxmfszbdgcldndj&pause=
192 26/Mar/05 20:06  /cgi-bin/chat/chat.cgi?action=chat&id=kmikzzagsqutngutbjgqntggrmulrm
192  5/Mar/05 22:52  /cgi-bin/chat/chat.cgi?action=chat&id=hnuxisblwbvlsqisttfrofqcannumc&pause=
191 20/Mar/05 14:29  /cgi-bin/chat/chat.cgi?action=chat&id=ahffdleplcshrwatdqqoploenhnacl
189 28/Mar/05 12:09  /cgi-bin/chat/chat.cgi?action=chat&id=xiwauomfjmfwsamawnfoczixuvcwht&pause=
187 13/Mar/05 19:44  /cgi-bin/chat/chat.cgi?action=chat&id=cbvgtyogkyniluuvytxcfdcvvhhatt&pause=
187 10/Mar/05 16:09  /cgi-bin/chat/chat.cgi?action=chat&id=asscdcfrwbzojcyxpvnkqoxhwzimgo&pause=
184  6/Mar/05 16:36  /cgi-bin/chat/chat.cgi?action=chat&id=gdbuwamccgmdgmehpdxgnblkhfphlf&pause=
184  8/Mar/05 18:34  /cgi-bin/chat/chat.cgi?action=chat&id=nieelcxohjzuaequtoeaclitgwsyei
184 27/Mar/05 17:47  /cgi-bin/chat/chat.cgi?action=chat&id=ijzqgmwwkrdzvbbcmdlmjppshjpeop&pause=
182 12/Mar/05 12:28  /cgi-bin/chat/chat.cgi?action=chat&id=siupqaouirwbmsxjgkvbpoxuixlqau&pause=
181 11/Mar/05 18:00  /cgi-bin/chat/chat.cgi?action=chat&id=dztfmmhzhsjhxdaukwuertmbqajtrt
181 27/Mar/05 20:58  /cgi-bin/chat/chat.cgi?action=chat&id=cypinfionwfftkjcxvfkqizqugziif&pause=
181  3/Mar/05 20:37  /cgi-bin/chat/chat.cgi?action=chat&id=ytsfveaeliygfuprpjeoszfvstfavw&pause=
180  3/Mar/05 18:20  /cgi-bin/chat/chat.cgi?action=chat&id=kqzgkjlutjjmoqguqvrnjguupgngbj&pause=
179  7/Mar/05 16:29  /cgi-bin/chat/chat.cgi?action=chat&id=oezzbnvdhsgjlvsontschloeljrhai
179  7/Mar/05 18:31  /cgi-bin/chat/chat.cgi?action=chat&id=mkkhtehlmrefavmyxenipxznbpmpkn&pause=
178  7/Mar/05 19:46  /cgi-bin/chat/chat.cgi?action=chat&id=eujixbcdowgvbnzrrphiqqqvaqknsl&pause=
176 17/Mar/05 19:40  /cgi-bin/chat/chat.cgi?action=chat&id=shpefwgmjujqkookbgldzjjzwhfydf&pause=
176  8/Mar/05 18:29  /cgi-bin/chat/chat.cgi?action=chat&id=ikmehihgoejbfnfoirgvxukaclfrcd&pause=
175  6/Mar/05 19:19  /cgi-bin/chat/chat.cgi?action=chat&id=teqqzkdpdlrjtfykspziivgmaremzp&pause=
175  7/Mar/05 17:44  /cgi-bin/chat/chat.cgi?action=chat&id=cogcygqrivopsrsjiswoigmutugxmn
175  6/Mar/05 19:53  /cgi-bin/chat/chat.cgi?action=chat&id=bnfynfwbgvorcxwvbpsoqvvqixnnna
175  5/Mar/05 16:10  /cgi-bin/chat/chat.cgi?action=chat&id=shsfpfdlqwegfgzalxfeyibwvvrscq
174 14/Mar/05 17:25  /cgi-bin/chat/chat.cgi?action=chat&id=avlddnxgqghohwygussjcraujcjlxh
174  3/Mar/05 18:36  /cgi-bin/chat/chat.cgi?action=chat&id=pbuicapzbyjivlqsapctpfwpmutrrk&pause=
174  6/Mar/05 15:50  /cgi-bin/chat/chat.cgi?action=chat&id=bztdoedccbjxdukbwzxiotssvwiffe&pause=
173  2/Mar/05 17:33  /cgi-bin/chat/chat.cgi?action=chat&id=iirrpcxfraldzpejkpzudcfsemiisx&pause=
171 28/Mar/05 12:10  /cgi-bin/chat/chat.cgi?action=chat&id=oruhmsgwbqymbzbndrywkgyalaptnc
169  5/Mar/05 19:30  /cgi-bin/chat/chat.cgi?action=chat&id=atseylzywgxdjplouunuslbretyuqm&pause=
168  1/Mar/05 18:49  /cgi-bin/chat/chat.cgi?action=chat&id=lduuumvwxoqnuctkunhxmzpsjcgrgg&pause=
168  7/Mar/05 21:35  /cgi-bin/chat/chat.cgi?action=chat&id=eekpmvvijydvwjzeyumswhldnsdlps
168  8/Mar/05 20:04  /cgi-bin/chat/chat.cgi?action=chat&id=ktubtqyghvwhcbqryqvplbzprypnhn
167 25/Mar/05 18:00  /cgi-bin/chat/chat.cgi?action=chat&id=ulsqpblxjfgvuwgvujuruuormtbcak
167  2/Mar/05 19:36  /cgi-bin/chat/chat.cgi?action=chat&id=nbgghdnpnayeimalicmoevsrwwaeal
166  6/Mar/05 17:24  /cgi-bin/chat/chat.cgi?action=chat&id=zeyiunomuoslyvkhakjhkvmzuobipg&pause=
165  5/Mar/05 22:21  /cgi-bin/chat/chat.cgi?action=chat&id=utadwqcgwwqpncvibxidksypdzeksm
165 14/Mar/05 19:55  /cgi-bin/chat/chat.cgi?action=chat&id=uaqbfpwmkitejkdlxpkcpzimtndodi&pause=
165 23/Mar/05 19:16  /cgi-bin/chat/chat.cgi?action=chat&id=ebwktjzyhmpcqawagbsxmspygonpah&pause=
164 23/Mar/05 13:28  /cgi-bin/chat/chat.cgi?action=chat&id=oertpkcxbgfyztifrujbkdholkdrsa&pause=
162 20/Mar/05 14:26  /cgi-bin/chat/chat.cgi?action=chat&id=bsxscsxyfpajygxiaoaazfvioallfq&pause=
161 11/Mar/05 23:38  /cgi-bin/chat/chat.cgi?action=chat&id=rdolmmbowjqmxmsyfutbdtzrcqaqrd
161 25/Mar/05 20:31  /cgi-bin/chat/chat.cgi?action=chat&id=auhdkqrmrkxrouuyunepvsilqoglkg
160 15/Mar/05 19:32  /cgi-bin/chat/chat.cgi?action=chat&id=suvdfgeffsczvsbxcbtholgtukigpr
160 23/Mar/05 19:43  /cgi-bin/chat/chat.cgi?action=chat&id=tkzsoiksunfgdrvfosahtwssitmwks&pause=
159 11/Mar/05 20:28  /cgi-bin/chat/chat.cgi?action=chat&id=rhlqvetkafrleegcvnbyavqrtiozbv&pause=
159  4/Mar/05 19:14  /cgi-bin/chat/chat.cgi?action=chat&id=rpateyeszyczdfslgsnhkuedqklslv
157 17/Mar/05 16:49  /cgi-bin/chat/chat.cgi?action=chat&id=aclvcwesbpqhdumnakzniidazlvddb
157  6/Mar/05 17:51  /cgi-bin/chat/chat.cgi?action=chat&id=uqhfvidhcdukbcsyuosenxhizbvzts&pause=
157 13/Mar/05 15:53  /cgi-bin/chat/chat.cgi?action=chat&id=nrjxdhlatbfpqpyjzcsovhljbqgdri&pause=
156 17/Mar/05 17:39  /cgi-bin/chat/chat.cgi?action=chat&id=oxgzksmehydxmoianbepzqxicsmpie
156 19/Mar/05 19:45  /cgi-bin/chat/chat.cgi?action=chat&id=qgmpoikpflfhsdchmammygefrtwjrp&pause=
156  5/Mar/05 19:40  /cgi-bin/chat/chat.cgi?action=chat&id=rapavqugaufihpdnkmmaaztcazqdpd&pause=
156 25/Mar/05 18:08  /cgi-bin/chat/chat.cgi?action=chat&id=unusrfibkgrxdmvafpnwrndamstfzl&pause=
156 11/Mar/05 23:56  /cgi-bin/chat/chat.cgi?action=chat&id=frgvcitvpsekghhevjjjbezzroggst
155  1/Mar/05 16:00  /cgi-bin/chat/chat.cgi?action=chat&id=chequlioyyefiviqqudfcfytjfwuoq
155 25/Mar/05 20:19  /cgi-bin/chat/chat.cgi?action=chat&id=cytxnkazystdgcfsfkfuznsnfapiac
154 27/Mar/05 18:12  /cgi-bin/chat/chat.cgi?action=chat&id=qousauezedspxywjifsivhdmnsdqqu
154 17/Mar/05 13:42  /cgi-bin/chat/chat.cgi?action=chat&id=qhpfghvoyzjcnkldipbikfvobiexnp
153  3/Mar/05 20:28  /cgi-bin/chat/chat.cgi?action=chat&id=qhzicnrjgmlnwozqudbnblwnbttllq
152  9/Mar/05 17:43  /cgi-bin/chat/chat.cgi?action=chat&id=vocszanudsavelncmxqaeovvxrcsco
152 17/Mar/05 08:52  /cgi-bin/chat/chat.cgi?action=chat&id=lzowjnnragicohonqcdgshfecqjvso
151  5/Mar/05 10:05  /cgi-bin/chat/chat.cgi?action=chat&id=ahdfanegarlajihpynhponmvhswptv
150 17/Mar/05 18:08  /cgi-bin/chat/chat.cgi?action=chat&id=fmdfnabwgwebmnpnvwbyzaizeunkiu&pause=
150 11/Mar/05 23:24  /cgi-bin/chat/chat.cgi?action=chat&id=frgvcitvpsekghhevjjjbezzroggst&pause=
149 13/Mar/05 19:46  /cgi-bin/chat/chat.cgi?action=chat&id=nhrmmlktlxyyxmqezrfnwjqlcodtaf
149  4/Mar/05 15:09  /cgi-bin/chat/chat.cgi?action=chat&id=komccbefukqwxsybgkwrqtvdhntabt&pause=
149  9/Mar/05 08:00  /cgi-bin/chat/chat.cgi?action=chat&id=uohlwlevsfvhqfamsbnkgsphhmtuwe
149  2/Mar/05 18:08  /cgi-bin/chat/chat.cgi?action=chat&id=jylxyzfxmpgrdjmggieihokkqrivjg
149  3/Mar/05 18:34  /cgi-bin/chat/chat.cgi?action=chat&id=khqoojyjgvoivcwqoulywqgiibeqeg
149 12/Mar/05 11:48  /cgi-bin/chat/chat.cgi?action=chat&id=alhaqgkzhipxcrruhsdpvwxkgnojkr&pause=
148 25/Mar/05 20:24  /cgi-bin/chat/chat.cgi?action=chat&id=ctfmyeopwbgnltqcllpaysssanjdjc&pause=
148 17/Mar/05 17:41  /cgi-bin/chat/chat.cgi?action=chat&id=fdyjwrvlpcbuxsspeggvowmfibmxjd
148 26/Mar/05 11:43  /cgi-bin/chat/chat.cgi?action=chat&id=jswhxkpbjgdeizjefgydabvfzwvkbp
147  9/Mar/05 19:47  /cgi-bin/chat/chat.cgi?action=chat&id=itmajktxuecshcrtyfbkdefgzpnobk&pause=
147 14/Mar/05 19:31  /cgi-bin/chat/chat.cgi?action=chat&id=eujfxdjtpmoxjjxiswrvojmziwnckp
145 26/Mar/05 11:43  /cgi-bin/chat/chat.cgi?action=chat&id=cecztnthfhorxavvbfhrzttdruzpga&pause=
145  1/Mar/05 18:35  /cgi-bin/chat/chat.cgi?action=chat&id=wnqphiklbneuhdgqgzjtofejsguvkp&pause=
145  6/Mar/05 17:11  /cgi-bin/chat/chat.cgi?action=chat&id=wikzxsjeuwcjkaqfgekrkocscrzqou&pause=
145 12/Mar/05 19:49  /cgi-bin/chat/chat.cgi?action=chat&id=yhrarcxtkenyunorkjxmyzcmkihydo&pause=
145  3/Mar/05 18:41  /cgi-bin/chat/chat.cgi?action=chat&id=fpycytjknrujlwvjajxopaeyvfsvcr&pause=
145 27/Mar/05 20:58  /cgi-bin/chat/chat.cgi?action=chat&id=wacrmyqrcecylckgqyzaexegydheqf&pause=
144 10/Mar/05 18:08  /cgi-bin/chat/chat.cgi?action=chat&id=kiwsvrdmaqigulseziorolnwkbyymn&pause=
143 25/Mar/05 19:08  /cgi-bin/chat/chat.cgi?action=chat&id=vxsijuahvqhadouxdabucssxytrfny&pause=
141 14/Mar/05 18:12  /cgi-bin/chat/chat.cgi?action=chat&id=sjqwnnwrhhnilcoulyolnztbodwmwz
140 14/Mar/05 20:14  /cgi-bin/chat/chat.cgi?action=chat&id=uaqbfpwmkitejkdlxpkcpzimtndodi
138 20/Mar/05 14:14  /cgi-bin/chat/chat.cgi?action=chat&id=dklhirnmykmutwebofnvcpfvhyswov&pause=
137 17/Mar/05 20:23  /cgi-bin/chat/chat.cgi?action=chat&id=qvwswonfpsqepsyjiasnzecuyyiqiq&pause=
136 11/Mar/05 20:41  /cgi-bin/chat/chat.cgi?action=chat&id=lcrnxevxypoljflmuwnfwpxrioadro&pause=
135  1/Mar/05 19:54  /cgi-bin/chat/chat.cgi?action=chat&id=zsilalkwolsghfaojbhrldlcgapdvq&pause=
135  4/Mar/05 16:39  /cgi-bin/chat/chat.cgi?action=chat&id=skqjgjsbklfqiiiqblhgksppknfanv
134  2/Mar/05 19:42  /cgi-bin/chat/chat.cgi?action=chat&id=hkitgjebjywftctghfnuibcbsjziez
134 17/Mar/05 19:45  /cgi-bin/chat/chat.cgi?action=chat&id=zfqkibhpzhtmyhsneaivhgjcnyxxsd&pause=
134 15/Mar/05 20:28  /cgi-bin/chat/chat.cgi?action=chat&id=ibiubcdyycnixfbzmwxrzblulvkqie&pause=
133  7/Mar/05 18:29  /cgi-bin/chat/chat.cgi?action=chat&id=hwckcqbojxgmiohpwrnrjuxiqudwos&pause=
133 12/Mar/05 00:00  /cgi-bin/chat/chat.cgi?action=chat&id=rdolmmbowjqmxmsyfutbdtzrcqaqrd&pause=
132 20/Mar/05 20:10  /cgi-bin/chat/chat.cgi?action=chat&id=qvyaktiudutxoikugirlozqklprzag
131 28/Mar/05 12:22  /cgi-bin/chat/chat.cgi?action=chat&id=elpqpvydzqqxjqrjtfzjsjrjibvhch
131  7/Mar/05 16:17  /cgi-bin/chat/chat.cgi?action=chat&id=dxksahhnijukbemipreqxmnetwqxge
131 23/Mar/05 19:45  /cgi-bin/chat/chat.cgi?action=chat&id=eexnqoeohfuokykobvumnoxpbniihg&pause=
130 16/Mar/05 20:24  /cgi-bin/chat/chat.cgi?action=chat&id=izltrohrtjlhfuywothleowdobnlhf&pause=
130 12/Mar/05 16:05  /cgi-bin/chat/chat.cgi?action=chat&id=pjocrowyidrxmadwbzwisfopmmqtlz&pause=
128  5/Mar/05 19:18  /cgi-bin/chat/chat.cgi?action=chat&id=bggwhcfpyeikrhjrzppnznvosuubjm&pause=
128 14/Mar/05 20:22  /cgi-bin/chat/chat.cgi?action=chat&id=jfnfforfcwaqyjzltdspterhphugei
128  4/Mar/05 19:49  /cgi-bin/chat/chat.cgi?action=chat&id=sxbrkhxebqfdjzimslfxxhoiedhfkf&pause=
128  3/Mar/05 20:06  /cgi-bin/chat/chat.cgi?action=chat&id=kmifrwbcfomoglgsmdcogzcmpjnbhm
127 20/Mar/05 19:59  /cgi-bin/chat/chat.cgi?action=chat&id=dehaqpgsagxqkmsdkfesthwhterqod&pause=
127  7/Mar/05 16:24  /cgi-bin/chat/chat.cgi?action=chat&id=kpqhgxizzshmdduarpljacpvaumryv
126  8/Mar/05 16:26  /cgi-bin/chat/chat.cgi?action=chat&id=xnclptmlwnexyyzxaxdblxhvkwjwki&pause=
126  6/Mar/05 19:20  /cgi-bin/chat/chat.cgi?action=chat&id=qqbyuuccpiauilkqiwxdkheehlhoiv
126 14/Mar/05 15:59  /cgi-bin/chat/chat.cgi?action=chat&id=dsqildewytcybfvptgjclsieqecxxt&pause=
126 25/Mar/05 20:25  /cgi-bin/chat/chat.cgi?action=chat&id=ctyyjyjmzazhmkasttxynoxkwqcpyk&pause=
125 15/Mar/05 17:39  /cgi-bin/chat/chat.cgi?action=chat&id=ngewjlqfrjjxuytzdmmacflfpuwjvt
125  6/Mar/05 08:21  /cgi-bin/chat/chat.cgi?action=chat&id=ipemlraxidxooitdrhhpcbxvfbxmdz
125 13/Mar/05 16:17  /cgi-bin/chat/chat.cgi?action=chat&id=bumegixzkbbzmaygpxrntibwtwqqyt&pause=
124 12/Mar/05 01:43  /cgi-bin/chat/chat.cgi?action=chat&id=itjushapocijtaovjllpeypfpfovae&pause=
124 23/Mar/05 19:44  /cgi-bin/chat/chat.cgi?action=chat&id=uxuizwwsrtutctjswthoptvvwylsgw&pause=
123  8/Mar/05 18:24  /cgi-bin/chat/chat.cgi?action=chat&id=ztttehtfduqitofvgijmuwldujcvqc&pause=
123  3/Mar/05 18:54  /cgi-bin/chat/chat.cgi?action=chat&id=vuvffrphmzomvzrznpvdcgcaiolzil&pause=
123 11/Mar/05 18:58  /cgi-bin/chat/chat.cgi?action=chat&id=ivupenclbyrwbstblecsskmppecyeh&pause=
123  7/Mar/05 23:42  /cgi-bin/chat/chat.cgi?action=chat&id=dxsvcvuvymfyrbwwpdlhxgadqyozwg&pause=
122  3/Mar/05 19:08  /cgi-bin/chat/chat.cgi?action=chat&id=wavzdzpjpfuuhsxkvvhaatzhoiflud
122 12/Mar/05 21:37  /cgi-bin/chat/chat.cgi?action=chat&id=jafngvclsqyfyvltzjihlmcpydrzhj&pause=
122 11/Mar/05 18:42  /cgi-bin/chat/chat.cgi?action=chat&id=opqkcusfzsalxvxcuujtlcmkgawqni&pause=
122 19/Mar/05 13:34  /cgi-bin/chat/chat.cgi?action=chat&id=yomygxdmregwtzfhsyigkkhdvehmjw&pause=
122 11/Mar/05 21:00  /cgi-bin/chat/chat.cgi?action=chat&id=ajokrprfbtmbpcpemssjoodntvjerw&pause=
122 16/Mar/05 20:38  /cgi-bin/chat/chat.cgi?action=chat&id=xdksvgacmajxrohqfoktpepptvctxi&pause=
121 14/Mar/05 20:20  /cgi-bin/chat/chat.cgi?action=chat&id=zdkwywmcmdyedrpycudqerchjkfscr&pause=
121 25/Mar/05 20:03  /cgi-bin/chat/chat.cgi?action=chat&id=goshqgcozzifmdhsxxhlnosrtagejm&pause=
120  3/Mar/05 20:36  /cgi-bin/chat/chat.cgi?action=chat&id=cvsuefhvtxjumvrfpyftwseyukfwnr
120  1/Mar/05 19:23  /cgi-bin/chat/chat.cgi?action=chat&id=xpsbgucgjxpgnllwnwojrhaxaynjyr&pause=
119 23/Mar/05 19:40  /cgi-bin/chat/chat.cgi?action=chat&id=ebwktjzyhmpcqawagbsxmspygonpah
119 25/Mar/05 14:41  /cgi-bin/chat/chat.cgi?action=chat&id=fgsxhfewymrzmtrdxstvwqaxvbzklt
119 13/Mar/05 19:48  /cgi-bin/chat/chat.cgi?action=chat&id=lylbnytdsqdslnbqtacsztyfzukbyh&pause=
118  9/Mar/05 20:36  /cgi-bin/chat/chat.cgi?action=chat&id=tbtrupaqetmaxjexxcssilzrnppalk
117  7/Mar/05 17:41  /cgi-bin/chat/chat.cgi?action=chat&id=cgcpeomeeqjvwmvnnpwoadtqeanibf
115  3/Mar/05 19:58  /cgi-bin/chat/chat.cgi?action=chat&id=rkdjfayeslstyzguihsxjkkmqmetnn&pause=
114  5/Mar/05 18:52  /cgi-bin/chat/chat.cgi?action=chat&id=mvpamyiohiupvficyjsmqzirlipyal&pause=
113 17/Mar/05 19:40  /cgi-bin/chat/chat.cgi?action=chat&id=ivxlfsalypyxwkkyhfptgyfevrwvcd
113 22/Mar/05 17:41  /cgi-bin/chat/chat.cgi?action=chat&id=iqzxosydljmaxkvxksqnfbdzrewcwi&pause=
113 16/Mar/05 20:32  /cgi-bin/chat/chat.cgi?action=chat&id=nwzvaelehqeufdsyhckupdmezdjsoh&pause=
113 13/Mar/05 17:02  /cgi-bin/chat/chat.cgi?action=chat&id=qqyrujkqbfnhymgfejuoqiawgqexsd
113  6/Mar/05 18:27  /cgi-bin/chat/chat.cgi?action=chat&id=rsmemgglpmyukaduxitssuhetttczb
112 11/Mar/05 21:00  /cgi-bin/chat/chat.cgi?action=chat&id=lcrnxevxypoljflmuwnfwpxrioadro
112  6/Mar/05 16:39  /cgi-bin/chat/chat.cgi?action=chat&id=sevbtegdftsthlqcfadqhjxewztoce&pause=
111  8/Mar/05 16:48  /cgi-bin/chat/chat.cgi?action=chat&id=mjyvmlbklwhvpawdduarplnsrijytz&pause=
111  2/Mar/05 19:10  /cgi-bin/chat/chat.cgi?action=chat&id=lnxnrbvhxixnfucmwmtbyhijpxyrjg
111  8/Mar/05 19:57  /cgi-bin/chat/chat.cgi?action=chat&id=pgdqntswwqmlpgemuukryacmspjrip&pause=
110  2/Mar/05 19:57  /cgi-bin/chat/chat.cgi?action=chat&id=hrmzlthupcvcsbbimqicicewvihwnu&pause=
110  4/Mar/05 18:49  /cgi-bin/chat/chat.cgi?action=chat&id=axyenzurltzipkojfmvysjxwihspel
110 14/Mar/05 18:19  /cgi-bin/chat/chat.cgi?action=chat&id=mohqgicepmlcgytszudctyogymdpgf&pause=
109  6/Mar/05 18:45  /cgi-bin/chat/chat.cgi?action=chat&id=fqidkavqfavjflzpaiygwczeghyyuc
108 23/Mar/05 16:35  /cgi-bin/chat/chat.cgi?action=chat&id=ojuobdrtrqzxsdoqnajyumcseipvdv&pause=
108 22/Mar/05 20:00  /cgi-bin/chat/chat.cgi?action=chat&id=equhbrdogjkfjauanekgkdyqeljqvi&pause=
108 17/Mar/05 17:05  /cgi-bin/chat/chat.cgi?action=chat&id=saykickghvknjqyaxbvvarsppxqmmp
108 23/Mar/05 17:31  /cgi-bin/chat/chat.cgi?action=chat&id=kukqoiapvtpayttxoifwsnfhfufcpl&pause=
107  8/Mar/05 19:26  /cgi-bin/chat/chat.cgi?action=chat&id=ftvvdvlaaqymezixbnchzertriyohd&pause=
107 17/Mar/05 16:44  /cgi-bin/chat/chat.cgi?action=chat&id=wjfkiykldoerqjtrarlcqrhbgsydhk
105 13/Mar/05 20:14  /cgi-bin/chat/chat.cgi?action=chat&id=etfpdpqgzfzshoxdcljmjfmcxbqtig&pause=
105  8/Mar/05 19:47  /cgi-bin/chat/chat.cgi?action=chat&id=qyfrybdjibupanzkbnoevjzdpyulgw&pause=
105 25/Mar/05 14:57  /cgi-bin/chat/chat.cgi?action=chat&id=hnwhjwoxnlwalhxfricrcglopbvmis&pause=
105  9/Mar/05 21:15  /cgi-bin/chat/chat.cgi?action=chat&id=sdgkuygvkllhnvcobfowgnnaxuyrru&pause=
104 11/Mar/05 20:56  /cgi-bin/chat/chat.cgi?action=chat&id=uduvjvkmyssizwxapgdhzdvzgbfmjl&pause=
103  1/Mar/05 13:31  /cgi-bin/chat/chat.cgi?action=chat&id=ynlbyjjimbejnyzjtazylblmbhaoor
103 17/Mar/05 17:42  /cgi-bin/chat/chat.cgi?action=chat&id=zszkvqcyhftoraxiouuqligfwqlkss&pause=
103  2/Mar/05 20:05  /cgi-bin/chat/chat.cgi?action=chat&id=dphocjbcuaqmiqhsdoxusspehueckm&pause=
101  8/Mar/05 19:29  /cgi-bin/chat/chat.cgi?action=chat&id=kceerlolbjmelczzxbasnizoqomizi&pause=
101  9/Mar/05 20:37  /cgi-bin/chat/chat.cgi?action=chat&id=wymzlbtywcfbxitvmxiynlfoxfsdlk&pause=
100  5/Mar/05 21:53  /cgi-bin/chat/chat.cgi?action=chat&id=dkkgsuofaruoapdrchvnqxujgdgscq
100  9/Mar/05 19:48  /cgi-bin/chat/chat.cgi?action=chat&id=wkwnvozskkcddcdjrekplxcaezoajt&pause=
100  3/Mar/05 20:36  /cgi-bin/chat/chat.cgi?action=chat&id=qouwedjuhubdfiejyqyxozvagichbx&pause=
99 25/Mar/05 19:38  /cgi-bin/chat/chat.cgi?action=chat&id=dhrhgevxgjlebnfakhnifozuragxlh
99  1/Mar/05 18:08  /cgi-bin/chat/chat.cgi?action=chat&id=fgckmkvdmgydfeumiojxztfpsihjkj
99  8/Mar/05 15:36  /cgi-bin/chat/chat.cgi?action=chat&id=bwsrzfphzvzwnuoniqejbaejrodnnt
98 26/Mar/05 17:07  /cgi-bin/chat/chat.cgi?action=chat&id=kkuquzwpokvmrasrnqhzyffypkanmc
98 21/Mar/05 19:54  /cgi-bin/chat/chat.cgi?action=chat&id=msoawxvskaxiunoqenxlbosnybqymz&pause=
97  4/Mar/05 18:51  /cgi-bin/chat/chat.cgi?action=chat&id=vovcjrmunjyljzpgdtslljnlhvaxqg&pause=
97  6/Mar/05 17:11  /cgi-bin/chat/chat.cgi?action=chat&id=bmgipsmnehlujaospxmxhnpemoelyn
97 20/Mar/05 23:46  /cgi-bin/chat/chat.cgi?action=chat&id=bkfymkktbwflftbpckmagbiyutefsw
96 25/Mar/05 16:42  /cgi-bin/chat/chat.cgi?action=chat&id=zpmsnxvrgfzphtgtvxaipvkuzgmipg
96 14/Mar/05 18:15  /cgi-bin/chat/chat.cgi?action=chat&id=gziniuhudlzxkybhhwulsgtmshmwno&pause=
95 14/Mar/05 18:48  /cgi-bin/chat/chat.cgi?action=chat&id=tcfiprcprflwwrwzaqxaqqdozulxko&pause=
94  6/Mar/05 15:53  /cgi-bin/chat/chat.cgi?action=chat&id=jgdcvjlfozhmhfkvpyncyxwnetrwzn&pause=
94 11/Mar/05 20:53  /cgi-bin/chat/chat.cgi?action=chat&id=sxydlvnnlnaovyytyttwtyfhtznztx&pause=
94 12/Mar/05 20:51  /cgi-bin/chat/chat.cgi?action=chat&id=rxpjeaggbqasynjbsshsfxtyugosgk
94 26/Mar/05 13:45  /cgi-bin/chat/chat.cgi?action=chat&id=kqahtvpnthgxehrdhozfnrfoqsbghn
94  8/Mar/05 21:47  /cgi-bin/chat/chat.cgi?action=chat&id=uuifyexbmaassywlbmtmsqpvqmstsq&pause=
94 19/Mar/05 19:52  /cgi-bin/chat/chat.cgi?action=chat&id=oafkkqbtstkfvsigumqbornsowzyha&pause=
93  7/Mar/05 16:47  /cgi-bin/chat/chat.cgi?action=chat&id=hfgqkddlmjujjnclpuwwfzgjcnieed&pause=
93 15/Mar/05 18:40  /cgi-bin/chat/chat.cgi?action=chat&id=mnhupmrfkcfzfuoobfnkadoxbjtrfb
93 18/Mar/05 16:46  /cgi-bin/chat/chat.cgi?action=chat&id=qyklgswroedkpbfmsezbbmgthljmkz&pause=
92  6/Mar/05 17:39  /cgi-bin/chat/chat.cgi?action=chat&id=xkxnudfagvvrekqthnlesxfhqbylnr
89 16/Mar/05 17:29  /cgi-bin/chat/chat.cgi?action=chat&id=abvhiqlbmzitpizdqzoroagdwfacnx
89 27/Mar/05 18:36  /cgi-bin/chat/chat.cgi?action=chat&id=zimdzavvqfpraorswmrnwpgwgkhgyp&pause=
89 13/Mar/05 18:36  /cgi-bin/chat/chat.cgi?action=chat&id=fzsvlxphuzwxxdakhkjadbzvpoeort&pause=
89 24/Mar/05 03:19  /cgi-bin/chat/chat.cgi?action=chat&id=cgpnuheojgjixsomlkpgtkkhedqopn
89 23/Mar/05 12:18  /cgi-bin/chat/chat.cgi?action=chat&id=emqlaisxxotzbgzvbyjtoevarjhjkb&pause=
88 21/Mar/05 18:23  /cgi-bin/chat/chat.cgi?action=chat&id=feowouktehmsgwrqausxsyqbottler&pause=
88 16/Mar/05 20:20  /cgi-bin/chat/chat.cgi?action=chat&id=pygbzguvcelfphbywhcdscujscvbas
88 16/Mar/05 18:46  /cgi-bin/chat/chat.cgi?action=chat&id=njzbztndulbhyivtxvkuyubuyfxhhk
88 23/Mar/05 17:41  /cgi-bin/chat/chat.cgi?action=chat&id=cvougrodfuwlzilicayyrofmfgehpk&pause=
87 25/Mar/05 06:27  /cgi-bin/chat/chat.cgi?action=chat&id=ztitdvhhpkjseonuwiceqrtepadrww
87 25/Mar/05 14:28  /cgi-bin/chat/chat.cgi?action=chat&id=msgqpkcrvypavwmottupwonaxcioox&pause=
87  7/Mar/05 23:44  /cgi-bin/chat/chat.cgi?action=chat&id=yedgxcsdwkmdxuraozapyijrkeqvnl
87  9/Mar/05 20:54  /cgi-bin/chat/chat.cgi?action=chat&id=jppwotebtdlbyqrfikincirsnoxqeg&pause=
87 19/Mar/05 19:56  /cgi-bin/chat/chat.cgi?action=chat&id=yoepufqdumqregiibeyajfqaacnssg&pause=
86  9/Mar/05 20:14  /cgi-bin/chat/chat.cgi?action=chat&id=tbtrupaqetmaxjexxcssilzrnppalk&pause=
85 18/Mar/05 17:51  /cgi-bin/chat/chat.cgi?action=chat&id=haufxmfqsbejsrmtpalnjcsmpuujvq&pause=
85 10/Mar/05 19:42  /cgi-bin/chat/chat.cgi?action=chat&id=aetskouyiwhotvczosplvmmrhbaqzq&pause=
85  4/Mar/05 19:51  /cgi-bin/chat/chat.cgi?action=chat&id=itzobnrfrmdejauhnzvanjtbssspic&pause=
85 15/Mar/05 17:57  /cgi-bin/chat/chat.cgi?action=chat&id=hxhkwwpmlpifqgwxkefftyilugnfpn&pause=
85 14/Mar/05 21:50  /cgi-bin/chat/chat.cgi?action=chat&id=hvlgkikcgauduqhvadzpcknaowiqfp
84 10/Mar/05 14:58  /cgi-bin/chat/chat.cgi?action=chat&id=shrqkgjyqvhpszwgkafvejccbykqyt&pause=
84 10/Mar/05 16:57  /cgi-bin/chat/chat.cgi?action=chat&id=ifkntwaxtrbyejadkuhzvvbuyozpgo&pause=
84 17/Mar/05 17:35  /cgi-bin/chat/chat.cgi?action=chat&id=svwcaqmtsuqfeuweuuihmcwwmufkze&pause=
84 11/Mar/05 21:47  /cgi-bin/chat/chat.cgi?action=chat&id=wxfyicyrabsflhegeohybowgpjxjfr
83  9/Mar/05 12:37  /cgi-bin/chat/chat.cgi?action=chat&id=bzamwqvupbtnsgmivsvvszjzbgtoda&pause=
83  3/Mar/05 15:55  /cgi-bin/chat/chat.cgi?action=chat&id=eyxbpgkgjjajumnismysfxqqdvtybi
83 14/Mar/05 20:00  /cgi-bin/chat/chat.cgi?action=chat&id=bgxsscnlwavujyqnkorowmgzmccolf&pause=
82 14/Mar/05 17:09  /cgi-bin/chat/chat.cgi?action=chat&id=cioxhjlupawqefnyrnpcogynyhsfoz
82  1/Mar/05 21:42  /cgi-bin/chat/chat.cgi?action=chat&id=hyagqakprwummkgqqjcwjgcdbrslap
81 15/Mar/05 19:17  /cgi-bin/chat/chat.cgi?action=chat&id=bbcwsmtbyiqdymtsgfevzmppeztxcq&pause=
81 26/Mar/05 13:48  /cgi-bin/chat/chat.cgi?action=chat&id=khtvhhrxjplmkpkaacytluddzuveap&pause=
80  8/Mar/05 18:59  /cgi-bin/chat/chat.cgi?action=chat&id=lseauqaucnfmrwqpekjqedpmvvvgxm
80 10/Mar/05 14:56  /cgi-bin/chat/chat.cgi?action=chat&id=qrykuxwqpiewodzbmkvskpppwlvtha
79 27/Mar/05 16:13  /cgi-bin/chat/chat.cgi?action=chat&id=dzmvdqetwiiqtotuqnkgizanpzcsdf
79  7/Mar/05 18:13  /cgi-bin/chat/chat.cgi?action=chat&id=tvqrkhymmjsukgsdkdwplzrofztyxa
78 16/Mar/05 21:04  /cgi-bin/chat/chat.cgi?action=chat&id=qkvbefdjhmvjqvvgknifaglpdiboif&pause=
78  3/Mar/05 17:33  /cgi-bin/chat/chat.cgi?action=chat&id=ervaayquwyrrxrwmffjshicamjkuma&pause=
78  7/Mar/05 19:33  /cgi-bin/chat/chat.cgi?action=chat&id=xieilhvbwlwgfyrndguxuxfhxpbxbt
78  7/Mar/05 19:43  /cgi-bin/chat/chat.cgi?action=chat&id=abmcfvsannblycqhjusllmotnrrkvc&pause=
77 10/Mar/05 15:54  /cgi-bin/chat/chat.cgi?action=chat&id=mwqjazpalupsierekrnqrjrbhutnqd&pause=
77  2/Mar/05 20:02  /cgi-bin/chat/chat.cgi?action=chat&id=hkneyalreebhkqrsayujkrhhhopojt
77 23/Mar/05 17:31  /cgi-bin/chat/chat.cgi?action=chat&id=kmlzwbsjrvxslrooneyhcqgaetovuc&pause=
77  4/Mar/05 18:44  /cgi-bin/chat/chat.cgi?action=chat&id=tzfwbghexadmzzzoducxjxhvczpthd&pause=
76 12/Mar/05 15:36  /cgi-bin/chat/chat.cgi?action=chat&id=ukhuwwhiqhyphupmqolamjkonlnhhq
75 18/Mar/05 20:13  /cgi-bin/chat/chat.cgi?action=chat&id=fdznjqzasqvamafxjaiteylcfuexxo
75 27/Mar/05 17:58  /cgi-bin/chat/chat.cgi?action=chat&id=creqtrewyohehrsbeieviqtmwyzmts&pause=
75  7/Mar/05 23:55  /cgi-bin/chat/chat.cgi?action=chat&id=njumfkowojskdglymkmwhiosmxbnhy&pause=
74 11/Mar/05 13:15  /cgi-bin/chat/chat.cgi?action=chat&id=csodxdkqxkaejxsrxzsroayewwdfwt
74  7/Mar/05 20:21  /cgi-bin/chat/chat.cgi?action=chat&id=ioifeotdwijmcxyuzoevsihzpkyyoh&pause=
74 13/Mar/05 18:50  /cgi-bin/chat/chat.cgi?action=chat&id=ewdhcmuopznlkmwfhhkzntalddfuzu&pause=
74 27/Mar/05 20:57  /cgi-bin/chat/chat.cgi?action=chat&id=xocxwpbujphptngunykttdpalwyhuw
74  9/Mar/05 10:22  /cgi-bin/chat/chat.cgi?action=chat&id=ixpniwdfbeeygnwbpjwbnalxqdpqtp
74  3/Mar/05 20:17  /cgi-bin/chat/chat.cgi?action=chat&id=odebmlegitoeqsccwbeuzjmfeqkdbj&pause=
73  6/Mar/05 07:56  /cgi-bin/chat/chat.cgi?action=chat&id=yxcsoupuewshgbwrahugrdeiqsbtak
72 16/Mar/05 16:43  /cgi-bin/chat/chat.cgi?action=chat&id=jcwiidjkykgnlroqczepsyjwdqkpiu&pause=
72 14/Mar/05 20:56  /cgi-bin/chat/chat.cgi?action=chat&id=auegfojebguvswglacabzecorcyprq&pause=
72 25/Mar/05 17:48  /cgi-bin/chat/chat.cgi?action=chat&id=afhborxrdznqlgflserpznepltlaju&pause=
72 18/Mar/05 17:58  /cgi-bin/chat/chat.cgi?action=chat&id=qqccwshnlbgpiqedpnmbybfpfraumj&pause=
70 25/Mar/05 13:32  /cgi-bin/chat/chat.cgi?action=chat&id=andbdwjbgukqlzcntdnnsugpgmmzda
70  7/Mar/05 21:46  /cgi-bin/chat/chat.cgi?action=chat&id=ytrbrndlbcfrnbovkvuntrlvouugfl&pause=
69 27/Mar/05 20:58  /cgi-bin/chat/chat.cgi?action=chat&id=yxznupwkyxpndzycioegmvqnolzfwt&pause=
69  3/Mar/05 20:27  /cgi-bin/chat/chat.cgi?action=chat&id=zumfhnuyoxrwugvwuwptdccctqmsgk&pause=
68  4/Mar/05 20:54  /cgi-bin/chat/chat.cgi?action=chat&id=pdannmxvyrwdnyyrpgpoifozegrqjf&pause=
68 17/Mar/05 18:38  /cgi-bin/chat/chat.cgi?action=chat&id=peyorntfzqvqeagayylrbfkwwphvdd&pause=
67  9/Mar/05 20:52  /cgi-bin/chat/chat.cgi?action=chat&id=vrghdeqsuysyobjjjajxxceixebkya&pause=
67  2/Mar/05 17:47  /cgi-bin/chat/chat.cgi?action=chat&id=ssrsnorvwpdlaydvykvlmptegpsaiz
67 11/Mar/05 19:01  /cgi-bin/chat/chat.cgi?action=chat&id=brpixywwlfxqmtqadodqmdjrxtzfpu
66 25/Mar/05 14:56  /cgi-bin/chat/chat.cgi?action=chat&id=snsltzeqlarfuhmauxhjoyfwzguvbm&pause=
65  3/Mar/05 17:11  /cgi-bin/chat/chat.cgi?action=chat&id=jlrzwotozxzalwfpuffltpsclmixoy&pause=
64  3/Mar/05 15:54  /cgi-bin/chat/chat.cgi?action=chat&id=faatvyqxirmejtzvmjvlwstpvfagfu&pause=
63 14/Mar/05 17:49  /cgi-bin/chat/chat.cgi?action=chat&id=sjqwnnwrhhnilcoulyolnztbodwmwz&pause=
63  6/Mar/05 15:47  /cgi-bin/chat/chat.cgi?action=chat&id=udysqwnlqnspaijmixavsplnlgbkwf&pause=
63 17/Mar/05 08:42  /cgi-bin/chat/chat.cgi?action=chat&id=mhncaylfyefoozsazshorlhompugqg&pause=
62  8/Mar/05 09:32  /cgi-bin/chat/chat.cgi?action=chat&id=wkckfeduxqmnypxwnvjchjzuubwtta&pause=
62  8/Mar/05 22:06  /cgi-bin/chat/chat.cgi?action=chat&id=lfpihqvuttzecsakfpebhljktqdbsd&pause=
62  3/Mar/05 19:38  /cgi-bin/chat/chat.cgi?action=chat&id=usnppyaxqgyasuwkjvkjadczsnjeuy
61  4/Mar/05 20:02  /cgi-bin/chat/chat.cgi?action=chat&id=sxbrkhxebqfdjzimslfxxhoiedhfkf
61 13/Mar/05 17:15  /cgi-bin/chat/chat.cgi?action=chat&id=barkuhbjqsfaexsnyyunarbmlbxngo
61  9/Mar/05 20:54  /cgi-bin/chat/chat.cgi?action=chat&id=zmncstzdkinncwruwopagvkddwmben
61 25/Mar/05 17:56  /cgi-bin/chat/chat.cgi?action=chat&id=fmswtjapamhnjtqjlwzxwrsbrydoyc
60 15/Mar/05 19:16  /cgi-bin/chat/chat.cgi?action=chat&id=wpqiqexhqlmlsybpbzrvphkyxoptzn&pause=
60 20/Mar/05 13:37  /cgi-bin/chat/chat.cgi?action=chat&id=lwaleysowbxyszdivtyxwpuvlbemia&pause=
60  5/Mar/05 18:53  /cgi-bin/chat/chat.cgi?action=chat&id=lmuzkrrriuhnkukrellfibsfniihno&pause=
59 11/Mar/05 17:36  /cgi-bin/chat/chat.cgi?action=chat&id=hdclbymmptnfcmvoxokqhihklxoelz&pause=
59  9/Mar/05 21:37  /cgi-bin/chat/chat.cgi?action=chat&id=issucdekrsthgczazjqlectzefbtse
59 18/Mar/05 16:39  /cgi-bin/chat/chat.cgi?action=chat&id=rfwzuxccnvgggyatthsupkppwmyryj
57 17/Mar/05 16:47  /cgi-bin/chat/chat.cgi?action=chat&id=wytmetyeelagjhzkuhqdlczmwndubg&pause=
57  4/Mar/05 18:32  /cgi-bin/chat/chat.cgi?action=chat&id=cpqjbaxmqleorsiqoiqgzsyxmmrfir&pause=
57  7/Mar/05 18:45  /cgi-bin/chat/chat.cgi?action=chat&id=esnnmzirjdmeukqfoduzxhpulpjivz
56 12/Mar/05 14:01  /cgi-bin/chat/chat.cgi?action=chat&id=xnlvholjackmzghzpmznhxbhtbbwck&pause=
56  2/Mar/05 18:50  /cgi-bin/chat/chat.cgi?action=chat&id=lnxnrbvhxixnfucmwmtbyhijpxyrjg&pause=
56 14/Mar/05 05:00  /cgi-bin/chat/chat.cgi?action=chat&id=hesrktlhhwieckeedrhupiijxilpno&pause=
55 17/Mar/05 17:48  /cgi-bin/chat/chat.cgi?action=chat&id=ddsdjjwmheiglqimsohtsohucgynfc&pause=
55  6/Mar/05 19:01  /cgi-bin/chat/chat.cgi?action=chat&id=rzvywvbzwofkhmipntlgpfkzqvopxa
55  6/Mar/05 19:39  /cgi-bin/chat/chat.cgi?action=chat&id=wekcsurhhiwsewjsudwwsbhediyrpe&pause=
54  5/Mar/05 14:31  /cgi-bin/chat/chat.cgi?action=chat&id=clulfenrgzggttjpckgetppqdxqwwe
53 14/Mar/05 17:37  /cgi-bin/chat/chat.cgi?action=chat&id=ebqqkormtvmolzeorulwdnbjmqychb&pause=
53 20/Mar/05 14:47  /cgi-bin/chat/chat.cgi?action=chat&id=cujjjwnsulrepucjrhebszocpsnfcv
52  8/Mar/05 16:08  /cgi-bin/chat/chat.cgi?action=chat&id=oaaocfcihzvcqrdwztvthewfqybtrq&pause=
52 15/Mar/05 17:28  /cgi-bin/chat/chat.cgi?action=chat&id=apfiobaswihbprhjbfxsuekbfhydkx&pause=
52 15/Mar/05 17:26  /cgi-bin/chat/chat.cgi?action=chat&id=aufdijxwfxgfwlmguzillvcdqyoqtm&pause=
51 12/Mar/05 15:12  /cgi-bin/chat/chat.cgi?action=chat&id=skjwzqkmwlgqrlzlgyomqzgmfmyift&pause=
51  6/Mar/05 15:37  /cgi-bin/chat/chat.cgi?action=chat&id=ataapnrxidgvkwdzoklgotniwgaxjh&pause=
51  2/Mar/05 19:03  /cgi-bin/chat/chat.cgi?action=chat&id=ybilmlaxlweqsqhatyiehupgkesxyb
50 28/Mar/05 07:10  /cgi-bin/chat/chat.cgi?action=chat&id=jdygupvinbuuopdqjfzuksgaaxnshr
50  8/Mar/05 18:52  /cgi-bin/chat/chat.cgi?action=chat&id=twqnbuvyqjuqigmquzynbtdyoqfstm&pause=
50 13/Mar/05 16:31  /cgi-bin/chat/chat.cgi?action=chat&id=lhdayfcfmoglgfvgqgdwujrokesjej
50 13/Mar/05 00:59  /cgi-bin/chat/chat.cgi?action=chat&id=hcuslhrllhjtkeuupcslyhbmmvposg
49 12/Mar/05 16:50  /cgi-bin/chat/chat.cgi?action=chat&id=djoeyuqeurcghkqkxxxmylgijoqqdp&pause=
49 15/Mar/05 20:27  /cgi-bin/chat/chat.cgi?action=chat&id=gunblxhlakxojdegffuhdsziryjrbw&pause=
48  6/Mar/05 17:19  /cgi-bin/chat/chat.cgi?action=chat&id=kmtsgcslgrjtjwsyyrvvltdmhgvzdc
48 16/Mar/05 20:39  /cgi-bin/chat/chat.cgi?action=chat&id=tffkvlnbcabciuscffxhzochklciib&pause=
48 13/Mar/05 23:26  /cgi-bin/chat/chat.cgi?action=chat&id=bjhzjzrenfudkuzrulxznajmmomqlv
48 25/Mar/05 20:31  /cgi-bin/chat/chat.cgi?action=chat&id=ijmmzqjwwnzewvepjbwmcwhlwhwnea&pause=
48  3/Mar/05 19:21  /cgi-bin/chat/chat.cgi?action=chat&id=ggcfixldsdnaypaiisvxmmnjxwnbtz
48 19/Mar/05 21:19  /cgi-bin/chat/chat.cgi?action=chat&id=jtcihxrsldcjmcjntlxuayfuspqzth
47 27/Mar/05 20:01  /cgi-bin/chat/chat.cgi?action=chat&id=ukpvbfdspbkcajseewzuqfmpounpcm&pause=
47 10/Mar/05 21:02  /cgi-bin/chat/chat.cgi?action=chat&id=gxwybdshmxrnrjohiszqhnelulicdh
47 15/Mar/05 20:39  /cgi-bin/chat/chat.cgi?action=chat&id=wpprtzdyaqmteywhwyorphgsdcneql&pause=
47 11/Mar/05 20:58  /cgi-bin/chat/chat.cgi?action=chat&id=nmrbnjifbflkaqwywvtgtvdmcdctil&pause=
47  9/Mar/05 18:50  /cgi-bin/chat/chat.cgi?action=chat&id=enzogcwhumettoyzoejdctwqklmuig&pause=
47  6/Mar/05 13:20  /cgi-bin/chat/chat.cgi?action=chat&id=gdsoiloheutgcwhtxpuhipusmkkpce
47 12/Mar/05 20:46  /cgi-bin/chat/chat.cgi?action=chat&id=memsjyvazjxipjeoqhlvfhczqllltx&pause=
46 19/Mar/05 20:15  /cgi-bin/chat/chat.cgi?action=chat&id=lbpjjuohkvkvprbzkezlqpbrlptkcs
46  9/Mar/05 21:00  /cgi-bin/chat/chat.cgi?action=chat&id=koffhateophgyxsyzlqtrufrcremmq
46 25/Mar/05 13:20  /cgi-bin/chat/chat.cgi?action=chat&id=odrsvcfltvqalosgrybkvumbgxlddr&pause=
46  1/Mar/05 16:07  /cgi-bin/chat/chat.cgi?action=chat&id=ahxqqknwbqelifzazuatjfnrmvexbo&pause=
46 12/Mar/05 17:31  /cgi-bin/chat/chat.cgi?action=chat&id=vlupitdeckttrzbifjqtoumwfbsfub&pause=
46  5/Mar/05 14:34  /cgi-bin/chat/chat.cgi?action=chat&id=bocdqbsgacxohjbhelmxiojuozebxu
46 12/Mar/05 21:29  /cgi-bin/chat/chat.cgi?action=chat&id=evfonhouulqvhsjepdhukgnyrdvpcc&pause=
45 26/Mar/05 11:13  /cgi-bin/chat/chat.cgi?action=chat&id=hdlrguwofgygxjwebeagumsrsdshvw&pause=
45  8/Mar/05 22:33  /cgi-bin/chat/chat.cgi?action=chat&id=eqbcfalinenxpmjxtlrptyjplrhlab&pause=
45 27/Mar/05 16:56  /cgi-bin/chat/chat.cgi?action=chat&id=sdvaynudkfbenchysktntognytnkru&pause=
45 19/Mar/05 18:21  /cgi-bin/chat/chat.cgi?action=chat&id=gzabrkddnepohkvwqsytoxunrujpqs
45 21/Mar/05 17:15  /cgi-bin/chat/chat.cgi?action=chat&id=eaageujdrgfjcvpjmqlfvgrutatdhl
45 25/Mar/05 20:01  /cgi-bin/chat/chat.cgi?action=chat&id=auhdkqrmrkxrouuyunepvsilqoglkg&pause=
44 25/Mar/05 20:35  /cgi-bin/chat/chat.cgi?action=chat&id=ctyyjyjmzazhmkasttxynoxkwqcpyk
44 10/Mar/05 23:40  /cgi-bin/chat/chat.cgi?action=chat&id=eigowwgxousmnypdffiormososkgzz&pause=
44  7/Mar/05 18:00  /cgi-bin/chat/chat.cgi?action=chat&id=xqyyjptsqejjmelpmwmaejqhxpniqo&pause=
43 21/Mar/05 18:33  /cgi-bin/chat/chat.cgi?action=chat&id=ylgigxzlqccavwasmshgbhnfollier
43  5/Mar/05 14:15  /cgi-bin/chat/chat.cgi?action=chat&id=bdawjsryugdvkpvyeeezywzilnzyxi
42  9/Mar/05 11:17  /cgi-bin/chat/chat.cgi?action=chat&id=vsjskhksyibzgwhpkmsxslqtttjlrc&pause=
42  6/Mar/05 18:02  /cgi-bin/chat/chat.cgi?action=chat&id=ifhinhvxjbzawqexozmubfkicpgqsq&pause=
42  2/Mar/05 16:53  /cgi-bin/chat/chat.cgi?action=chat&id=fqowzlvnrluiryljukzqybjpuptqkz&pause=
42 12/Mar/05 13:25  /cgi-bin/chat/chat.cgi?action=chat&id=mtpmeqzerdjmzravhxrdfbaenncrrp&pause=
42  5/Mar/05 22:02  /cgi-bin/chat/chat.cgi?action=chat&id=bhfxnfqhfuavedbfcpjlnpxkjbsudj&pause=
41 14/Mar/05 21:20  /cgi-bin/chat/chat.cgi?action=chat&id=hvlgkikcgauduqhvadzpcknaowiqfp&pause=
41 23/Mar/05 17:28  /cgi-bin/chat/chat.cgi?action=chat&id=aatjslfsviajmxiapopatmlpjeunav&pause=
40 26/Mar/05 19:55  /cgi-bin/chat/chat.cgi?action=chat&id=jzwikvrgqnqratytaobudbcsshgtxq&pause=
40  6/Mar/05 18:35  /cgi-bin/chat/chat.cgi?action=chat&id=eqxntnipdxfxosrsuvwwlixtyambmi
40 11/Mar/05 15:17  /cgi-bin/chat/chat.cgi?action=chat&id=glifbndnlazltxbcpcuqqdfukoukjn&pause=
40 12/Mar/05 11:53  /cgi-bin/chat/chat.cgi?action=chat&id=egfjxyvvfqrtmfrhovigotkoqgjbie
39  2/Mar/05 17:28  /cgi-bin/chat/chat.cgi?action=chat&id=otlazbamaekwgstgiawftalgrhvbdd&pause=
39  8/Mar/05 15:36  /cgi-bin/chat/chat.cgi?action=chat&id=xnxmecqhaedhwsgqomyxpepbggosov
39  7/Mar/05 16:45  /cgi-bin/chat/chat.cgi?action=chat&id=xnxifwzevnuknoglrafpdisswpdwxd&pause=
39 23/Mar/05 17:09  /cgi-bin/chat/chat.cgi?action=chat&id=vkjgakhvoinvsdqwozpucrjzknvmmf&pause=
39 16/Mar/05 21:11  /cgi-bin/chat/chat.cgi?action=chat&id=ipvlrjgzleoeaotcuzbtikroeenrnv&pause=
39 26/Mar/05 16:23  /cgi-bin/chat/chat.cgi?action=chat&id=pxvkzpatiaepztdlmhqsvmdzadweco&pause=
38 25/Mar/05 14:39  /cgi-bin/chat/chat.cgi?action=chat&id=yluuigjhriywuhuwdmrjrowqjkpglk&pause=
38 11/Mar/05 21:31  /cgi-bin/chat/chat.cgi?action=chat&id=hquiutnotjzaapolxriaxrappomtua&pause=
38  7/Mar/05 21:45  /cgi-bin/chat/chat.cgi?action=chat&id=xqtabvgpicaolnrqxatldrnkjbhhzi&pause=
38  5/Mar/05 15:26  /cgi-bin/chat/chat.cgi?action=chat&id=wggqwxlrpoxzdflsnqmyjcwdxphxdo
38 27/Mar/05 20:33  /cgi-bin/chat/chat.cgi?action=chat&id=jhsinnqqyxsydhpwuqinsksiwcxzev&pause=
38 18/Mar/05 20:01  /cgi-bin/chat/chat.cgi?action=chat&id=edpqeughpgjfgosntuqnnqwcwlhccs&pause=
37  9/Mar/05 17:55  /cgi-bin/chat/chat.cgi?action=chat&id=lrczetmhzelfwebzccxesntfmfsjcz&pause=
37 12/Mar/05 16:41  /cgi-bin/chat/chat.cgi?action=chat&id=jlshqgyzyytwjslayrsqyavlgxedue&pause=
37  4/Mar/05 20:22  /cgi-bin/chat/chat.cgi?action=chat&id=rauiigfsexnczflppysxzhmfqvpeyw&pause=
37 18/Mar/05 15:48  /cgi-bin/chat/chat.cgi?action=chat&id=xvoynlnkoqbdaxqrhapslvfigeyzwv&pause=
36 18/Mar/05 17:45  /cgi-bin/chat/chat.cgi?action=chat&id=wtdtoougqiphcjljfaixxasqadqpba
36 13/Mar/05 21:38  /cgi-bin/chat/chat.cgi?action=chat&id=esxntigsacgstyadnyltjaomwabvjx&pause=
36 18/Mar/05 20:25  /cgi-bin/chat/chat.cgi?action=chat&id=mnpqjsbifxwaekcdxyowmbplqfsbjk
36  2/Mar/05 15:06  /cgi-bin/chat/chat.cgi?action=chat&id=njtzceoukiaouaznsqxuhdgowqwsqc&pause=
35 15/Mar/05 18:53  /cgi-bin/chat/chat.cgi?action=chat&id=rnzfavhoodvzjswnidiztjzizgtohk
35  8/Mar/05 16:55  /cgi-bin/chat/chat.cgi?action=chat&id=gmqaelmebchpsrasymukdcgftmypis&pause=
35 14/Mar/05 19:24  /cgi-bin/chat/chat.cgi?action=chat&id=ndulaaosaqnleqyopcbstrfpwwnbuh&pause=
34 10/Mar/05 16:40  /cgi-bin/chat/chat.cgi?action=chat&id=mxebuuavlnkjdpgmfnplpgutpdiwkw&pause=
34 14/Mar/05 21:02  /cgi-bin/chat/chat.cgi?action=chat&id=peteywxsvwfwwlbusbzwyfjugphxin&pause=
34  4/Mar/05 19:26  /cgi-bin/chat/chat.cgi?action=chat&id=oedudwqcgzvejtkhwqfczwvvfovoqb&pause=
34  4/Mar/05 17:05  /cgi-bin/chat/chat.cgi?action=chat&id=tuyrsjxquewaddzjmsaxvybopjygzo&pause=
34 17/Mar/05 08:57  /cgi-bin/chat/chat.cgi?action=chat&id=lzowjnnragicohonqcdgshfecqjvso&pause=
34 15/Mar/05 17:01  /cgi-bin/chat/chat.cgi?action=chat&id=vcqxqqqbttkpntuomxipvrwmfwbbhi&pause=
34 12/Mar/05 15:32  /cgi-bin/chat/chat.cgi?action=chat&id=gyfvjzisvgerbzbiuvobirwmtljqlx&pause=
34 12/Mar/05 14:08  /cgi-bin/chat/chat.cgi?action=chat&id=xnlvholjackmzghzpmznhxbhtbbwck
33 11/Mar/05 11:23  /cgi-bin/chat/chat.cgi?action=chat&id=hxdeddqfkfohtqeqepmkdkkspabiqw
33  9/Mar/05 16:44  /cgi-bin/chat/chat.cgi?action=chat&id=wcbryjfnrivjxewajhqfjpxbrhsaby
33 23/Mar/05 20:48  /cgi-bin/chat/chat.cgi?action=chat&id=zktyyrjqreeikewsbtxwyhxtmvdiud&pause=
33 23/Mar/05 15:44  /cgi-bin/chat/chat.cgi?action=chat&id=ulfadicexvlgcdvbgvmwzaydamfuyw&pause=
33 11/Mar/05 17:09  /cgi-bin/chat/chat.cgi?action=chat&id=jzeammjbgglnazcwmjlxlbhlbnwdrf&pause=
33 25/Mar/05 19:39  /cgi-bin/chat/chat.cgi?action=chat&id=pkrvzbjepqgegqltneptwltfeewjor&pause=
32 11/Mar/05 17:02  /cgi-bin/chat/chat.cgi?action=chat&id=pxfgwbccuvnxrfcbcggqpyijgxxbuu&pause=
32 17/Mar/05 20:50  /cgi-bin/chat/chat.cgi?action=chat&id=naqosvwfoyzzuadkprnteezttgfoco&pause=
32 26/Mar/05 19:16  /cgi-bin/chat/chat.cgi?action=chat&id=xltbmlypbgwlctvgfperrrpjyvjmcn&pause=
32  6/Mar/05 18:36  /cgi-bin/chat/chat.cgi?action=chat&id=txzdprpdqxvotfdtwvxterfyzoveyj
32 12/Mar/05 12:16  /cgi-bin/chat/chat.cgi?action=chat&id=wimeilzilvfjexucjpvxvsjqpkcnke
31 11/Mar/05 18:48  /cgi-bin/chat/chat.cgi?action=chat&id=poboxpeuykutkgkdgeeoyxhuujafaw
31  5/Mar/05 08:44  /cgi-bin/chat/chat.cgi?action=chat&id=jarcynuxzhsmoodvzlflwcnwxjdrmv&pause=
31 15/Mar/05 07:49  /cgi-bin/chat/chat.cgi?action=chat&id=kduoqzkeghyvvgoggwqoboieptlatp&pause=
31 13/Mar/05 11:42  /cgi-bin/chat/chat.cgi?action=chat&id=mkxngzfsxfbggdavgfjxrnkqrmsljq&pause=
31  8/Mar/05 15:06  /cgi-bin/chat/chat.cgi?action=chat&id=gmjsulqvunwbttfecbudacmaajjvab&pause=
30  9/Mar/05 18:00  /cgi-bin/chat/chat.cgi?action=chat&id=pirxzvmfdaqjwhmtmsvkikzafuqbnp&pause=
30  8/Mar/05 17:55  /cgi-bin/chat/chat.cgi?action=chat&id=paanubzjggadsskoztomlsmjnbdenq&pause=
30 22/Mar/05 19:30  /cgi-bin/chat/chat.cgi?action=chat&id=fmlmwukvsetnazwgjfijiqeadwpjov
30 21/Mar/05 18:49  /cgi-bin/chat/chat.cgi?action=chat&id=jffmyrtvufztqzvnktlmgsqltzxzml&pause=
30 11/Mar/05 18:56  /cgi-bin/chat/chat.cgi?action=chat&id=vurntfbbuhprtqvyoehdiuvdyrzuft&pause=
30 18/Mar/05 18:21  /cgi-bin/chat/chat.cgi?action=chat&id=svanytgnszbcjhznopycndneksafoj&pause=
29 12/Mar/05 17:06  /cgi-bin/chat/chat.cgi?action=chat&id=mzgxigpixvijcvvllkgmejpgjkxoed&pause=
29  5/Mar/05 08:37  /cgi-bin/chat/chat.cgi?action=chat&id=tcqpzonjwgqrepnmzjhrbpypyfvivx&pause=
29 16/Mar/05 21:07  /cgi-bin/chat/chat.cgi?action=chat&id=qkvbefdjhmvjqvvgknifaglpdiboif
29  6/Mar/05 10:53  /cgi-bin/chat/chat.cgi?action=chat&id=orwpvilmmrmcqczuucotfzfrdzipnd
29  8/Mar/05 22:30  /cgi-bin/chat/chat.cgi?action=chat&id=opxrioszruwvnoymqmysthomnefzlf&pause=
29  4/Mar/05 14:47  /cgi-bin/chat/chat.cgi?action=chat&id=fgkesgwyabguuuhsshhtouuzmnqpfw
29  1/Mar/05 13:39  /cgi-bin/chat/chat.cgi?action=chat&id=yntsvrpuzctbitirbngtwegtrjnglz
28  5/Mar/05 14:07  /cgi-bin/chat/chat.cgi?action=chat&id=gyebeazjvfoplrxsbcrnhztnaqthdq&pause=
28  5/Mar/05 15:40  /cgi-bin/chat/chat.cgi?action=chat&id=egsvydtgwzjfzedbbsbffwpqdpyjfi
28 27/Mar/05 15:56  /cgi-bin/chat/chat.cgi?action=chat&id=oiasrbijdpygbvkywhdzxownoqqfjq
28 15/Mar/05 16:47  /cgi-bin/chat/chat.cgi?action=chat&id=ftuygqvgqolvlizmztmyqomdslaeuv&pause=
27  9/Mar/05 17:45  /cgi-bin/chat/chat.cgi?action=chat&id=idkfjexwcymwgfolbxuxaxsazsudve
27  2/Mar/05 11:04  /cgi-bin/chat/chat.cgi?action=chat&id=blzfoxsgukjykxmglowmeixjsixzev
27 15/Mar/05 19:36  /cgi-bin/chat/chat.cgi?action=chat&id=suvdfgeffsczvsbxcbtholgtukigpr&pause=
27  4/Mar/05 17:19  /cgi-bin/chat/chat.cgi?action=chat&id=tuyrsjxquewaddzjmsaxvybopjygzo
27  3/Mar/05 16:46  /cgi-bin/chat/chat.cgi?action=chat&id=letarnycwgljykjmhqvogtmhmpafek
26 13/Mar/05 20:33  /cgi-bin/chat/chat.cgi?action=chat&id=jqphvazgwwvyfjjolclrkddkikelqa&pause=
26  2/Mar/05 10:26  /cgi-bin/chat/chat.cgi?action=chat&id=anglxvjfihscgwzkavghgbophhyapb&pause=
26  5/Mar/05 15:52  /cgi-bin/chat/chat.cgi?action=chat&id=faymmghtlgtsakanjznhtpnmvxqhik
26  9/Mar/05 14:21  /cgi-bin/chat/chat.cgi?action=chat&id=usgkenljqglufocqyhmwtgbckjcwcv&pause=
26 20/Mar/05 14:38  /cgi-bin/chat/chat.cgi?action=chat&id=mxjkucxxayeyghwspkwfzsqvwgocli&pause=
26 11/Mar/05 12:46  /cgi-bin/chat/chat.cgi?action=chat&id=duafiwerzqoiubrtxzraqyesuitbzh&pause=
26  9/Mar/05 14:38  /cgi-bin/chat/chat.cgi?action=chat&id=skvjmzbvkvdfwnuwgzgnziylasjkqd&pause=
26  4/Mar/05 05:43  /cgi-bin/chat/chat.cgi?action=chat&id=ykdravupolqovfnrpqrcixwifppxgl&pause=
26 19/Mar/05 23:02  /cgi-bin/chat/chat.cgi?action=chat&id=kpgfsuhzvebrujbxkwfembgqxbgkez&pause=
26 22/Mar/05 17:56  /cgi-bin/chat/chat.cgi?action=chat&id=xktbwcfmgyeurfjlfbxznyxznnahuz&pause=
26  2/Mar/05 10:26  /cgi-bin/chat/chat.cgi?action=chat&id=rymyrrgrluwbyrwdpzkxzdgylpizzf&pause=
26  9/Mar/05 21:08  /cgi-bin/chat/chat.cgi?action=chat&id=bivrennoyronmfxmkdmrtykdkmihqt&pause=
26  5/Mar/05 14:46  /cgi-bin/chat/chat.cgi?action=chat&id=gnfhdqpxswrfgxncjzppcnrijlzluo&pause=
26 10/Mar/05 19:21  /cgi-bin/chat/chat.cgi?action=chat&id=mvjzvpbzxwhiqzzlvwvcqwgnnzoufa&pause=
25  9/Mar/05 20:33  /cgi-bin/chat/chat.cgi?action=chat&id=brlcscaavalrurbwrqcynyqtpmveuo&pause=
25  5/Mar/05 14:07  /cgi-bin/chat/chat.cgi?action=chat&id=bdawjsryugdvkpvyeeezywzilnzyxi&pause=
25  5/Mar/05 13:23  /cgi-bin/chat/chat.cgi?action=chat&id=ntkdausbyhrfjfwbbtaymnnwjdmchm
25 26/Mar/05 15:46  /cgi-bin/chat/chat.cgi?action=chat&id=atnpiiobniwzkhsmhxvlamnizuyzpw&pause=
25 14/Mar/05 15:42  /cgi-bin/chat/chat.cgi?action=chat&id=dsvayejrtxmjcyohlpmvtkzpvuwjdh&pause=
25 21/Mar/05 17:43  /cgi-bin/chat/chat.cgi?action=chat&id=nwqfpydcmcvdtptdgirrmjldeukcuh&pause=
24 20/Mar/05 15:14  /cgi-bin/chat/chat.cgi?action=chat&id=fwesyrjvafsstcmmddvvfcnrowjhxd&pause=
24 10/Mar/05 12:52  /cgi-bin/chat/chat.cgi?action=chat&id=whbrvvyguqbkgkmmodbcjltljyerxf
24 19/Mar/05 18:23  /cgi-bin/chat/chat.cgi?action=chat&id=cwfkvlkeqvhgsecpklxdvkvmrqethc
24 15/Mar/05 21:21  /cgi-bin/chat/chat.cgi?action=chat&id=erazozrrqzdhhirneqbxdqybfazjus&pause=
24 17/Mar/05 11:49  /cgi-bin/chat/chat.cgi?action=chat&id=hhlokpwryirgbnllpbrwndmuhcfawo
24 14/Mar/05 20:08  /cgi-bin/chat/chat.cgi?action=chat&id=jfnfforfcwaqyjzltdspterhphugei&pause=
24 13/Mar/05 13:50  /cgi-bin/chat/chat.cgi?action=chat&id=bwitqdftvbypelddtopvirbcgzxtrl&pause=
23 17/Mar/05 17:56  /cgi-bin/chat/chat.cgi?action=chat&id=sprmdhvirqbdigmptyifqkdfzmhhud
23 27/Mar/05 19:58  /cgi-bin/chat/chat.cgi?action=chat&id=gwmcycloouzlyeatgdpkcpncryzpcs&pause=
23  9/Mar/05 06:34  /cgi-bin/chat/chat.cgi?action=chat&id=oymyhkabhrkruasefxluflwspqpars
23 26/Mar/05 17:59  /cgi-bin/chat/chat.cgi?action=chat&id=ofjoeokthozgrcovlmjalobmjkwtuo&pause=
23  9/Mar/05 17:15  /cgi-bin/chat/chat.cgi?action=chat&id=vocszanudsavelncmxqaeovvxrcsco&pause=
23 22/Mar/05 19:52  /cgi-bin/chat/chat.cgi?action=chat&id=hnugjskooofurovavzwuprjmbvbfzs
23  3/Mar/05 20:13  /cgi-bin/chat/chat.cgi?action=chat&id=xawdkcfxsxtzltbemwltpzfttbgjjc
23  2/Mar/05 18:16  /cgi-bin/chat/chat.cgi?action=chat&id=jouobmpcforqhzzgcjzxrdwatudxde&pause=
23  6/Mar/05 13:23  /cgi-bin/chat/chat.cgi?action=chat&id=rshckujjdofpnfhdoaeybuupwfkmug
23 11/Mar/05 17:53  /cgi-bin/chat/chat.cgi?action=chat&id=fdqyormkkijrzwluihiiqdwdkdwils&pause=
23 12/Mar/05 21:43  /cgi-bin/chat/chat.cgi?action=chat&id=wnedcovhsgarqexuxpdtevhhyzobfc&pause=
23 16/Mar/05 01:17  /cgi-bin/chat/chat.cgi?action=chat&id=xldooncaxwcoxbqtsonezushskjdvg&pause=
23 25/Mar/05 15:32  /cgi-bin/chat/chat.cgi?action=chat&id=hiovmehxhwrjnkhdqrpqfysoshxxje&pause=
22  9/Mar/05 22:01  /cgi-bin/chat/chat.cgi?action=chat&id=aydfapvfjphruxdmuckegdjakurfyz&pause=
22 17/Mar/05 12:56  /cgi-bin/chat/chat.cgi?action=chat&id=hoptxkagcevsrqlykzmcatffjyvtii&pause=
22 20/Mar/05 12:37  /cgi-bin/chat/chat.cgi?action=chat&id=fopcgfdjiiapfiqyatlhmbhmrbvmvh&pause=
22  2/Mar/05 14:20  /cgi-bin/chat/chat.cgi?action=chat&id=rrjrbekajqsbhqfkykpmgwrgasdree
22 20/Mar/05 19:10  /cgi-bin/chat/chat.cgi?action=chat&id=eqdjfdzkhsewxokhazreigrcibfowl&pause=
22 11/Mar/05 15:20  /cgi-bin/chat/chat.cgi?action=chat&id=glifbndnlazltxbcpcuqqdfukoukjn
22 16/Mar/05 11:05  /cgi-bin/chat/chat.cgi?action=chat&id=isdskxzxzlvfcwbozgzootwelcgoun
21 18/Mar/05 08:04  /cgi-bin/chat/chat.cgi?action=chat&id=mymdqaloylbockcsblpdfmlnxgsahz
21 27/Mar/05 20:14  /cgi-bin/chat/chat.cgi?action=chat&id=dkvlgfacupkbczujlaclcozqmsjand&pause=
21 22/Mar/05 17:25  /cgi-bin/chat/chat.cgi?action=chat&id=vbfzchhhjsytgsbwogdzggleovwyfs&pause=
21  7/Mar/05 20:04  /cgi-bin/chat/chat.cgi?action=chat&id=isfcelbkhmartuonfgbxitudhjrvls
21  5/Mar/05 18:40  /cgi-bin/chat/chat.cgi?action=chat&id=dhxaoqesncyhwaposntxvlimrdgnum&pause=
21 11/Mar/05 14:21  /cgi-bin/chat/chat.cgi?action=chat&id=ulkqmdvzdybhjbfnrfpbcoslxnuhah&pause=
21 20/Mar/05 09:37  /cgi-bin/chat/chat.cgi?action=chat&id=dlmyksppxhaerxepcurtiuoiytxnpt&pause=
21  6/Mar/05 19:02  /cgi-bin/chat/chat.cgi?action=chat&id=jkitnpevnltdbbxrgrohruyopwndfo&pause=
21 12/Mar/05 11:35  /cgi-bin/chat/chat.cgi?action=chat&id=klhmatmnazstpnkhpxnxkputqrxnoe&pause=
21 12/Mar/05 08:44  /cgi-bin/chat/chat.cgi?action=chat&id=bvkwwzyqqzakfxwxuhwvlrydmmqzky&pause=
21 26/Mar/05 16:11  /cgi-bin/chat/chat.cgi?action=chat&id=egotdelevzijyobsyufehlhefkeiow
21  9/Mar/05 10:59  /cgi-bin/chat/chat.cgi?action=chat&id=vogcruttrxhybypkxdgdiytzqmpbag&pause=
21  4/Mar/05 17:33  /cgi-bin/chat/chat.cgi?action=chat&id=tfpargscxjlqwfdjqgfpslpztozzlu&pause=
21 15/Mar/05 19:50  /cgi-bin/chat/chat.cgi?action=chat&id=fobegtrvjuvshsqcygtoerxcygfytg
21 22/Mar/05 21:35  /cgi-bin/chat/chat.cgi?action=chat&id=zxhjagpxdjnufiomprwmcghinseswt&pause=
21  8/Mar/05 17:29  /cgi-bin/chat/chat.cgi?action=chat&id=qnpinrxykmkgliqmqctfuyziuvjzhq&pause=
20 27/Mar/05 11:33  /cgi-bin/chat/chat.cgi?action=chat&id=wtnpciqwlsbilmxjtjtmjddqxoubtb&pause=
20 13/Mar/05 13:46  /cgi-bin/chat/chat.cgi?action=chat&id=lkufuxebrevufgjqdphszqillxjyqw&pause=
20 18/Mar/05 20:36  /cgi-bin/chat/chat.cgi?action=chat&id=hmpldebxfaqzrtlhgnytluqsvifzbs&pause=
20  3/Mar/05 15:39  /cgi-bin/chat/chat.cgi?action=chat&id=bdlywktqlelhkuvostcghzkbfmcqoz&pause=
20 18/Mar/05 10:02  /cgi-bin/chat/chat.cgi?action=chat&id=bryxegnxazcywihfulaekxityugpfn
20 18/Mar/05 10:36  /cgi-bin/chat/chat.cgi?action=chat&id=dgadzdoftcmuefoozkqkjfgwmezxxs&pause=
20  1/Mar/05 13:27  /cgi-bin/chat/chat.cgi?action=chat&id=jomwaudvkixsxwxylddjyeyqyjdvar
20 10/Mar/05 16:17  /cgi-bin/chat/chat.cgi?action=chat&id=lzutvlmdrptigqaszjbkfpgxgxkurv&pause=
20 27/Mar/05 20:06  /cgi-bin/chat/chat.cgi?action=chat&id=qssldinnibalzzdleezbbrglgxotpq&pause=
19 17/Mar/05 19:44  /cgi-bin/chat/chat.cgi?action=chat&id=bzguwcgyocuthofxrogiqxjhapeofl&pause=
19  3/Mar/05 08:22  /cgi-bin/chat/chat.cgi?action=chat&id=nngtewqcwkvaqitqoiklhplgfbglrj&pause=
19 22/Mar/05 16:21  /cgi-bin/chat/chat.cgi?action=chat&id=cravyjsktgjdjtekiduhytbcwhjohf&pause=
19 18/Mar/05 15:16  /cgi-bin/chat/chat.cgi?action=chat&id=rfxyywzascgshhkqwckcotclfecbfj&pause=
19 10/Mar/05 13:32  /cgi-bin/chat/chat.cgi?action=chat&id=pryvjmfonqkbegzuwwnmgqcfrssytc
19 10/Mar/05 03:51  /cgi-bin/chat/chat.cgi?action=chat&id=otvanzhgzznjhnptaupztoykjckmch
19  1/Mar/05 21:33  /cgi-bin/chat/chat.cgi?action=chat&id=hyagqakprwummkgqqjcwjgcdbrslap&pause=
19  3/Mar/05 19:24  /cgi-bin/chat/chat.cgi?action=chat&id=usnppyaxqgyasuwkjvkjadczsnjeuy&pause=
19 10/Mar/05 16:14  /cgi-bin/chat/chat.cgi?action=chat&id=gzakfawfjsizhopeimhkovffmygiej&pause=
19 12/Mar/05 10:35  /cgi-bin/chat/chat.cgi?action=chat&id=tmrzwciofrtxcsknkyhzaqvkhruhem&pause=
19 26/Mar/05 16:00  /cgi-bin/chat/chat.cgi?action=chat&id=jwtjcvuzpvbxkvyoezhdsrgkqjqzbv
18 13/Mar/05 10:49  /cgi-bin/chat/chat.cgi?action=chat&id=vxvqqcrcduugrsnbajamtvqgzjeycc&pause=
18 17/Mar/05 18:23  /cgi-bin/chat/chat.cgi?action=chat&id=avwppmkfcmshoclvbvaclxdtidegbk&pause=
18  3/Mar/05 19:36  /cgi-bin/chat/chat.cgi?action=chat&id=gjufvcivihpncrhqsfkoobqtxjpkcx
18  3/Mar/05 16:12  /cgi-bin/chat/chat.cgi?action=chat&id=vljoqvjdcrzhljatbcahajyyfvqqmk&pause=
18  2/Mar/05 12:33  /cgi-bin/chat/chat.cgi?action=chat&id=ufmromrpyjyireorcjpeuhcbejukhn
18 16/Mar/05 11:08  /cgi-bin/chat/chat.cgi?action=chat&id=isdskxzxzlvfcwbozgzootwelcgoun&pause=
18 19/Mar/05 12:30  /cgi-bin/chat/chat.cgi?action=chat&id=qyugpojlzyqgfjlmlpwcnwihxvnhfc&pause=
18  4/Mar/05 19:56  /cgi-bin/chat/chat.cgi?action=chat&id=dfvetygiqanzfgqgxcoiidoagajetf&pause=
18  6/Mar/05 19:28  /cgi-bin/chat/chat.cgi?action=chat&id=pnoyeewjavlxoqeqdgobcesdifbcnk
18 13/Mar/05 16:17  /cgi-bin/chat/chat.cgi?action=chat&id=ujbqbjzbhooepifkefnvcdhfkixfzr
18 21/Mar/05 10:17  /cgi-bin/chat/chat.cgi?action=chat&id=jafnlufmboqklxmwnrxmhgvazpphat&pause=
18 20/Mar/05 09:03  /cgi-bin/chat/chat.cgi?action=chat&id=dghnubfadeqzfmcdebtlidpxaxqusr
17 10/Mar/05 20:26  /cgi-bin/chat/chat.cgi?action=chat&id=fqpoftgvgxaecyktjtjnbwuwtzcnky&pause=
17  2/Mar/05 15:02  /cgi-bin/chat/chat.cgi?action=chat&id=rtebmrxgxrnzgvlboalhueevbumlun&pause=
17  4/Mar/05 18:29  /cgi-bin/chat/chat.cgi?action=chat&id=axyenzurltzipkojfmvysjxwihspel&pause=
17 11/Mar/05 14:01  /cgi-bin/chat/chat.cgi?action=chat&id=rjmizoludvubciyetbzyckaldtslud&pause=
17  1/Mar/05 15:18  /cgi-bin/chat/chat.cgi?action=chat&id=yfhxwsijmkbnhkkuinkzaagavpigqn
17 17/Mar/05 17:19  /cgi-bin/chat/chat.cgi?action=chat&id=bljfanecxihhsmwfuymxmsqfjvxbjg&pause=
17 11/Mar/05 17:05  /cgi-bin/chat/chat.cgi?action=chat&id=szcpvlsxhkaqgqmudkrrkiwisvzlda&pause=
17  7/Mar/05 20:00  /cgi-bin/chat/chat.cgi?action=chat&id=isfcelbkhmartuonfgbxitudhjrvls&pause=
17  8/Mar/05 17:36  /cgi-bin/chat/chat.cgi?action=chat&id=btajrprefoowqzaixgvizuanpozeoi&pause=
17 10/Mar/05 18:46  /cgi-bin/chat/chat.cgi?action=chat&id=erokrcjlgzunpraldrimrxzneoernu&pause=
17 15/Mar/05 15:27  /cgi-bin/chat/chat.cgi?action=chat&id=sokykhqclgjpuyzpuxfrqkpygmflmw&pause=
17  5/Mar/05 09:48  /cgi-bin/chat/chat.cgi?action=chat&id=jinxpvrionryfonuafrkcygiyaavpm
17 12/Mar/05 17:43  /cgi-bin/chat/chat.cgi?action=chat&id=dnwqexgvvwwimvzsrhztvihhtjjdwm&pause=
17 12/Mar/05 15:48  /cgi-bin/chat/chat.cgi?action=chat&id=srjpgackwaogneglygmvxnjozixatm&pause=
16  6/Mar/05 16:39  /cgi-bin/chat/chat.cgi?action=chat&id=wsgcoadxkkupsvyhnffjdzjouuftbp&pause=
16 18/Mar/05 09:00  /cgi-bin/chat/chat.cgi?action=chat&id=lyhfjtuysnbtwabreiztvvscmdvuxy&pause=
16  3/Mar/05 17:09  /cgi-bin/chat/chat.cgi?action=chat&id=ozuugvqkndlvoxhnhguvkupnisqlph&pause=
16 17/Mar/05 23:26  /cgi-bin/chat/chat.cgi?action=chat&id=jkuuwkvvxrpxjfnjjdgqkgwqdxsjrd&pause=
16 16/Mar/05 20:42  /cgi-bin/chat/chat.cgi?action=chat&id=nwzvaelehqeufdsyhckupdmezdjsoh
16 16/Mar/05 18:46  /cgi-bin/chat/chat.cgi?action=chat&id=yqihhsvshbmrsymeigczpbbnittxsr&pause=
16  4/Mar/05 17:38  /cgi-bin/chat/chat.cgi?action=chat&id=pouomhgblnmzfxgzdtwslioyqqbsvd&pause=
15 25/Mar/05 11:52  /cgi-bin/chat/chat.cgi?action=chat&id=iharlbowzncqiaunoqcqgjejjbgzit&pause=
15 11/Mar/05 23:31  /cgi-bin/chat/chat.cgi?action=chat&id=fhsfcxhtrvuptqdnolcpfylolwkcji
15 22/Mar/05 17:21  /cgi-bin/chat/chat.cgi?action=chat&id=dgzdlbodhkytqaxuheztuzpzhlvpbi&pause=
15 26/Mar/05 15:50  /cgi-bin/chat/chat.cgi?action=chat&id=jwtjcvuzpvbxkvyoezhdsrgkqjqzbv&pause=
15  6/Mar/05 13:27  /cgi-bin/chat/chat.cgi?action=chat&id=nqyhaerlvedszforhhuyjuaimmpubu&pause=
15 20/Mar/05 15:49  /cgi-bin/chat/chat.cgi?action=chat&id=xamgxvacftmlbxvafirdnfpldgvvhd&pause=
15 15/Mar/05 11:27  /cgi-bin/chat/chat.cgi?action=chat&id=yachmdiklycelyttjlptjicuhxoyjf&pause=
15 17/Mar/05 16:10  /cgi-bin/chat/chat.cgi?action=chat&id=iozcppjdxyanmlkieflqtzwrjufvst&pause=
15  5/Mar/05 20:12  /cgi-bin/chat/chat.cgi?action=chat&id=edpkpjpnhdgdhnkeeotvlresadpudh&pause=
14 20/Mar/05 12:41  /cgi-bin/chat/chat.cgi?action=chat&id=fopcgfdjiiapfiqyatlhmbhmrbvmvh
14  2/Mar/05 12:29  /cgi-bin/chat/chat.cgi?action=chat&id=pogxvntzpdbopwtjqvsjvbttjilbay&pause=
14 11/Mar/05 10:40  /cgi-bin/chat/chat.cgi?action=chat&id=xzfyluipyvudwzshkqfuphgdjemync&pause=
14  2/Mar/05 19:28  /cgi-bin/chat/chat.cgi?action=chat&id=curhhynrdfhyxrtesgqldxupagcapy&pause=
14  9/Mar/05 22:06  /cgi-bin/chat/chat.cgi?action=chat&id=lnsvznvrcewhfsuhljcnyiiufunapz&pause=
14  5/Mar/05 21:34  /cgi-bin/chat/chat.cgi?action=chat&id=kxbeivyoafdfovbytpgmkujqvkdhdq&pause=
14 25/Mar/05 20:54  /cgi-bin/chat/chat.cgi?action=chat&id=dtrstoojljcqvdluhegwpvlkilnlfg
14 20/Mar/05 19:27  /cgi-bin/chat/chat.cgi?action=chat&id=xdfglbrljzrkyvvqnjqzidrdpllznh&pause=
14 27/Mar/05 08:12  /cgi-bin/chat/chat.cgi?action=chat&id=kyxdfqmjdikmaxpxmcoepmlnfzcrgd
14 22/Mar/05 20:44  /cgi-bin/chat/chat.cgi?action=chat&id=ckzxckmlhytbanmlcquwlpgixwjcax&pause=
14 17/Mar/05 20:59  /cgi-bin/chat/chat.cgi?action=chat&id=ffojdxclaxzxiwzybzwndckqcgduos&pause=
14 21/Mar/05 17:38  /cgi-bin/chat/chat.cgi?action=chat&id=sexntaegxhzohthtcfyolwiwfsbrze&pause=
14  1/Mar/05 14:34  /cgi-bin/chat/chat.cgi?action=chat&id=fcgcehxydlhyftscflslaulruygdqj&pause=
14 12/Mar/05 20:23  /cgi-bin/chat/chat.cgi?action=chat&id=naxbqepyrblroxswxqhrxfqyaicxps&pause=
13 17/Mar/05 16:12  /cgi-bin/chat/chat.cgi?action=chat&id=iozcppjdxyanmlkieflqtzwrjufvst
13 21/Mar/05 16:32  /cgi-bin/chat/chat.cgi?action=chat&id=dcdchlgygrgoqrnwwxvbcdqtxbdazp&pause=
13 17/Mar/05 17:13  /cgi-bin/chat/chat.cgi?action=chat&id=pgsiqpfijxqykblxozpntjxeykpqmq
13 27/Mar/05 17:16  /cgi-bin/chat/chat.cgi?action=chat&id=zbunwittarvvyszjviqvvqazdwensq
13 21/Mar/05 16:48  /cgi-bin/chat/chat.cgi?action=chat&id=jyndcxliofgznxggjlvhoufqexyzef&pause=
13  6/Mar/05 17:35  /cgi-bin/chat/chat.cgi?action=chat&id=xkxnudfagvvrekqthnlesxfhqbylnr&pause=
13 18/Mar/05 15:57  /cgi-bin/chat/chat.cgi?action=chat&id=vxkaerdvjwzxwhflqisivdimxmbgbm&pause=
13  9/Mar/05 19:11  /cgi-bin/chat/chat.cgi?action=chat&id=ztdxabztwykhhynyincfgxcmiofngs&pause=
13 17/Mar/05 08:11  /cgi-bin/chat/chat.cgi?action=chat&id=cwpgkzrhxvtjlbgqtedhwskxzykdyd
13 22/Mar/05 16:56  /cgi-bin/chat/chat.cgi?action=chat&id=gwqklqoigpasoayxbcqfexrqflvidy&pause=
13 10/Mar/05 18:40  /cgi-bin/chat/chat.cgi?action=chat&id=buuyorfsmjbhtruhcnsysxetqqhhww&pause=
13  7/Mar/05 09:59  /cgi-bin/chat/chat.cgi?action=chat&id=nmvjevpffpzlkjpmfthglffxadlikn
13 17/Mar/05 15:37  /cgi-bin/chat/chat.cgi?action=chat&id=jeubxkogumnpzhmmfotonyaoxjtjkm&pause=
13 16/Mar/05 16:01  /cgi-bin/chat/chat.cgi?action=chat&id=skzbjmcgmkjmjgneetuqnuikymtxkp&pause=
13  8/Mar/05 15:52  /cgi-bin/chat/chat.cgi?action=chat&id=uaabclyoyifjasypmggfwoybtzicti&pause=
12 27/Mar/05 07:08  /cgi-bin/chat/chat.cgi?action=chat&id=jpgfypvuopggwlysupzgcwlucwvuxs&pause=
12  3/Mar/05 15:45  /cgi-bin/chat/chat.cgi?action=chat&id=veqjlfysdlfpuesmpwvgmcweamzyqc
12 18/Mar/05 12:25  /cgi-bin/chat/chat.cgi?action=chat&id=qzkcvluiepywrpiyqqfwxrgbsxpjhz&pause=
12  1/Mar/05 06:42  /cgi-bin/chat/chat.cgi?action=chat&id=udntozamnejtgvkxrxvksuhcsqlfdh
12  2/Mar/05 17:04  /cgi-bin/chat/chat.cgi?action=chat&id=sodmkvknpaxwdychoadfdkwyvtavtu&pause=
12 17/Mar/05 15:30  /cgi-bin/chat/chat.cgi?action=chat&id=wafmavdltjkbgnlnmkwepcrvsqjmjg&pause=
12  8/Mar/05 19:25  /cgi-bin/chat/chat.cgi?action=chat&id=vhktqxescjtnwwrrnzlqnqpnbvpxts&pause=
12 25/Mar/05 13:20  /cgi-bin/chat/chat.cgi?action=chat&id=dbcezogeftxvobvfrdoaxyvwavojwq&pause=
12  7/Mar/05 09:57  /cgi-bin/chat/chat.cgi?action=chat&id=nmvjevpffpzlkjpmfthglffxadlikn&pause=
12 10/Mar/05 20:40  /cgi-bin/chat/chat.cgi?action=chat&id=ndxzcoefqihkoiiwtjmjhbdjgmmksn&pause=
12  2/Mar/05 19:53  /cgi-bin/chat/chat.cgi?action=chat&id=hkneyalreebhkqrsayujkrhhhopojt&pause=
12 25/Mar/05 13:17  /cgi-bin/chat/chat.cgi?action=chat&id=dbcezogeftxvobvfrdoaxyvwavojwq
12  9/Mar/05 10:33  /cgi-bin/chat/chat.cgi?action=chat&id=crtnemdsstxzvbaunsgjiaodgmejnl&pause=
12  4/Mar/05 15:13  /cgi-bin/chat/chat.cgi?action=chat&id=lprmzfgzjgrxbjtalxmgukskyfbzxv&pause=
12 17/Mar/05 17:09  /cgi-bin/chat/chat.cgi?action=chat&id=kqgzoheabevaffaxifzbcyfyehmfkv&pause=
12  9/Mar/05 21:25  /cgi-bin/chat/chat.cgi?action=chat&id=issucdekrsthgczazjqlectzefbtse&pause=
12 25/Mar/05 11:45  /cgi-bin/chat/chat.cgi?action=chat&id=xddseqpvqskndptltfwxnfmpxvugvi&pause=
12 22/Mar/05 16:37  /cgi-bin/chat/chat.cgi?action=chat&id=sxahbvwprzgvlhwqfpztfnhcsnziqz&pause=
12 27/Mar/05 17:41  /cgi-bin/chat/chat.cgi?action=chat&id=gnqqalmzdfjlizvabavyddhrodtjnv&pause=
12 21/Mar/05 10:42  /cgi-bin/chat/chat.cgi?action=chat&id=bojpddgjrcvsxabkvqkpwhljfpodyq&pause=
12 15/Mar/05 14:52  /cgi-bin/chat/chat.cgi?action=chat&id=lotrwkgraskycyobedrjrbbregeicc&pause=
12 16/Mar/05 10:31  /cgi-bin/chat/chat.cgi?action=chat&id=yqohgadejmvzgonfwjfckzxvbtukqm&pause=
12 12/Mar/05 15:07  /cgi-bin/chat/chat.cgi?action=chat&id=frgqlcuvoujhocjgkulvbkcivcqmhu&pause=
12 25/Mar/05 12:46  /cgi-bin/chat/chat.cgi?action=chat&id=cgyykrdnqukvyhasvpwasuqnfwqmzx&pause=
11 14/Mar/05 15:52  /cgi-bin/chat/chat.cgi?action=chat&id=pyucxsjiwdrtxyptdjladsbdrzmtyj
11  5/Mar/05 20:44  /cgi-bin/chat/chat.cgi?action=chat&id=tpjggmxsqipynegrazjufdsvxuqesg&pause=
11 19/Mar/05 13:39  /cgi-bin/chat/chat.cgi?action=chat&id=nsydxowexivpbtnuxgvrwmobgnpjrf&pause=
11 27/Mar/05 11:50  /cgi-bin/chat/chat.cgi?action=chat&id=usnfejzxccdmggolhstyxiczlzlelt
11 10/Mar/05 11:39  /cgi-bin/chat/chat.cgi?action=chat&id=ypipsyjfzlarigvmqxowezyemmhptf&pause=
11  5/Mar/05 10:49  /cgi-bin/chat/chat.cgi?action=chat&id=jzklsoekbwruvrvbwlyjwvbxwycutl&pause=
11 25/Mar/05 11:18  /cgi-bin/chat/chat.cgi?action=chat&id=ophfoeenrsvvcdtuocapfgywlkifoj&pause=
11  4/Mar/05 13:46  /cgi-bin/chat/chat.cgi?action=chat&id=jmamxtbvkylcvelnforzvnhnmjhepq
11  9/Mar/05 18:21  /cgi-bin/chat/chat.cgi?action=chat&id=gkawxebmczagezqieulcjotbwvklvi&pause=
11  3/Mar/05 10:01  /cgi-bin/chat/chat.cgi?action=chat&id=hksjzswjpakdzqtmsyzbrkymieymyo&pause=
11 15/Mar/05 17:12  /cgi-bin/chat/chat.cgi?action=chat&id=ltistkerkjgrinvnycnjtqdmagaudq&pause=
11  9/Mar/05 21:02  /cgi-bin/chat/chat.cgi?action=chat&id=gistpklrlqplaqmqcwsldwastiwedd&pause=
11 18/Mar/05 18:03  /cgi-bin/chat/chat.cgi?action=chat&id=vjxcpnhwwwcxkkcoqvehqlhjjfdthg&pause=
11 19/Mar/05 18:32  /cgi-bin/chat/chat.cgi?action=chat&id=gjbtfcnibjfpojvnghekopqjftflpg
11 20/Mar/05 19:13  /cgi-bin/chat/chat.cgi?action=chat&id=mupdlpuklcvkjqboxqomcuekppdwjf&pause=
11 25/Mar/05 12:08  /cgi-bin/chat/chat.cgi?action=chat&id=ghqxwjxaacyejtiacelhpjftpabjmw
11 26/Mar/05 16:12  /cgi-bin/chat/chat.cgi?action=chat&id=wfbmnvlgfozhsfwtiawbxavgcgcdle&pause=
10  4/Mar/05 19:45  /cgi-bin/chat/chat.cgi?action=chat&id=vacxerzfxtprvoklqkfvykrnlardin&pause=
10 15/Mar/05 16:23  /cgi-bin/chat/chat.cgi?action=chat&id=duraoivzbgbcnsuqqhcraglucnklfy&pause=
10 14/Mar/05 19:29  /cgi-bin/chat/chat.cgi?action=chat&id=edsqvoafqrywelrweybvyhredahikb&pause=
10 14/Mar/05 20:41  /cgi-bin/chat/chat.cgi?action=chat&id=szjkfcblfldjmpxnxrwsvqnkhnaudo&pause=
10 19/Mar/05 11:20  /cgi-bin/chat/chat.cgi?action=chat&id=hnccglazwuwdcydvairigzxhuofjiy&pause=
10 22/Mar/05 09:44  /cgi-bin/chat/chat.cgi?action=chat&id=xnvcjyvwlkyqzswkzvrcrbacowkhig&pause=
10  9/Mar/05 17:13  /cgi-bin/chat/chat.cgi?action=chat&id=atjzhrbrrbgggnkgldsybljrgltwim&pause=
10 14/Mar/05 00:32  /cgi-bin/chat/chat.cgi?action=chat&id=bkvjihafokbdilyfnwpemhpyefahex&pause=
10 11/Mar/05 13:36  /cgi-bin/chat/chat.cgi?action=chat&id=jgfawlvrmlpzhmztpwkdbvsxnrsvzi&pause=
10 18/Mar/05 08:55  /cgi-bin/chat/chat.cgi?action=chat&id=ougqlqwfghthggbkwidnpuynmzyfcw&pause=
10 26/Mar/05 04:38  /cgi-bin/chat/chat.cgi?action=chat&id=oeiydzrtfcotqrihrlvooxhxkuilnb&pause=
10  4/Mar/05 18:35  /cgi-bin/chat/chat.cgi?action=chat&id=utrulvfonmmclsiskadgajhzgfxurf&pause=
10 15/Mar/05 15:19  /cgi-bin/chat/chat.cgi?action=chat&id=uqmpumvzisavjbeflgmjilhjdtorxb&pause=
10  2/Mar/05 16:43  /cgi-bin/chat/chat.cgi?action=chat&id=aqvxdwcmxjsgjnqxvhmhcseajcdegi&pause=
10  2/Mar/05 19:17  /cgi-bin/chat/chat.cgi?action=chat&id=nbgghdnpnayeimalicmoevsrwwaeal&pause=
10 20/Mar/05 20:41  /cgi-bin/chat/chat.cgi?action=chat&id=ebpfjtaeskakwrfjmkxuawypfwcjbe&pause=
10 27/Mar/05 16:54  /cgi-bin/chat/chat.cgi?action=chat&id=hmljyczdurcqtesabcegaerdkmdmsm&pause=
199171 0.34%29/Mar/05 09:59/graphics/he.gif
164893 0.11%29/Mar/05 09:59/spam_vaccine/spam_vaccine.js
153604 0.03%29/Mar/05 09:59/graphics/email-text.gif
153547 0.02%29/Mar/05 09:59/graphics/print-text.gif
145134 0.19%29/Mar/05 09:59/graphics/helpinglogo1.gif
142766 0.23%29/Mar/05 09:59/graphics/banners/fun-l.gif
142465 0.04%29/Mar/05 09:59/graphics/banners/fun-r.gif
127998 0.01%29/Mar/05 09:59/graphics/triangle.gif
109074 1.84%29/Mar/05 09:59/
87587 0.13%28/Mar/05 12:49/cgi-bin/chat/chatsa.cgi
74553 0.85%29/Mar/05 09:59/graphics/homepage/left.gif
74477 0.02%29/Mar/05 09:59/graphics/notify-me.gif
74375 1.46%29/Mar/05 09:59/graphics/homepage/right.gif
74153 0.02%29/Mar/05 09:59/graphics/homepage/backbar2.gif
74051 0.18%29/Mar/05 09:59/graphics/homepage/homepage-banner-text.gif
68815 0.24%29/Mar/05 09:59/easter/hrs-banner-easter.gif
65519 0.17%29/Mar/05 09:59/graphics/banners/faq-l.gif
65427 0.02%29/Mar/05 09:59/graphics/banners/faq-r.gif
63089 0.19%29/Mar/05 09:59/graphics/banners/care-l.gif
62773 0.02%29/Mar/05 09:59/graphics/banners/care-r.gif
54099 0.17%29/Mar/05 09:58/easter/hrs-square-easter.gif
48895 0.31%29/Mar/05 09:59/easter/hrs-square-easter-75.jpg
38793 0.06%28/Mar/05 12:49/cgi-bin/chat/chatpm.cgi
21 20/Mar/05 19:34  /cgi-bin/chat/chatpm.cgi?action=chatinput_html&id=aidslanbxnucfjurgczulyurjakccq
11 21/Mar/05 19:53  /cgi-bin/chat/chatpm.cgi?action=chatinput_html&id=gdbawcqooqwdvjcllngfadezaomtsk
38552 0.40%29/Mar/05 09:59/fun/
37161 0.05%29/Mar/05 09:59/favicon.ico
36941 0.10%29/Mar/05 09:59/graphics/banners/opinion-l.gif
36849 0.13%29/Mar/05 09:58/graphics/banners/hrs-info-l.gif
36789 0.01%29/Mar/05 09:58/graphics/banners/hrs-info-r.gif
36524 0.01%29/Mar/05 09:59/graphics/banners/opinion-r.gif
30808 5.58%29/Mar/05 09:57/graphics/fun/netbunnies/
114 0.02%29/Mar/05 05:07  /graphics/fun/netbunnies/?M=A
44 0.01%29/Mar/05 06:02  /graphics/fun/netbunnies/?N=D
36 0.01%27/Mar/05 21:54  /graphics/fun/netbunnies/?M=D
34 0.01%28/Mar/05 14:21  /graphics/fun/netbunnies/?S=A
32 0.01%28/Mar/05 17:02  /graphics/fun/netbunnies/?D=A
27 0.01%27/Mar/05 21:54  /graphics/fun/netbunnies/?S=D
22 27/Mar/05 21:54  /graphics/fun/netbunnies/?N=A
12 27/Mar/05 21:55  /graphics/fun/netbunnies/?D=D
30299 0.34%29/Mar/05 09:58/easter/
27178 0.32%29/Mar/05 09:59/faq/
26847 0.46%29/Mar/05 09:58/care/
26024 0.01%29/Mar/05 09:58/chapters/san-diego/buttongo.gif
25945 0.01%29/Mar/05 09:58/chapters/san-diego/subnav/sn_emailoff.gif
25934 29/Mar/05 09:58/chapters/san-diego/subnav/sn_faqoff.gif
25892 0.01%29/Mar/05 09:58/chapters/san-diego/subnav/sn_adoptionon.gif
25700 0.01%29/Mar/05 09:58/chapters/san-diego/subnav/sn_homeoff.gif
25609 0.01%29/Mar/05 09:58/chapters/san-diego/subnav/sn_productsoff.gif
25297 0.01%29/Mar/05 09:58/chapters/san-diego/subnav/sn_aboutusoff.gif
25086 0.07%29/Mar/05 09:53/graphics/banners/behavior-l.gif
25031 0.01%29/Mar/05 09:59/graphics/banners/behavior-r.gif
24820 0.04%29/Mar/05 09:59/styles/styles.css
24768 0.01%29/Mar/05 09:58/chapters/san-diego/subnav/sn_healthon.gif
24562 0.01%29/Mar/05 09:58/chapters/san-diego/subnav/sn_behavioron.gif
24090 0.01%29/Mar/05 09:58/chapters/san-diego/subnav/sn_dieton.gif
24022 0.01%29/Mar/05 09:58/chapters/san-diego/subnav/linedown.gif
23704 0.07%29/Mar/05 09:55/graphics/banners/health-l.gif
23688 0.01%29/Mar/05 09:58/chapters/san-diego/subnav/sn_dietoff.gif
23595 0.01%29/Mar/05 09:55/graphics/banners/health-r.gif
23545 0.01%29/Mar/05 09:58/chapters/san-diego/subnav/sn_aboutuson.gif
23115 0.01%29/Mar/05 09:58/chapters/san-diego/subnav/sn_productson.gif
23035 0.01%29/Mar/05 09:58/chapters/san-diego/subnav/sn_behavioroff.gif
22688 0.31%29/Mar/05 09:58/behavior/
22610 29/Mar/05 09:58/chapters/san-diego/subnav/sn_faqon.gif
22481 0.01%29/Mar/05 09:58/chapters/san-diego/subnav/sn_emailon.gif
22297 29/Mar/05 09:58/chapters/san-diego/subnav/sn_homeon.gif
21474 0.68%29/Mar/05 09:57/graphics/fun/netbunnies/lucky-nuui1.jpg
20646 0.01%29/Mar/05 09:58/chapters/san-diego/subnav/sn_adoptionoff.gif
18422 0.01%29/Mar/05 09:57/icons/image2.gif
18231 29/Mar/05 09:57/icons/blank.gif
18190 29/Mar/05 09:58/chapters/san-diego/subnav/sn_healthoff.gif
17661 29/Mar/05 09:57/icons/back.gif
15910 0.02%29/Mar/05 09:58/graphics/donate.png
15827 0.27%29/Mar/05 09:56/adoption/
15700 29/Mar/05 09:57/icons/unknown.gif
15497 0.24%29/Mar/05 09:56/health/
15465 0.13%29/Mar/05 09:58/behavior/body-language.html
15316 0.12%29/Mar/05 09:58/care/new-bunny-index.html
14169 0.04%29/Mar/05 09:54/graphics/banners/adoption-l.gif
14153 0.01%29/Mar/05 09:54/graphics/banners/adoption-r.gif
13833 0.44%29/Mar/05 09:57/faq/sections/litter.html
12651 0.17%29/Mar/05 09:57/faq/sections/diet.html
12143 0.18%29/Mar/05 09:53/journal/3-7/brandolino-poem.html
11491 0.02%29/Mar/05 09:47/graphics/links/japanese.gif
11332 29/Mar/05 09:54/icons/folder.gif
10813 0.03%29/Mar/05 09:59/graphics/banners/links-l.gif
10787 29/Mar/05 09:59/graphics/banners/links-r.gif
10734 0.02%29/Mar/05 09:56/graphics/hrs.gif
10577 0.09%29/Mar/05 09:52/journal/3-9/cute-quotes.html
10562 0.03%29/Mar/05 09:59/graphics/banners/help-l.gif
10557 29/Mar/05 09:54/icons/binary.gif
10520 29/Mar/05 09:59/graphics/banners/help-r.gif
10203 0.15%29/Mar/05 09:55/faq/sections/housing.html
9859 0.12%29/Mar/05 09:58/chapters/san-diego/health/graphics/health_headergraphic_v2.jpg
9718 0.17%29/Mar/05 09:54/care/living-with-a-house-rabbit.html
9705 29/Mar/05 09:59/graphics/resources/red.gif
9591 0.08%29/Mar/05 09:52/journal/hrj-gallery.html
9465 0.09%29/Mar/05 09:52/journal/3-9/graphics/1.gif
9459 0.08%29/Mar/05 09:52/journal/3-9/graphics/2.gif
9429 0.06%29/Mar/05 09:52/journal/3-9/graphics/3.gif
9401 0.08%29/Mar/05 09:52/journal/3-9/graphics/4.gif
9398 0.07%29/Mar/05 09:52/journal/3-9/graphics/6.gif
9396 0.07%29/Mar/05 09:52/journal/3-9/graphics/5.gif
9369 0.01%29/Mar/05 09:39/cgi-bin/chat/chat2.cgi
1831 0.01%28/Mar/05 12:41  /cgi-bin/chat/chat2.cgi?action=banner
595 29/Mar/05 08:22  /cgi-bin/chat/chat2.cgi?action=register
81 27/Mar/05 19:14  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Poopybunny
73 28/Mar/05 12:00  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Flemishr2cool
62 26/Mar/05 20:52  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Kermit
49 27/Mar/05 20:42  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=L.A.B.B.
45 28/Mar/05 07:06  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Legolas
44 23/Mar/05 17:38  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Riokko
43 18/Mar/05 18:10  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Krissy
38 25/Mar/05 11:16  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=WimsMa
38 23/Mar/05 17:09  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=babywiso
33 27/Mar/05 19:45  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=JoW
33 28/Mar/05 11:56  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=lumpy-dumps
33 25/Mar/05 20:15  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=BekasBunnies
33 27/Mar/05 17:53  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=littlegem
31 22/Mar/05 19:36  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Lisaxx
31 28/Mar/05 09:02  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Silvergiant
30 19/Mar/05 19:56  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=taximom
29 27/Mar/05 20:14  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=mickey
28 20/Mar/05 19:08  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=buns2luv
28 20/Mar/05 19:09  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=TJJ
28 12/Mar/05 21:11  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=pandxpress
26 27/Mar/05 17:17  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=SunStar85
26 23/Mar/05 17:21  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=shersher
25 26/Mar/05 19:12  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Rose_Luna_Puff
21 20/Mar/05 19:34  /cgi-bin/chat/chat2.cgi?action=rooms&id=aidslanbxnucfjurgczulyurjakccq
20 27/Mar/05 17:32  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Agos2911
18 21/Mar/05 18:09  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=minilopsrock
17 17/Mar/05 11:46  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=lil
17 26/Mar/05 17:57  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=jackismck
16 21/Mar/05 19:45  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=drewbunnymore
16 11/Mar/05 17:58  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=chewycheb5000@
16 27/Mar/05 19:23  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Saje
16 25/Mar/05 11:49  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=~mabel
16 25/Mar/05 14:18  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=ashleigh
15 17/Mar/05 20:50  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=grace1917
14 20/Mar/05 09:36  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=LapLap
14 27/Mar/05 20:47  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=barrie
14 27/Mar/05 18:02  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=CookiesMom
14 26/Mar/05 16:58  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=lilac
14 27/Mar/05 20:31  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=CCowan
13  4/Mar/05 17:33  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Browniegrile
13 14/Mar/05 19:18  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=wharf
13 25/Mar/05 06:32  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=binkybobobunny
12 26/Mar/05 20:03  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=TINAKRAUEL
12 26/Mar/05 19:31  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Hopnoodle
12 25/Mar/05 13:18  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Kikina
11 21/Mar/05 19:53  /cgi-bin/chat/chat2.cgi?action=rooms&id=gdbawcqooqwdvjcllngfadezaomtsk
11 14/Mar/05 19:32  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=dumbunny
11 23/Mar/05 17:27  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=HyperCello
11 16/Mar/05 20:31  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Aura
10 18/Mar/05 15:15  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=MJCHIKA
9300 0.09%29/Mar/05 09:52/journal/3-9/graphics/7.gif
9262 0.09%29/Mar/05 09:52/journal/3-9/graphics/8.gif
8903 0.30%29/Mar/05 09:57/faq/sections/orphan.html
8528 0.03%29/Mar/05 09:52/links/rabbit-pictures.html
8516 0.16%29/Mar/05 09:52/graphics/hrs-rabbits/benny.gif
8514 0.15%29/Mar/05 09:52/graphics/hrs-rabbits/cecil.gif
8506 0.12%29/Mar/05 09:59/chapters/
8396 0.01%29/Mar/05 09:56/graphics/houserabbitsociety.gif
8389 0.18%29/Mar/05 09:52/graphics/hrs-rabbits/freckels.gif
8350 0.16%29/Mar/05 09:56/faq/sections/spay-neuter.html
8350 0.06%29/Mar/05 09:52/graphics/hrs-rabbits/guy.gif
8319 0.35%29/Mar/05 07:41/graphics/fun/netbunnies/herdoc-gerdoc-9wks-on-backs.jpg
8302 0.64%29/Mar/05 09:52/graphics/hrs-rabbits/minnie-in-tunnel.gif
8263 0.13%29/Mar/05 09:52/graphics/hrs-rabbits/jimmy.gif
8220 0.08%29/Mar/05 09:52/graphics/hrs-rabbits/sara.gif
8177 0.12%29/Mar/05 09:52/graphics/hrs-rabbits/ruby.gif
8164 0.11%29/Mar/05 09:52/graphics/hrs-rabbits/petunia.gif
8125 0.03%29/Mar/05 09:50/graphics/banners/kids-l.gif
8095 29/Mar/05 09:50/graphics/banners/kids-r.gif
7980 0.10%29/Mar/05 09:52/graphics/hrs-rabbits/thomas.gif
7912 0.11%29/Mar/05 09:52/graphics/hrs-rabbits/three-spots.gif
7865 0.08%29/Mar/05 09:52/graphics/hrs-rabbits/tinket-bell.gif
7841 0.15%29/Mar/05 09:52/graphics/hrs-rabbits/vanessa.gif
7769 0.11%29/Mar/05 09:52/graphics/hrs-rabbits/walter.gif
7688 0.08%29/Mar/05 09:32/kids/
7639 0.06%29/Mar/05 09:56/hrs-info/
7630 0.07%29/Mar/05 09:58/care/veggies.html
7498 0.02%29/Mar/05 09:46/graphics/link-hrsz.gif
7384 0.09%29/Mar/05 09:58/chapters/san-diego/adoption/graphics/adoption_headergraphic_v2.jpg
7319 0.44%29/Mar/05 09:52/graphics/mine/king-foo.gif
7143 0.03%29/Mar/05 09:52/graphics/mine/baby-zowie-profile-l.gif
7115 0.03%29/Mar/05 09:52/graphics/mine/baby-zowie-profile-r.gif
7061 0.12%29/Mar/05 09:52/graphics/mine/foo-t.jpg
7002 0.21%29/Mar/05 09:52/graphics/mine/izzy-zippy.gif
6969 0.33%29/Mar/05 09:53/graphics/mine/foo-zippy-by-comp.gif
6938 0.23%29/Mar/05 09:53/graphics/mine/foo-zowie-by-tv.gif
6880 0.21%29/Mar/05 09:53/graphics/mine/zowie-on-bed.gif
6825 0.37%29/Mar/05 09:53/graphics/mine/zowie-on-couch.gif
6768 0.46%29/Mar/05 09:53/graphics/mine/mom-zippy.gif
6594 0.02%29/Mar/05 09:59/graphics/banners/chapters-l.gif
6559 29/Mar/05 09:59/graphics/banners/chapters-r.gif
6540 0.16%29/Mar/05 09:56/rabbit-center/
6399 0.24%29/Mar/05 09:49/care/babies.html
6336 0.07%29/Mar/05 09:54/graphics/books/hrh.gif
6316 0.10%29/Mar/05 09:49/faq/sections/medical.html
6154 0.21%29/Mar/05 09:27/graphics/fun/netbunnies/3bunnies-chercat1.jpg
6047 0.03%29/Mar/05 09:49/graphics/link-hrslogo.gif
6016 0.08%29/Mar/05 09:58/faq/sections/toys.html
5973 0.07%29/Mar/05 09:54/care/drollery.html
5815 0.07%29/Mar/05 09:58/adoption/easter.html
5806 0.08%29/Mar/05 09:51/links/story-of-foobar-1.html
5794 0.02%29/Mar/05 09:58/cgi-bin/postcard.cgi
62 26/Mar/05 20:21  /cgi-bin/postcard.cgi?code=1111697966psinnette@cbcruiser.com
12 26/Mar/05 19:10  /cgi-bin/postcard.cgi?code=1111801315elf@pmt.org
5716 0.10%29/Mar/05 09:59/links/mail-order-resources.html
5463 0.07%29/Mar/05 09:58/chapters/san-diego/behavior/graphics/behavior_headergraphic_v2.jpg
5425 29/Mar/05 09:58/robots.txt
5396 0.18%29/Mar/05 09:49/graphics/babies/babiesnow.jpg
5374 0.09%29/Mar/05 09:56/rabbit-center/randomize/image9.gif
5373 0.11%29/Mar/05 09:56/rabbit-center/randomize/image7.gif
5350 0.09%29/Mar/05 09:56/rabbit-center/randomize/image11.gif
5324 0.12%29/Mar/05 09:56/rabbit-center/randomize/image5.gif
5298 0.10%29/Mar/05 09:56/rabbit-center/randomize/image4.gif
5277 0.09%29/Mar/05 09:56/rabbit-center/randomize/image3.gif
5229 0.10%29/Mar/05 09:56/rabbit-center/randomize/image2.gif
5211 0.05%29/Mar/05 09:56/rabbit-center/randomize/image10.jpg
5191 0.16%29/Mar/05 09:56/rabbit-center/graphics/bun.gif
5166 29/Mar/05 09:55/rabbit-center/graphics/icon_rabbit_r.gif
5163 0.08%29/Mar/05 09:55/rabbit-center/randomize/image1.gif
5150 0.05%29/Mar/05 09:56/rabbit-center/graphics/adoption-center-banner_gr.gif
5129 0.08%29/Mar/05 09:56/rabbit-center/randomize/image8.gif
5125 0.47%29/Mar/05 09:56/rabbit-center/Fortunate_ones_copy.jpg
5123 0.01%29/Mar/05 09:56/rabbit-center/graphics/icon_news_update.gif
5117 0.12%29/Mar/05 09:51/graphics/mine/foo/gifs/1-baby-foo-25.gif
5114 0.17%29/Mar/05 09:55/faq/sections/children.html
5098 29/Mar/05 09:56/rabbit-center/graphics/icon_events.gif
5089 0.04%29/Mar/05 09:51/graphics/mine/foo/2-pumpkin-foo-50.jpg
5080 29/Mar/05 09:56/rabbit-center/graphics/resources/pixel.gif
5076 0.01%29/Mar/05 09:56/rabbit-center/graphics/icon_donation.gif
5066 0.36%29/Mar/05 09:49/graphics/babies/sixteenday.jpg
5058 29/Mar/05 09:51/graphics/bunny-butt.gif
5052 0.01%29/Mar/05 09:56/rabbit-center/graphics/icon_adopt_rabbit.gif
5040 0.04%29/Mar/05 09:51/graphics/mine/foo/3-under-bed-50.jpg
5032 0.01%29/Mar/05 09:56/rabbit-center/graphics/icon_boarding.gif
5023 29/Mar/05 09:56/rabbit-center/graphics/icon_services.gif
5015 0.05%29/Mar/05 09:51/graphics/mine/foo/8-zowie-holiday-inn-50.jpg
5014 0.07%29/Mar/05 09:51/graphics/mine/foo/4-under-bed-50.jpg
5011 0.01%29/Mar/05 09:56/rabbit-center/graphics/icon_bunny_buddy.gif
5003 0.01%29/Mar/05 09:56/rabbit-center/graphics/icon_get_involved.gif
4990 0.06%29/Mar/05 09:51/graphics/mine/foo/5-under-table-50.jpg
4966 0.26%29/Mar/05 09:49/graphics/babies/nestbabyfirst.jpg
4944 0.06%29/Mar/05 09:51/graphics/mine/foo/6-licking-50.jpg
4928 0.05%29/Mar/05 09:51/graphics/mine/foo/7-by-couch-50.jpg
4873 0.07%29/Mar/05 09:59/care/vets.html
4822 0.05%29/Mar/05 09:59/links/
4698 0.02%29/Mar/05 09:49/graphics/babies/kplogo.gif
4632 0.06%29/Mar/05 09:50/care/newborn.html
4453 0.05%29/Mar/05 09:55/chapters/san-diego/diet/graphics/diet_headergraphic_v2.jpg
4388 0.04%29/Mar/05 09:52/fun/izzy-zowie/
4224 0.03%29/Mar/05 09:22/care/facts.html
4210 0.06%29/Mar/05 09:59/journal/1/history-of-easter.html
4036 0.11%29/Mar/05 09:54/graphics/fun/netbunnies/bunny-hays1.jpg
4027 0.06%29/Mar/05 09:59/faq/sections/vet.html
4002 0.10%29/Mar/05 09:58/chapters/san-diego/
3999 0.07%29/Mar/05 09:52/fun/izzy-zowie/izzy-up-t.jpg
3915 0.07%29/Mar/05 09:52/fun/izzy-zowie/who-me-t.jpg
3915 0.04%29/Mar/05 09:52/fun/izzy-zowie/izzy-portrait-t.jpg
3893 0.04%29/Mar/05 09:58/journal/3-11/legs.html
3890 0.05%29/Mar/05 09:52/fun/izzy-zowie/izzy-zowie.jpg
3875 0.05%29/Mar/05 09:52/fun/izzy-zowie/izzy-t.jpg
3824 0.04%29/Mar/05 09:57/vets/
3806 0.03%29/Mar/05 09:59/graphics/easter/rabbit5.gif
3806 0.15%29/Mar/05 09:58/journal/3-11/graphics/feet-out-on-couch.gif
3805 0.06%29/Mar/05 09:52/fun/izzy-zowie/zowie1-t.jpg
3802 0.06%29/Mar/05 09:52/fun/izzy-zowie/zowie2-t.jpg
3800 0.06%29/Mar/05 09:52/fun/izzy-zowie/zowie-izzy-t.jpg
3761 0.09%29/Mar/05 09:52/fun/izzy-zowie/carl-chasing-izzy-t.jpg
3649 0.48%29/Mar/05 09:40/rabbit-center/adoptables/
3600 0.01%29/Mar/05 09:51/links/zippy-izzy.html
3593 0.05%29/Mar/05 09:58/journal/3-11/graphics/laying-out-by-wall.gif
3591 0.03%29/Mar/05 09:58/journal/3-11/graphics/flopped-on-each-other.gif
3583 0.07%29/Mar/05 09:58/journal/1/liver-disease.html
3522 0.07%29/Mar/05 09:55/graphics/postcard/Muggs.jpg
3446 0.08%29/Mar/05 09:40/rabbit-center/hayward_rabbits.html
3418 0.07%29/Mar/05 09:58/chapters/san-diego/rabbits.jpg
3403 0.89%29/Mar/05 09:42/chapters/san-diego/adoption/colorbook.pdf
3350 29/Mar/05 09:58/chapters/san-diego/navfront_behavioroff.gif
3341 0.04%29/Mar/05 09:46/fun/ascii-art.html
3302 0.01%29/Mar/05 09:58/chapters/san-diego/navfront_dietoff.gif
3292 0.01%29/Mar/05 09:55/rabbit-center/graphics/header_gr.gif
3288 0.08%29/Mar/05 09:55/faq/sections/training.html
3288 0.33%29/Mar/05 08:08/easter/flyer/childstory.pdf
3286 29/Mar/05 09:58/chapters/san-diego/navfront_adoptionoff.gif
3286 0.03%29/Mar/05 09:51/graphics/mine/emmybunny-s.gif
3274 0.05%29/Mar/05 09:51/graphics/mine/zippy1-s.gif
3271 0.01%29/Mar/05 09:58/chapters/san-diego/navfront_healthoff.gif
3266 0.05%29/Mar/05 09:51/graphics/mine/zippy2-s.gif
3262 0.03%29/Mar/05 09:51/care/fruits.html
3259 0.04%29/Mar/05 09:51/graphics/mine/zippy3-s.gif
3248 0.01%29/Mar/05 09:58/chapters/san-diego/navfront_productsoff.gif
3247 0.14%29/Mar/05 09:52/graphics/fun/netbunnies/willow-having-a-chat.jpg
3224 0.05%29/Mar/05 09:53/faq/sections/introductions.html
3217 0.01%29/Mar/05 09:58/chapters/san-diego/navfront_aboutusoff.gif
3177 0.07%29/Mar/05 09:47/links/translate.html
3095 0.07%29/Mar/05 09:40/rabbit-center/hayward_rescue/hayward_graphics/first_day.jpg
3089 0.01%29/Mar/05 09:58/chapters/san-diego/navfront_adoptionon.gif
3083 0.01%29/Mar/05 09:58/chapters/san-diego/front_top.gif
3059 0.01%29/Mar/05 09:58/chapters/san-diego/houserabbit.gif
3045 0.01%29/Mar/05 09:58/chapters/san-diego/navfront_behavioron.gif
3045 0.02%29/Mar/05 09:40/rabbit-center/graphics/header_gr_hw.gif
3038 0.01%29/Mar/05 09:58/chapters/san-diego/donateoff.gif
3025 0.01%29/Mar/05 09:58/chapters/san-diego/society.gif
3022 0.05%29/Mar/05 09:51/journal/3-4/two-rabbits.html
2999 0.01%29/Mar/05 09:58/chapters/san-diego/navfront_dieton.gif
2997 0.01%29/Mar/05 09:58/chapters/san-diego/sandiego_.gif
2991 0.01%29/Mar/05 09:58/chapters/san-diego/navfront_healthon.gif
2988 0.01%29/Mar/05 09:58/chapters/san-diego/sandieg_2.gif
2972 29/Mar/05 09:58/chapters/san-diego/yourresource.gif
2959 0.14%29/Mar/05 09:17/hrs-info/contacts.html
2956 0.01%29/Mar/05 09:58/chapters/san-diego/navfront_productson.gif
2955 0.01%29/Mar/05 09:40/rabbit-center/adoptables/header_gr.gif
2948 0.06%29/Mar/05 09:48/faq/sections/aggression.html
2944 0.01%29/Mar/05 09:53/rabbit-center/graphics/header.gif
2930 0.01%29/Mar/05 09:58/chapters/san-diego/rabbits2.jpg
2917 29/Mar/05 09:40/rabbit-center/adoptables/adopt-t.gif
2914 0.01%29/Mar/05 09:58/chapters/san-diego/navfront_aboutuson.gif
2907 0.05%29/Mar/05 09:40/rabbit-center/adoptables/P2050012tiny.jpg
2884 0.05%29/Mar/05 09:51/faq/sections/hazards.html
2860 29/Mar/05 09:58/chapters/san-diego/quiz.gif
2860 0.02%29/Mar/05 09:55/postcard/
2834 0.06%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/debbie r1411 09tiny.jpg
2814 0.01%29/Mar/05 09:40/rabbit-center/adoptables/images/altimage.gif
2807 0.05%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/tia r1409 06tiny.jpg
2801 0.05%29/Mar/05 09:41/rabbit-center/adoptables/graphics/thumb/bounce27tiny.jpg
2800 0.03%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/holly-tiny.jpg
2795 0.04%29/Mar/05 09:54/faq/sections/outdoors.html
2787 0.03%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/sara1-tiny.jpg
2778 0.05%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/fred r1412-09tiny.jpg
2774 0.02%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/satin-r1308-01tiny.jpg
2772 0.01%29/Mar/05 09:56/graphics/banners/vets-l.gif
2770 0.02%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/luke3-r1396-47tiny.jpg
2769 29/Mar/05 09:56/graphics/banners/vets-r.gif
2768 0.03%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/yuna-r1395-16tiny.jpg
2754 0.03%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/george-r1397-34tiny.jpg
2737 0.01%29/Mar/05 09:58/chapters/san-diego/donateon.gif
2733 0.03%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/annie05tiny.jpg
2733 0.03%29/Mar/05 09:52/journal/1/rabbit-run.html
2718 0.05%29/Mar/05 09:55/faq/sections/groom.html
2718 0.03%29/Mar/05 09:40/rabbit-center/adoptables/images/zela31tiny.jpg
2708 0.02%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/charms-r1352-47tiny.jpg
2704 0.02%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/chimes-r1352-32tiny.jpg
2697 0.03%29/Mar/05 09:40/rabbit-center/adoptables/images/venus06tiny.jpg
2692 0.35%29/Mar/05 09:47/graphics/links/chinese.bmp
2690 0.03%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/richard131tiny.jpg
2688 0.05%29/Mar/05 09:45/graphics/fun/netbunnies/2bunnies7-agape1.jpg
2686 0.02%29/Mar/05 09:40/rabbit-center/adoptables/images/eileen_small.gif
2683 0.02%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/michael046tiny.jpg
2678 0.03%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/johanna095tiny.jpg
2677 0.02%29/Mar/05 09:37/stories/
2662 0.04%29/Mar/05 09:50/faq/sections/chewing.html
2656 0.03%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/lewis122tiny.jpg
2652 0.03%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/danny116tiny.jpg
2648 0.03%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/frankie041tiny.jpg
2643 0.02%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/angel062tiny.jpg
2636 0.02%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/cleo61tiny.jpg
2636 0.03%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/benton111tiny.jpg
2630 0.05%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/berklee03tiny.jpg
2624 29/Mar/05 09:47/graphics/links/arneb.gif
2621 29/Mar/05 09:47/graphics/links/hebrew.gif
2619 29/Mar/05 09:47/graphics/links/araanib.gif
2615 0.02%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/julie03tiny.jpg
2615 0.02%29/Mar/05 09:41/rabbit-center/adoptables/graphics/thumb/ichiro12tiny.jpg
2613 0.03%29/Mar/05 09:56/cgi-bin/print-article.cgi
2613 0.01%29/Mar/05 09:40/rabbit-center/adoptables/images/jenny_small.jpg
2612 29/Mar/05 09:47/graphics/links/youn.gif
2605 29/Mar/05 09:47/graphics/links/Persian.gif
2597 0.02%29/Mar/05 09:41/rabbit-center/adoptables/graphics/thumb/grabriel13tiny.jpg
2591 0.03%29/Mar/05 09:41/rabbit-center/adoptables/graphics/thumb/peaches26tiny.jpg
2590 0.15%29/Mar/05 09:27/journal/
2587 0.02%29/Mar/05 09:41/rabbit-center/adoptables/graphics/thumb/timothy27tiny.jpg
2586 29/Mar/05 09:47/graphics/links/tibet.gif
2577 0.05%29/Mar/05 09:41/rabbit-center/adoptables/graphics/thumb/julliette64tiny.jpg
2576 0.02%29/Mar/05 09:41/rabbit-center/adoptables/graphics/thumb/gretchen15tiny.jpg
2572 0.08%29/Mar/05 09:56/chapters/san-diego/adoption/
2571 0.03%29/Mar/05 09:41/rabbit-center/adoptables/graphics/thumb/anusha07tiny.jpg
2570 0.02%29/Mar/05 09:41/rabbit-center/adoptables/graphics/thumb/bungee08tiny.jpg
2566 0.14%29/Mar/05 09:41/rabbit-center/adoptables/images/mr_missy.gif
2558 0.03%29/Mar/05 09:41/rabbit-center/adoptables/graphics/thumb/buzz25tiny.jpg
2558 0.01%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/baloo-tiny.jpg-41
2556 0.12%29/Mar/05 09:41/rabbit-center/adoptables/images/mazi_000.gif
2552 0.04%29/Mar/05 09:41/rabbit-center/adoptables/images/maxie_small.gif
2550 0.02%29/Mar/05 09:41/rabbit-center/adoptables/graphics/thumb/valentino02tiny.jpg
2545 29/Mar/05 09:41/rabbit-center/adoptables/images/lily_small.jpg
2538 29/Mar/05 09:16/rabbit-center/lucky/css/mm_health_nutr.css
2519 0.03%29/Mar/05 09:41/rabbit-center/adoptables/graphics/thumb/Brittany.jpg
2505 29/Mar/05 09:50/spam_vaccine/at_medium.gif
2493 0.03%29/Mar/05 09:51/journal/4-3/new-home.html
2492 0.02%29/Mar/05 09:41/rabbit-center/adoptables/graphics/thumb/r1215sami16tiny.jpg
2491 0.05%29/Mar/05 09:54/chapters/san-diego/health/sick.html
2491 0.02%29/Mar/05 09:41/rabbit-center/adoptables/images/r1179josephine62tiny.jpg
2482 0.02%29/Mar/05 09:41/rabbit-center/adoptables/images/r1165claudia096tiny.jpg
2481 0.02%29/Mar/05 09:41/rabbit-center/adoptables/images/jasmine47tiny.jpg
2480 0.02%29/Mar/05 09:41/rabbit-center/adoptables/images/phoebe2_64tiny.jpg
2476 0.03%29/Mar/05 09:41/rabbit-center/adoptables/graphics/thumb/r1180anabelle40tiny.jpg
2465 0.03%29/Mar/05 09:41/rabbit-center/adoptables/images/honey32tiny.jpg
2460 0.02%29/Mar/05 09:41/rabbit-center/adoptables/images/casey43tiny.jpg
2460 0.02%29/Mar/05 09:40/rabbit-center/adoptables/images/r1071honda58tiny.jpg
2448 0.09%29/Mar/05 09:53/graphics/fun/netbunnies/bunny-white.jpg
2448 0.03%29/Mar/05 09:41/rabbit-center/adoptables/graphics/thumb/r1017mini81tiny.jpg
2446 0.02%29/Mar/05 09:41/rabbit-center/adoptables/images/r1034sergio61tiny.jpg
2439 0.02%29/Mar/05 09:41/rabbit-center/adoptables/images/poppy49tiny.jpg
2437 0.02%29/Mar/05 09:41/rabbit-center/adoptables/graphics/thumb/r1009greta08tiny.jpg
2436 0.02%29/Mar/05 09:41/rabbit-center/adoptables/graphics/thumb/r967natalia19tiny.jpg
2435 0.02%29/Mar/05 09:41/rabbit-center/adoptables/graphics/thumb/moca+bean30tiny.jpg
2431 0.02%29/Mar/05 09:41/rabbit-center/adoptables/graphics/thumb/r963teddy2-13tiny.jpg
2423 0.02%29/Mar/05 09:41/rabbit-center/adoptables/graphics/thumb/r934brownie16tiny.jpg
2422 0.03%29/Mar/05 09:41/rabbit-center/adoptables/graphics/thumb/r964emma2-21tiny.jpg
2419 0.01%28/Mar/05 11:31/chapters/san-diego/images/hrs-square-easter.gif
2362 0.09%29/Mar/05 09:59/graphics/fun/netbunnies/GaryMaggie-Bottorff1.jpg
2361 0.08%29/Mar/05 09:50/graphics/fun/netbunnies/bunnies-cook1.jpg
2339 0.03%29/Mar/05 09:53/journal/3-1/just-for-fun.html
2333 0.02%27/Mar/05 21:51/rabbit-center/adoptables/graphics/thumb/patootie-r1295-27tiny.jpg
2290 0.03%29/Mar/05 08:42/graphics/fun/netbunnies/snoop-robson1.jpg
2284 29/Mar/05 09:53/styles/joining.css
2273 0.19%29/Mar/05 09:40/graphics/fun/netbunnies/2-rabbits-outside.jpg
2267 29/Mar/05 09:16/rabbit-center/lucky/images/mm_dashed_line.gif
2264 27/Mar/05 20:44/rabbit-center/adoptables/images/tulip_small.jpg
2259 29/Mar/05 09:16/rabbit-center/lucky/images/mm_spacer.gif
2183 0.09%29/Mar/05 09:55/graphics/postcard/izzy-portrait-crop-tmb.jpg
2179 0.10%29/Mar/05 09:56/easter/hrs_easter_release_2005.pdf
2174 0.03%29/Mar/05 09:57/faq/sections/rabbit-proofing.html
2170 0.03%29/Mar/05 09:45/journal/1/dogs.html
2167 0.03%29/Mar/05 09:55/graphics/postcard/paddington-craddick-tmb.jpg
2166 0.02%27/Mar/05 21:12/rabbit-center/adoptables/graphics/thumb/r958hershey37tiny.jpg
2163 0.02%29/Mar/05 09:55/graphics/postcard/tabatha-tmb.jpg
2153 0.06%29/Mar/05 09:40/graphics/fun/netbunnies/bear1-binks1.jpg
2149 0.02%29/Mar/05 09:24/easter/flyer/
2142 0.03%29/Mar/05 09:41/journal/2-11/cats-and-rabbits.html
2141 0.03%29/Mar/05 09:55/graphics/postcard/lavender-tmb.jpg
2139 0.03%29/Mar/05 09:46/faq/sections/treat.html
2135 0.02%29/Mar/05 09:55/graphics/postcard/willow-in-bed-teddy-tmb.jpg
2135 0.03%29/Mar/05 09:55/graphics/postcard/strawberry-white-baby-tmb.gif
2134 0.02%29/Mar/05 09:55/graphics/postcard/tracy-tmb.jpg
2125 0.07%29/Mar/05 09:36/graphics/fun/netbunnies/0246.jpg
2121 0.02%29/Mar/05 09:55/graphics/postcard/amos-tmb.jpg
2120 0.02%29/Mar/05 09:55/graphics/postcard/Pl-sch10-tmb.jpg
2110 0.02%29/Mar/05 09:55/graphics/postcard/Rab1-tmb.jpg
2104 0.02%29/Mar/05 09:55/graphics/postcard/Tommy2-tmb.jpg
2099 0.04%29/Mar/05 09:52/chapters/san-diego/behavior/
2099 0.05%29/Mar/05 09:49/graphics/chinese-bunny.gif
2086 0.02%26/Mar/05 03:52/rabbit-center/adoptables/graphics/thumb/r935nibbles02tiny.jpg
2078 0.02%29/Mar/05 09:16/rabbit-center/lucky_rescue.html
2070 0.05%29/Mar/05 09:27/graphics/fun/netbunnies/1016sleepycuddle.jpg
2068 0.01%29/Mar/05 09:37/graphics/banners/stories-l.gif
2066 0.03%29/Mar/05 09:58/adoption/rabbits-at-easter.html
2064 0.05%29/Mar/05 09:38/journal/3-6/chew-stick.html
2059 0.02%29/Mar/05 09:48/care/box-toy.html
2054 29/Mar/05 09:37/graphics/banners/stories-r.gif
2051 0.03%29/Mar/05 09:53/journal/3-1/graphics/trio-2.gif
2051 0.03%29/Mar/05 09:53/journal/3-1/graphics/trio-1.gif
2050 0.06%29/Mar/05 09:16/rabbit-center/lucky/images/lucky_1_002.gif
2049 0.02%29/Mar/05 09:54/journal/1/rejection.html
2048 0.03%29/Mar/05 09:53/journal/3-1/graphics/trio-3.gif
2029 0.03%29/Mar/05 09:52/chapters/san-diego/diet/
2028 0.14%29/Mar/05 09:51/graphics/fun/netbunnies/2-white-rabbits-cushons.jpg
2025 0.07%29/Mar/05 09:53/graphics/fun/netbunnies/cute-jones1.jpg
1982 0.03%29/Mar/05 09:45/graphics/fun/netbunnies/hello.jpg
1960 0.02%29/Mar/05 09:32/faq/sections/handling.html
1934 0.03%29/Mar/05 09:50/care/orphan.html
1931 0.03%29/Mar/05 09:57/graphics/misc/cable-wrap-pkg.jpg
1929 0.08%29/Mar/05 09:07/graphics/fun/netbunnies/1.jpg
1929 0.03%29/Mar/05 09:57/graphics/misc/wrapped-cord.jpg
1927 0.11%29/Mar/05 09:53/chapters/san-diego/adoption/adoption_photos.html
1918 29/Mar/05 03:32/chapters/san-diego/adoption/pdf_icon.gif
1902 0.02%29/Mar/05 09:30/graphics/fun/netbunnies/fripouille-eating-sandals.jpg
1898 0.02%29/Mar/05 09:41/journal/4-4/pen-living.html
1886 0.02%29/Mar/05 09:58/graphics/easter/anti-gabriella-circle.jpg
1880 0.02%29/Mar/05 09:14/journal/1/amoxicillin-warning.html
1876 0.07%29/Mar/05 09:46/graphics/fun/netbunnies/2dumb.jpg
1848 0.02%29/Mar/05 09:54/journal/2-8/honorary-rabbit.html
1843 0.02%29/Mar/05 09:51/journal/2-7/max.html
1842 0.03%29/Mar/05 09:20/graphics/fun/netbunnies/2bunnies8-agape1.jpg
1834 0.04%29/Mar/05 09:57/graphics/fun/netbunnies/Biba-Vangeel1.jpg
1823 0.06%29/Mar/05 09:50/graphics/fun/netbunnies/bunny-stak1.jpg
1810 0.01%29/Mar/05 09:38/journal/3-6/graphics/tossing-1.gif
1808 0.06%29/Mar/05 09:38/journal/3-6/graphics/under-chair.gif
1808 29/Mar/05 09:38/journal/3-6/graphics/tossing-3.gif
1806 29/Mar/05 09:38/journal/3-6/graphics/tossing-4.gif
1805 0.01%29/Mar/05 09:38/journal/3-6/graphics/tossing-2.gif
1805 0.03%29/Mar/05 09:38/journal/3-6/graphics/basket-keys.gif
1805 0.02%29/Mar/05 09:38/journal/3-6/graphics/lop-in-basket.gif
1801 0.03%29/Mar/05 09:38/journal/3-6/graphics/baskets-pinecones.gif
1798 0.01%29/Mar/05 09:38/journal/3-6/graphics/batting-toys.gif
1797 0.02%29/Mar/05 09:38/journal/3-6/graphics/digging.gif
1797 0.05%29/Mar/05 09:35/graphics/fun/netbunnies/bunny-lee1.jpg
1792 0.06%29/Mar/05 09:58/chapters/san-diego/adoption/Adoption_Photos/HRS_Bonnie_3_Jan05.jpg
1791 0.01%29/Mar/05 09:58/hrs-info/whats-popular.html
1785 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/Bear-Zehpyr1.jpg
1783 0.01%29/Mar/05 07:59/easter/link.html
1780 0.02%29/Mar/05 09:47/hrs-info/link-to-hrs.html
1776 0.01%27/Mar/05 14:08/chapters/san-diego/images/hrs-banner-easter.gif
1773 0.02%29/Mar/05 09:58/hrs-info/whats-new.html
1771 0.01%29/Mar/05 09:40/chat/
1761 0.07%29/Mar/05 09:50/graphics/fun/netbunnies/Bunny-Davis1.jpg
1757 0.15%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_NatashaBeau3_Jan05.jpg
1756 0.02%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Neil_Feb05.jpg
1740 0.04%29/Mar/05 09:13/graphics/fun/netbunnies/annie-berrie1.jpg
1734 0.04%29/Mar/05 09:38/graphics/fun/netbunnies/bugs-arobinson1.jpg
1730 0.02%29/Mar/05 09:47/fun/biscuts.html
1723 0.01%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Daisy2_Jan05.jpg
1719 0.03%29/Mar/05 09:54/graphics/fun/netbunnies/bertha-hogue1.jpg
1713 0.02%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/Duchess_Rory_lowres.jpg
1700 0.02%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/Rory_tv_spot.jpg
1700 0.01%29/Mar/05 09:24/easter/flyer/food-not-free.jpg
1700 0.02%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/Duchess_on-air_lowres.jpg
1696 0.02%29/Mar/05 09:24/easter/flyer/childstory.jpg
1683 29/Mar/05 09:24/easter/flyer/flyer1.gif
1681 29/Mar/05 09:24/easter/flyer/flyer2.gif
1677 0.03%29/Mar/05 09:57/hrs-info/feedback.html
1676 0.01%29/Mar/05 09:24/easter/flyer/flyer3.gif
1675 0.01%29/Mar/05 09:24/easter/flyer/flyer4.gif
1674 0.09%29/Mar/05 09:52/graphics/fun/netbunnies/2rabbitsinbasketjanwild.jpg
1671 0.03%29/Mar/05 08:44/links/sections/groups.html
1665 0.02%29/Mar/05 09:47/journal/2-7/letterman.html
1663 0.06%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Kisser_2_Jun04.JPG
1659 0.03%29/Mar/05 09:09/rabbit-center/lucky/images/lucky.gif
1657 0.01%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/vito3.jpg
1650 0.01%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/alex3.jpg
1650 0.02%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Lilly_2_Jun04.JPG
1649 0.02%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Honey_4_11Jul03.JPG
1640 0.03%29/Mar/05 09:53/journal/4-4/tough-bonding.html
1639 0.01%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/cookie2.jpg
1638 0.02%29/Mar/05 09:51/journal/2-7/graphics/black-max.gif
1637 0.02%29/Mar/05 09:52/chapters/san-diego/aboutus/graphics/aboutus_headergraphic_v2.jpg
1632 0.04%29/Mar/05 09:55/graphics/fun/netbunnies/Lapin-profil.jpg
1630 0.14%28/Mar/05 11:31/chapters/san-diego/adoption/Adoption_Photos/HRS_NatashaBeau1_Jan05.jpg
1630 0.03%29/Mar/05 09:16/rabbit-center/lucky/images/front_001.gif
1629 0.03%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Romeo_Raindrop_23Sept04.jpg
1629 0.05%29/Mar/05 09:38/graphics/fun/netbunnies/2buns-herrington1.jpg
1625 0.05%29/Mar/05 09:09/chapters/san-diego/adoption/Cages/cage.html
1619 0.01%29/Mar/05 09:16/rabbit-center/lucky/images/logo-footer.gif
1614 29/Mar/05 09:52/links/foo.html
1612 0.03%25/Mar/05 20:54/rabbit-center/adoptables/graphics/thumb/dana21tiny.jpg
1611 0.02%29/Mar/05 09:43/journal/2-10/mellow-lops.html
1610 0.02%29/Mar/05 09:28/graphics/fun/netbunnies/P1010005.jpg
1606 0.01%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Luke_3_Jan05.jpg
1605 0.01%29/Mar/05 09:38/fun/answer.html
1602 0.01%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Molly_1_Feb05.jpg
1598 0.01%27/Mar/05 13:10/chapters/san-diego/adoption/Adoption_Photos/HRS_Stewart_2_Feb05.jpg
1591 0.03%29/Mar/05 09:32/faq/sections/multiple.html
1591 0.02%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Lizetta_Dec04.jpg
1590 0.02%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Ranger_4_20Oct04.JPG
1590 0.01%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Angel_Dec04.jpg
1586 29/Mar/05 09:02/cgi-bin/chat/chatgu.cgi
1004 29/Mar/05 09:02  /cgi-bin/chat/chatgu.cgi?chat.cgi
19 18/Mar/05 17:31  /cgi-bin/chat/chatgu.cgi?http://img.photobucket.com/albums/v258/Poopybunny/dollynest.jpg
18 27/Mar/05 16:08  /cgi-bin/chat/chatgu.cgi?http://www.ralfchat.com
15  5/Mar/05 23:10  /cgi-bin/chat/chatgu.cgi?http://img.photobucket.com/albums/v258/Poopybunny/dollybite.jpg
13 18/Mar/05 19:17  /cgi-bin/chat/chatgu.cgi?http://img.photobucket.com/albums/v258/Poopybunny/dollynest004.jpg
11 18/Mar/05 19:18  /cgi-bin/chat/chatgu.cgi?http://img.photobucket.com/albums/v258/Poopybunny/dollynestbabies001.jpg
11  1/Mar/05 18:07  /cgi-bin/chat/chatgu.cgi?http://ecard.veepers.com/card/sij_d2ki2rgAEBDaXDYqlW
10  3/Mar/05 17:32  /cgi-bin/chat/chatgu.cgi?http://www.ratemybunny.com/
1581 0.03%29/Mar/05 09:41/chapters/san-diego/health/
1579 0.01%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Jemma_21Feb05.JPG
1578 0.14%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Gwen_2_17Sept04.JPG
1577 0.01%27/Mar/05 21:18/rabbit-center/adoptables/graphics/thumb/anabelle-r1393-48tiny.jpg
1576 0.16%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Marjorie_1_17Sep04.JPG
1574 0.03%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Sierra_Dec04.jpg
1563 0.03%29/Mar/05 09:50/graphics/brushbaby.jpg
1561 0.10%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/blossom1.jpg
1558 0.32%29/Mar/05 09:22/chapters/san-diego/diet/graphics/Food_Chart.pdf
1557 0.11%29/Mar/05 09:52/chapters/san-diego/diet/graphics/Food_pyramid.jpg
1557 0.02%29/Mar/05 09:59/journal/3-12/disabled-litter.html
1549 0.03%29/Mar/05 09:00/graphics/fun/netbunnies/Cuddles.jpg
1547 0.04%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Dallas_Randi_4_4_ezr.jpg
1536 0.02%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Keera_Monroe_DEc04.jpg
1535 0.01%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Georgia_4_11Jul03.JPG
1532 0.03%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Dusty_Ronan_4_Dec04.jpg
1507 0.01%29/Mar/05 09:40/rabbit-center/hayward_rescue/hayward_graphics/abscess.jpg
1504 0.04%29/Mar/05 09:57/graphics/fun/netbunnies/badbadbunny-Intelligoth1.jpg
1500 0.01%29/Mar/05 09:47/links/sections/pictures.html
1499 0.02%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Simon_Dec04.jpg
1499 0.02%29/Mar/05 09:54/chapters/san-diego/products/graphics/products_headergraphic_v2.jpg
1486 0.05%29/Mar/05 09:57/graphics/fun/netbunnies/amelia-mcsherry1.jpg
1484 0.03%29/Mar/05 09:53/journal/2-4/emergency-preparedness.html
1484 0.04%29/Mar/05 09:55/graphics/fun/netbunnies/Bunnies-Cohen1.jpg
1483 0.13%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/pamela.jpg
1477 0.02%29/Mar/05 09:32/graphics/fun/netbunnies/BomBom-Southall1.jpg
1467 0.02%29/Mar/05 09:00/opinion/
1464 0.02%29/Mar/05 09:47/journal/2-7/graphics/top-10.gif
1462 0.04%29/Mar/05 06:47/graphics/fun/netbunnies/6V46_006.jpg
1460 0.01%29/Mar/05 09:55/graphics/postcard/rabbit-stamp.gif
1460 0.02%29/Mar/05 09:54/adoption/baby-bunnies.html
1449 0.02%29/Mar/05 09:16/graphics/fun/netbunnies/Asher2-Denise1.jpg
1436 0.01%29/Mar/05 09:59/journal/3-1/games-rabbits-play.html
1431 0.02%29/Mar/05 09:57/journal/1/lap-rabbit.html
1429 0.02%29/Mar/05 09:59/faq/sections/sources.html
1426 0.02%29/Mar/05 09:59/hrs-info/joining.html
1420 0.02%29/Mar/05 09:56/faq/sections/warm-weather.html
1413 0.02%27/Mar/05 22:15/rabbit-center/adoptables/images/r1176emy08tiny.jpg
1401 0.08%29/Mar/05 09:58/graphics/fun/netbunnies/2rabbitsoutsideleaves.jpg
1400 0.08%29/Mar/05 07:32/graphics/fun/netbunnies/3rabbitsonchair.jpg
1391 0.02%29/Mar/05 09:49/chapters/san-diego/diet/foods.html
1386 0.01%29/Mar/05 08:57/links/sections/reference.html
1371 0.03%29/Mar/05 08:44/graphics/fun/netbunnies/Bunny1-Hough1.jpg
1366 0.01%29/Mar/05 09:59/chapters/san-francisco/graphics/wavtile.gif
1366 0.03%29/Mar/05 09:56/graphics/fun/netbunnies/BISCOTTO-Negro1.jpg
1363 0.02%29/Mar/05 09:59/graphics/fun/netbunnies/rabbit2-wlals1.jpg
1361 0.04%29/Mar/05 09:07/chapters/san-diego/adoption/Cages/Cage-Dolce.jpg
1356 0.02%29/Mar/05 07:59/journal/3-1/red-urine.html
1342 0.02%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Madeline_2_Feb05.jpg
1340 0.05%29/Mar/05 09:06/rabbit-center/adoptables/graphics/big/
1339 0.10%29/Mar/05 09:07/chapters/san-diego/adoption/Cages/Libby_cage_setup.jpg
1328 0.02%29/Mar/05 09:52/graphics/mine/foo/9-cds-50.jpg
1327 0.07%29/Mar/05 09:07/chapters/san-diego/adoption/Cages/Honey_famroom_pen.JPG
1319 0.03%29/Mar/05 09:46/journal/3-4/pellets.html
1310 0.02%29/Mar/05 09:21/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Capodimonte_flower_basket.JPG
1309 0.01%29/Mar/05 09:51/health/exotic-diseases.html
1309 0.02%29/Mar/05 09:54/journal/3-11/lift.html
1305 0.01%29/Mar/05 09:05/graphics/fun/netbunnies/C-H-resting.jpg
1297 0.03%29/Mar/05 09:52/graphics/fun/netbunnies/HoneyBunny-Lud1.jpg
1295 0.02%29/Mar/05 09:58/journal/1/place-space.html
1293 0.05%29/Mar/05 09:48/graphics/fun/netbunnies/6V46_003.jpg
1292 0.04%29/Mar/05 09:57/graphics/fun/netbunnies/Annabelle-Geisler1.jpg
1286 0.04%29/Mar/05 08:59/graphics/fun/netbunnies/Athene-Owdicat1.jpg
1285 0.01%29/Mar/05 09:30/graphics/fun/netbunnies/C-H-circle.jpg
1283 0.02%29/Mar/05 09:07/chapters/san-diego/adoption/Cages/Shelley_office_1.JPG
1278 0.03%29/Mar/05 09:07/chapters/san-diego/adoption/Cages/Cage-LaceyBeau.jpg
1277 0.05%29/Mar/05 09:57/graphics/fun/netbunnies/Bunny-Hiler1.jpg
1273 0.06%29/Mar/05 09:07/chapters/san-diego/adoption/Cages/Alison_pen_1.JPG
1268 0.07%29/Mar/05 09:07/chapters/san-diego/adoption/Cages/Alison_pen_2.JPG
1262 0.01%29/Mar/05 09:46/graphics/fun/netbunnies/C-H-eating.jpg
1259 0.03%29/Mar/05 09:57/graphics/fun/netbunnies/9.jpg
1254 0.05%29/Mar/05 09:40/graphics/fun/netbunnies/BabyBunnies-Kiddazzle1.jpg
1249 0.08%29/Mar/05 09:47/graphics/fun/netbunnies/bunnies.gif
1248 0.03%29/Mar/05 09:07/chapters/san-diego/adoption/Cages/Bess_cage.JPG
1248 0.01%29/Mar/05 09:35/help/
1238 0.04%29/Mar/05 09:51/graphics/fun/netbunnies/BBunny17-Myers1.jpg
1237 0.16%29/Mar/05 09:40/rabbit-center/hayward_rescue/hayward_graphics/Toby_day1.JPG
1234 0.03%29/Mar/05 09:07/chapters/san-diego/adoption/Cages/Patio_setup_1.JPG
1228 0.04%29/Mar/05 09:07/chapters/san-diego/adoption/Cages/LeithPetwerks_condo.JPG
1225 0.02%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/colby r1423 03tiny.jpg
1220 0.02%29/Mar/05 09:52/graphics/fun/netbunnies/Rabbits5.jpg
1218 0.05%29/Mar/05 08:42/graphics/fun/netbunnies/Maggiechristmas-sandy1.jpg
1217 0.03%29/Mar/05 09:54/journal/3-8/head-tilt.html
1215 0.05%29/Mar/05 09:24/graphics/fun/netbunnies/Vicky-LilSweet1.jpg
1207 0.03%29/Mar/05 09:59/graphics/fun/netbunnies/barnie2-lee1.jpg
1202 0.03%29/Mar/05 09:51/graphics/fun/netbunnies/Paddington-Craddick1.jpg
1197 0.02%29/Mar/05 09:55/chapters/san-diego/diet/hay_grass.html
1196 0.03%29/Mar/05 09:40/graphics/fun/netbunnies/8-28-20.jpg
1184 0.08%29/Mar/05 08:58/graphics/fun/netbunnies/suki-1yr-rear-end.jpg
1177 0.03%29/Mar/05 09:45/graphics/fun/netbunnies/bunny-mirage1.jpg
1161 0.02%29/Mar/05 09:58/journal/3-3/age-related-behavior.html
1161 0.03%29/Mar/05 09:51/links/sections/rabbits.html
1155 0.02%29/Mar/05 08:48/graphics/easter/gold-egg.gif
1150 0.04%29/Mar/05 09:54/journal/3-11/graphics/pickup123.gif
1149 0.01%29/Mar/05 08:18/journal/2-7/chateau.html
1148 0.04%29/Mar/05 09:50/chapters/san-francisco/adoptables.html
1145 0.02%29/Mar/05 09:54/journal/3-11/graphics/pickup4.gif
1142 0.03%29/Mar/05 09:57/graphics/fun/netbunnies/spencer.jpg
1141 0.03%29/Mar/05 07:59/journal/3-9/graphics/mouth.gif
1140 0.02%29/Mar/05 09:10/journal/1/place-space-update.html
1140 0.03%29/Mar/05 09:47/graphics/fun/netbunnies/Baby_Honey-Simon1.jpg
1138 0.01%29/Mar/05 09:58/graphics/postcard/postmarked-stamp.jpg
1137 0.01%29/Mar/05 09:22/journal/3-6/play-ed.html
1136 0.03%29/Mar/05 09:56/graphics/fun/netbunnies/Beatrice-Pipkorn1.jpg
1127 0.01%29/Mar/05 09:41/journal/2-5/men-women-bunnies.html
1127 0.03%29/Mar/05 09:43/graphics/fun/netbunnies/WhoMe.jpg
1124 0.03%29/Mar/05 09:52/graphics/fun/netbunnies/BabySammy-Singleton1.jpg
1122 0.03%29/Mar/05 08:51/graphics/fun/netbunnies/SylviaXmas.jpg
1118 0.04%29/Mar/05 09:58/graphics/fun/netbunnies/arthur-lees1.jpg
1116 0.02%29/Mar/05 09:48/graphics/fun/netbunnies/blaze5-heldt1.jpg
1109 0.14%29/Mar/05 09:52/graphics/fun/netbunnies/bunnikins.jpg
1106 0.01%29/Mar/05 07:59/journal/3-1/graphics/herman.gif
1100 0.02%29/Mar/05 09:31/graphics/fun/netbunnies/HelenPeeps-Jones1.jpg
1095 0.02%29/Mar/05 09:44/journal/3-3/digestibility.html
1094 0.01%29/Mar/05 09:21/adoption/why-not-to-breed.html
1093 0.01%29/Mar/05 08:11/translations/japanese/
1092 0.06%29/Mar/05 09:46/graphics/fun/netbunnies/WABBIT-Wes1.jpg
1089 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/a1.jpg
1085 0.01%29/Mar/05 09:50/journal/4-5/bunny-rules.html
1083 0.02%29/Mar/05 07:48/graphics/fun/netbunnies/beezle-hayworth1.jpg
1082 0.03%29/Mar/05 09:56/graphics/fun/netbunnies/BunBun.jpg
1075 0.03%29/Mar/05 09:55/chapters/san-diego/diet/graphics/bermuda.jpg
1073 0.02%29/Mar/05 09:55/chapters/san-diego/diet/graphics/timothy.jpg
1073 0.02%29/Mar/05 09:54/graphics/fun/netbunnies/bunny4-spence1.jpg
1072 29/Mar/05 09:50/chapters/san-francisco/banner-small.gif
1072 0.02%29/Mar/05 09:55/chapters/san-diego/diet/graphics/oat.jpg
1068 0.02%29/Mar/05 09:55/chapters/san-diego/diet/graphics/alfalfa.jpg
1067 0.03%18/Mar/05 06:36/chapters/san-diego/adoption/Adoption_Photos/HRS_Kisser_3_Jun04.JPG
1065 0.02%27/Mar/05 20:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Donnie_April_3_Dec04.jpg
1065 0.01%29/Mar/05 09:59/chapters/san-francisco/graphics/adoptables/SF_Sparky_2_Feb05.jpg
1061 0.02%29/Mar/05 09:49/journal/3-2/e-cuniculi.html
1059 0.03%29/Mar/05 09:53/graphics/fun/netbunnies/killer-dodge1.jpg
1054 0.03%29/Mar/05 09:36/graphics/fun/netbunnies/BloopButt-Altitude1.jpg
1050 0.01%29/Mar/05 09:55/chapters/san-diego/diet/graphics/orchard_grass_small.jpg
1045 0.03%29/Mar/05 09:42/graphics/fun/netbunnies/Biscotto-Negro1.jpg
1036 0.01%29/Mar/05 09:24/chapters/san-diego/products/graphics/Harmony_Kingomd_TJ.jpg
1036 0.07%29/Mar/05 09:03/rabbit-center/hayward_rescue/hayward_graphics/whiterabbit.jpg
1036 0.18%18/Mar/05 00:21/chapters/san-diego/adoption/Adoption_Photos/HRS_Brandy_3_Jan05.jpg
1033 0.01%29/Mar/05 09:52/journal/3-8/graphics/head-tilt.gif
1031 0.01%29/Mar/05 09:49/adoption/hidden-cost-of-breeding.html
1030 0.03%29/Mar/05 09:04/graphics/fun/netbunnies/BallBall-Choi1.jpg
1029 0.02%29/Mar/05 07:59/graphics/fun/netbunnies/Bunny+Dog-Tsang1.jpg
1024 0.02%29/Mar/05 08:46/graphics/fun/netbunnies/bunny-brown1.jpg
1023 0.01%29/Mar/05 09:16/hrs-info/site-map.html
1018 0.17%27/Mar/05 19:57/chapters/san-diego/adoption/Adoption_Photos/HRS_Lacey_2_Jan05.jpg
1011 0.97%18/Mar/05 00:21/chapters/san-diego/adoption/Adoption_Photos/HRS_Donovan_4_Dec04.jpg
1010 0.05%29/Mar/05 08:45/graphics/fun/netbunnies/Ben-Trent1.jpg
1009 0.03%29/Mar/05 08:18/journal/2-7/graphics/iowa-house.gif
1008 0.02%29/Mar/05 09:17/chapters/san-diego/health/vet-talk/pasteurella.html
1005 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/Belle-Chase1.jpg
1003 0.01%29/Mar/05 09:47/care/litterbox.html
1000 0.02%29/Mar/05 09:59/graphics/fun/netbunnies/Chauncy2-Pop1.jpg
999 0.03%29/Mar/05 09:48/graphics/fun/netbunnies/clover-conley1.jpg
998 0.03%29/Mar/05 09:15/graphics/fun/netbunnies/smidgen-morris1.jpg
997 0.02%29/Mar/05 09:49/chapters/san-diego/adoption/graphics/JulieJessica3-333-250.jpg
996 0.02%29/Mar/05 09:51/graphics/fun/netbunnies/Bub&Pink-Ervin1.jpg
994 0.01%29/Mar/05 08:34/journal/2-8/eye-problems.html
988 0.03%29/Mar/05 09:49/chapters/san-diego/adoption/new_zealand_white.html
980 0.02%29/Mar/05 09:37/graphics/fun/netbunnies/Spots.jpg
979 0.02%29/Mar/05 09:07/graphics/fun/netbunnies/funny.jpg
979 0.01%29/Mar/05 09:39/graphics/fun/netbunnies/FlyingBunny-Krissy1.jpg
976 0.02%29/Mar/05 09:47/journal/4-7/love-goes-on.html
970 0.01%29/Mar/05 09:49/care/medical-leads.html
969 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/babyschmoo-Gadsby1.jpg
967 0.01%27/Mar/05 19:33/chapters/san-diego/adoption/Adoption_Photos/HRS_Harley_Dec04.jpg
966 0.02%29/Mar/05 09:40/journal/3-7/gi.html
965 0.06%29/Mar/05 09:02/graphics/fun/netbunnies/Buddy1-Lepage1.jpg
963 0.02%29/Mar/05 09:51/graphics/fun/netbunnies/Mister-Mizzrizz1.jpg
953 0.02%29/Mar/05 09:29/journal/3-4/marriage.html
950 0.02%29/Mar/05 08:02/journal/3-10/graphics/rabbit-class.gif
947 0.02%29/Mar/05 09:37/graphics/fun/netbunnies/baby-sweetpea.jpg
947 0.01%29/Mar/05 08:32/adoption/right-person.html
946 0.03%29/Mar/05 09:19/graphics/fun/netbunnies/ailey _work1.jpg
945 0.03%29/Mar/05 09:11/graphics/postcard/lavender.jpg
945 0.02%29/Mar/05 09:44/graphics/fun/netbunnies/BoboIndy-Niemi1.jpg
944 0.01%29/Mar/05 09:29/journal/1/cage-manufacturers.html
939 0.02%29/Mar/05 09:52/faq/sections/medicating.html
938 0.05%29/Mar/05 08:51/graphics/fun/netbunnies/BubbaPinky-Ervin1.jpg
936 29/Mar/05 09:51/chapters/san-francisco/graphics/logo-footer.gif
934 0.04%29/Mar/05 09:51/graphics/fun/netbunnies/BunniesBasket-Krissy1.jpg
933 0.04%29/Mar/05 09:52/graphics/fun/netbunnies/herman-black-marks-gordon.jpg
932 0.05%29/Mar/05 09:58/graphics/fun/netbunnies/beachingbunnieshenriettahon.jpg
931 0.03%29/Mar/05 09:40/graphics/fun/netbunnies/butterbean2-vegton1.jpg
929 0.02%29/Mar/05 09:53/journal/3-11/rabbits-teaching-rabbits.html
927 0.03%29/Mar/05 04:19/graphics/fun/netbunnies/fluff-kraina1.jpg
926 0.02%29/Mar/05 09:59/journal/3-2/bridging-com-gaps.html
925 0.02%29/Mar/05 09:26/journal/3-3/fiber.html
925 0.05%29/Mar/05 09:06/graphics/fun/netbunnies/Buddy2-Lepage1.jpg
922 0.01%29/Mar/05 09:35/journal/2-2/mean-rabbit.html
922 0.02%29/Mar/05 09:29/graphics/fun/netbunnies/Pandora-Burrascano1.jpg
921 0.04%29/Mar/05 09:50/graphics/fun/netbunnies/Buddy-Rowan1.jpg
921 0.02%29/Mar/05 09:33/faq/sections/classroom.html
919 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/b31997.jpg
916 0.04%29/Mar/05 09:58/graphics/fun/netbunnies/Bunny2-Hough1.jpg
915 0.02%29/Mar/05 09:42/graphics/fun/netbunnies/chopper-Raymond1.jpg
914 0.01%29/Mar/05 09:03/rabbit-center/hayward_rescue/hayward_graphics/rabbit.jpg
913 0.07%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_nicolas1.jpg
911 0.11%29/Mar/05 09:52/faq/faq.txt
910 0.02%29/Mar/05 09:21/graphics/fun/netbunnies/Choco.jpg
909 0.02%29/Mar/05 09:30/graphics/fun/netbunnies/misha-tarling1.jpg
906 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/rabbit2-weinberg1.jpg
906 0.04%29/Mar/05 09:47/graphics/fun/netbunnies/BunBun-Kelly1.jpg
905 0.01%29/Mar/05 09:16/faq/sections/intro.html
904 0.08%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_nicolas2.jpg
904 29/Mar/05 09:50/chapters/san-francisco/adoptables.gif
903 0.03%29/Mar/05 01:26/graphics/fun/netbunnies/Bunnies02.jpg
902 0.03%29/Mar/05 09:29/graphics/fun/netbunnies/Bugsi-bc1.jpg
902 0.01%29/Mar/05 08:41/journal/3-5/like-a-rabbit.html
900 0.03%29/Mar/05 09:03/graphics/fun/netbunnies/Chuck&Reeses-Goldsmith1.jpg
900 0.01%29/Mar/05 09:53/journal/2-7/bringing-baby-home.html
900 0.02%29/Mar/05 09:19/chapters/san-diego/health/vet-talk/spay_neuter.html
897 0.01%29/Mar/05 09:24/chapters/san-diego/products/
894 0.01%29/Mar/05 09:01/graphics/fun/netbunnies/Bun-hahn1.jpg
894 0.01%29/Mar/05 09:55/care/vets-uncovered-regions.txt
892 0.02%29/Mar/05 09:21/graphics/fun/netbunnies/Bunny-Mbhjch1.jpg
892 0.02%29/Mar/05 01:24/graphics/fun/netbunnies/emmett-erin1.jpg
892 0.04%29/Mar/05 08:36/graphics/fun/netbunnies/Bunnies-Catmichel1.jpg
890 0.05%29/Mar/05 09:40/rabbit-center/hayward_rescue/witness_statements.html
886 0.01%29/Mar/05 09:50/chapters/san-diego/behavior/litterbox_setup.html
886 0.01%29/Mar/05 09:19/care/bibliography.html
886 0.03%29/Mar/05 09:45/graphics/fun/netbunnies/bucky-schaffer1.jpg
886 0.02%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_Emily_2_Feb05.jpg
884 0.01%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_Emily_1_FEb05.jpg
883 0.01%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_Chloe_Chelsea_1_Feb05.jpg
880 29/Mar/05 09:54/graphics/books/stuparyk_small.jpg
878 0.02%29/Mar/05 09:43/graphics/fun/netbunnies/buns-zen1.jpg
877 0.02%29/Mar/05 09:16/graphics/fun/netbunnies/rabbits-sukiennik1.jpg
876 0.03%29/Mar/05 09:32/graphics/fun/netbunnies/Bunny3-Hough1.jpg
875 0.03%29/Mar/05 09:24/graphics/fun/netbunnies/miska-funcic1.jpg
875 0.02%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/Chloe_Chelsea_1_Dec04.jpg
874 0.02%29/Mar/05 09:53/graphics/fun/netbunnies/bubbles-wilkinson1.jpg
872 0.01%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_Nooman_2_Feb05.jpg
871 0.02%29/Mar/05 06:50/graphics/fun/netbunnies/babies-chickermane1.jpg
871 0.07%29/Mar/05 07:34/graphics/fun/netbunnies/brown-rabbit-bricks2.jpg
870 0.03%29/Mar/05 09:25/graphics/fun/netbunnies/sedona-shopping.jpg
870 0.01%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_Chloe_Chelsea_2_Feb05.jpg
869 0.01%29/Mar/05 09:31/graphics/fun/netbunnies/CaesarSleeping-Dawn1.jpg
868 0.01%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_Rocky_1_Feb05.jpg
868 0.01%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_Nooman_1_Feb05.jpg
866 0.04%29/Mar/05 08:33/graphics/fun/netbunnies/yoshi-strope1.jpg
866 0.01%29/Mar/05 09:46/graphics/fun/netbunnies/ShadowToSend.jpg
865 0.04%29/Mar/05 09:52/graphics/fun/netbunnies/Stndprty-RustyBux1.jpg
860 0.01%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_Rocky_2_Feb05.jpg
859 0.03%29/Mar/05 09:46/graphics/fun/netbunnies/SmellyPiglet2-Lam1.jpg
859 0.02%29/Mar/05 07:59/graphics/fun/netbunnies/Cadbury-Beckemeyer1.jpg
857 0.01%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/Harley_Jan05.jpg
857 0.10%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_Mo_2_Mar04.JPG
857 0.09%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_Mo_1_Mar04.JPG
855 0.01%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_Frankie_1_FEb05.jpg
854 0.01%29/Mar/05 09:55/graphics/fun/netbunnies/fosterbun-cvetan1.jpg
854 0.01%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_Frankie_2_Feb05.jpg
853 0.02%29/Mar/05 09:41/graphics/fun/netbunnies/hermione2-tourret1.jpg
852 0.02%29/Mar/05 09:54/links/sections/books.html
852 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/Heaven-Sent.jpg
852 0.02%29/Mar/05 09:47/graphics/fun/netbunnies/luna-lynne1.jpg
851 0.02%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_delilah_1_dec04.jpg
851 0.03%29/Mar/05 08:23/graphics/fun/netbunnies/Bunny2-Emig1.jpg
850 0.02%29/Mar/05 09:49/graphics/fun/netbunnies/Bunny-Sepesy1.jpg
850 0.02%29/Mar/05 08:48/journal/3-4/pellet-info.html
849 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/poppy.jpg
849 0.07%29/Mar/05 09:24/graphics/fun/netbunnies/aggie-hare-tortoise-hadawi.jpg
849 0.02%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_delilah_2_dec04.jpg
849 0.02%29/Mar/05 09:37/graphics/fun/netbunnies/alien-tenma1.jpg
848 0.01%29/Mar/05 08:42/journal/1/aloof.html
848 0.02%29/Mar/05 09:54/graphics/fun/netbunnies/makandaun.jpg
848 0.01%29/Mar/05 09:49/chapters/san-diego/adoption/graphics/Skye_sofa.jpg
848 0.01%29/Mar/05 09:39/graphics/fun/netbunnies/george-julie1.jpg
846 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/cinnamon-Cathy1.jpg
845 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/bunny4-ButlerClarke1.jpg
845 0.03%29/Mar/05 09:05/graphics/fun/netbunnies/simmie1-ang1.jpg
844 0.02%29/Mar/05 09:39/graphics/fun/netbunnies/hawaiibest-caulders1.jpg
842 0.02%29/Mar/05 09:02/graphics/fun/netbunnies/elliot2-cote1.jpg
842 0.04%29/Mar/05 09:35/graphics/fun/netbunnies/Chippers-McConville1.jpg
841 0.04%29/Mar/05 06:37/graphics/fun/netbunnies/bunny-barry1.jpg
840 0.01%29/Mar/05 09:49/journal/3-2/graphics/health-2.gif
840 0.01%29/Mar/05 09:06/graphics/fun/netbunnies/pixie-chiu1.jpg
839 0.02%29/Mar/05 08:30/graphics/fun/netbunnies/flurrymax-french1.jpg
839 0.02%29/Mar/05 09:58/chapters/san-diego/behavior/dothat.html
838 0.04%29/Mar/05 06:49/graphics/fun/netbunnies/bunnyinbox-Leatherdale1.jpg
838 0.06%29/Mar/05 09:35/graphics/fun/netbunnies/fifi-gray-lop-lying.jpg
838 0.01%29/Mar/05 07:55/graphics/fun/netbunnies/Caesar-Curtis1.jpg
838 0.02%29/Mar/05 07:54/chapters/san-diego/adoption/Adoption_Photos/HRS_Oreo_2_2Nov03.JPG
837 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/bunnybegging-eng1.jpg
837 0.01%29/Mar/05 09:49/journal/2-12/tools-of-the-trade.html
834 0.02%29/Mar/05 09:02/graphics/fun/netbunnies/Cbunny-Easteregg1.jpg
833 0.04%29/Mar/05 09:13/graphics/fun/netbunnies/ericrags3.jpg
833 0.01%29/Mar/05 09:48/opinion/fur.html
832 0.02%29/Mar/05 08:42/graphics/fun/netbunnies/missey-rogers1.jpg
831 0.02%29/Mar/05 09:32/faq/sections/rescue.html
831 0.01%29/Mar/05 09:37/journal/3-5/bladder-disease.html
830 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/owen3-victoria1.jpg
829 0.02%29/Mar/05 09:34/graphics/fun/netbunnies/ozzy3-jodi1.jpg
828 0.02%29/Mar/05 09:54/graphics/fun/netbunnies/buns3-schnellbach1.jpg
827 0.01%29/Mar/05 06:49/graphics/fun/netbunnies/bunboy-smith1.jpg
827 0.09%29/Mar/05 09:49/chapters/san-diego/adoption/graphics/Gayon_Adoption.JPG
826 0.01%29/Mar/05 08:53/graphics/fun/netbunnies/sage2.jpg
826 0.03%29/Mar/05 05:51/graphics/fun/netbunnies/rabbits3-reeves1.jpg
826 0.01%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/0203_triston.jpg
825 0.03%29/Mar/05 09:38/graphics/fun/netbunnies/haylee-imboden1.jpg
825 0.04%29/Mar/05 09:46/graphics/fun/netbunnies/suki-gray-strectched-out.jpg
825 0.01%29/Mar/05 08:59/graphics/fun/netbunnies/zoe-ffitch1.jpg
824 0.03%29/Mar/05 09:46/graphics/fun/netbunnies/wabbitthewefugee.jpg
823 0.02%29/Mar/05 08:57/graphics/fun/netbunnies/rabbit-a-spence1.jpg
823 0.04%29/Mar/05 09:57/graphics/fun/netbunnies/lopingrass.jpg
823 0.01%29/Mar/05 08:46/graphics/fun/netbunnies/rabbits5-reeves1.jpg
822 0.02%29/Mar/05 09:49/graphics/fun/netbunnies/checkers-tolle1.jpg
822 0.01%29/Mar/05 08:02/journal/3-10/classroom.html
822 0.01%29/Mar/05 09:44/care/pasteurella.html
822 0.02%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_Merry_Pippen_1_Dec04.jpg
822 0.01%29/Mar/05 09:51/graphics/fun/netbunnies/mattboo-Carlson1.jpg
821 0.01%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_Merry_Pippen_2_Dec04.jpg
821 0.02%29/Mar/05 09:54/graphics/fun/netbunnies/oreo-angela1.jpg
821 0.01%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/feb02/molly1.jpg
821 0.01%29/Mar/05 09:06/graphics/fun/netbunnies/poppy8-marcia1.jpg
820 0.03%29/Mar/05 09:55/graphics/fun/netbunnies/thumper-gynn1.jpg
819 0.02%29/Mar/05 09:45/graphics/fun/netbunnies/CottonFeedcloseup1.jpg
818 0.01%29/Mar/05 07:21/graphics/fun/netbunnies/tabitha2-leung1.jpg
818 0.02%29/Mar/05 09:33/graphics/fun/netbunnies/DSC00008.jpg
816 0.10%29/Mar/05 09:49/chapters/san-diego/adoption/graphics/Norm_BradyKids_10Nov01_1.JPG
816 0.01%29/Mar/05 06:56/graphics/fun/netbunnies/bunbun1-chelsey1.jpg
815 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/pete-guzman1.jpg
814 0.02%29/Mar/05 09:28/graphics/fun/netbunnies/bunny-fischer1.jpg
814 0.02%29/Mar/05 07:56/graphics/fun/netbunnies/Cbunny2-Easteregg1.jpg
813 0.01%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/feb02/sabrina.jpg
813 0.01%29/Mar/05 09:36/chapters/san-diego/health/poisonous.html
813 0.02%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/Aug02/SF_Heidi_Molly_3_Jul02.JPG
813 0.01%29/Mar/05 09:29/graphics/fun/netbunnies/frenchy+maybe-lorian1.jpg
812 0.05%29/Mar/05 09:39/rabbit-center/hayward_rescue/hayward_graphics/hayward_bunnies_1.jpg
812 0.03%29/Mar/05 07:07/graphics/fun/netbunnies/freddy-lalonde1.jpg
812 0.11%29/Mar/05 09:51/chapters/san-francisco/graphics/adoptables/SF_Maurice_1_Feb05.jpg
812 0.01%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_Lucy-2_Feb05.jpg
812 0.01%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/Aug02/SF_Heidi_Molly_2_Jul02.JPG
811 0.02%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/Aug02/SF_Heidi_Molly_Jul02.JPG
811 0.02%29/Mar/05 09:16/graphics/fun/netbunnies/biscuit.jpg
810 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/andrewsammy-prince1.jpg
810 0.02%29/Mar/05 09:29/graphics/fun/netbunnies/snowball-Veres1.jpg
810 0.02%29/Mar/05 06:37/graphics/fun/netbunnies/rockey1-kirk1.jpg
810 0.01%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_Lucy_1_Feb05.jpg
809 0.02%29/Mar/05 09:51/graphics/fun/netbunnies/FIONA-Primrose1.jpg
809 0.02%29/Mar/05 09:48/graphics/fun/netbunnies/tywla-lummels1.jpg
809 0.03%29/Mar/05 09:50/graphics/fun/netbunnies/riley1-charisemaria1.jpg
809 0.01%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_Higgins_1_Feb05.jpg
808 0.02%29/Mar/05 09:56/graphics/fun/netbunnies/baby-Jalasco1.jpg
808 0.02%29/Mar/05 07:58/graphics/fun/netbunnies/Clive&Fletch-Kleback1.jpg
808 0.01%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_Higgins_2_Feb05.jpg
807 0.01%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/feb02/molly2.jpg
807 0.05%29/Mar/05 09:56/graphics/fun/netbunnies/kidschris1-Hunt1.jpg
807 0.03%29/Mar/05 09:53/graphics/fun/netbunnies/NIJNTJE-Alewin1.jpg
806 0.03%29/Mar/05 09:24/graphics/fun/netbunnies/Bunny4-Hough1.jpg
805 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/casey&min-Cathy1.jpg
804 29/Mar/05 06:08/graphics/fun/netbunnies/scooter-hawthorne1.jpg
803 0.01%29/Mar/05 09:51/graphics/fun/netbunnies/Cal2-727-1.jpg
803 0.01%29/Mar/05 09:49/easter/help.html
802 0.01%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_Albert_1_Feb05.jpg
800 0.01%29/Mar/05 09:51/chapters/san-francisco/graphics/adoptables/SF_Sparky_1_Feb05.jpg
800 0.08%29/Mar/05 09:51/chapters/san-francisco/graphics/adoptables/SF_Maurice_2_Feb05.jpg
798 0.01%29/Mar/05 09:37/graphics/fun/netbunnies/ginger1-leen1.jpg
798 0.01%29/Mar/05 09:51/chapters/san-francisco/graphics/adoptables/SF_Amelie_2_Feb05.jpg
798 29/Mar/05 09:50/graphics/banners/banner-m.gif
798 0.01%29/Mar/05 09:50/chapters/san-francisco/graphics/adoptables/SF_Albert_2_FEb05.jpg
798 0.11%29/Mar/05 09:58/chapters/san-diego/behavior/graphics/fresh_hay.JPG
797 0.05%29/Mar/05 09:58/chapters/san-diego/behavior/graphics/large_catpan.JPG
797 0.01%29/Mar/05 08:48/chapters/san-diego/aboutus/bunnyfest/bunnyfest_2003_photos.html
797 0.01%29/Mar/05 09:49/journal/3-2/graphics/health-1.gif
796 0.02%29/Mar/05 09:51/chapters/san-francisco/graphics/adoptables/0103_amelie.jpg
795 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/DSC00002.jpg
795 0.01%29/Mar/05 09:58/chapters/san-diego/behavior/graphics/medium_catpan.JPG
795 0.03%29/Mar/05 09:58/graphics/fun/netbunnies/CHIP1-Rappold1.jpg
794 0.01%29/Mar/05 09:51/chapters/san-francisco/graphics/adoptables/SF_Amelie_1_Feb05.jpg
794 0.02%29/Mar/05 08:43/graphics/fun/netbunnies/cherrios-miller1.jpg
794 0.05%29/Mar/05 08:52/graphics/fun/netbunnies/Diggler-Wilkinson1.jpg
793 0.01%29/Mar/05 09:49/graphics/fun/netbunnies/snowball-gitter1.jpg
793 0.03%29/Mar/05 09:31/graphics/fun/netbunnies/ChuChu1-Choi1.jpg
793 0.01%29/Mar/05 09:40/rabbit-center/hayward_rescue/whiterabbit.jpg
792 0.04%29/Mar/05 06:37/graphics/fun/netbunnies/Cappuccino-Philips1.jpg
792 0.02%29/Mar/05 09:14/graphics/fun/netbunnies/EasterBenny-Scollo1.jpg
791 0.01%29/Mar/05 09:58/chapters/san-diego/behavior/graphics/giant_catpan.JPG
790 0.06%29/Mar/05 09:51/chapters/san-francisco/graphics/adoptables/11/AUT_3094.JPG
790 0.04%29/Mar/05 09:40/graphics/fun/netbunnies/snoopy-gurpz1.jpg
789 0.02%29/Mar/05 09:41/graphics/fun/netbunnies/Dggler2-Wilkinson1.jpg
788 0.06%29/Mar/05 09:51/chapters/san-francisco/graphics/adoptables/11/AUT_3100.JPG
787 0.01%29/Mar/05 07:04/graphics/fun/netbunnies/DSC00007.jpg
786 0.01%29/Mar/05 06:19/graphics/fun/netbunnies/kissmeliss-ndren1.jpg
785 0.02%29/Mar/05 09:13/graphics/fun/netbunnies/chercat-camelot1.jpg
785 0.03%29/Mar/05 09:24/graphics/fun/netbunnies/Cj-mika1.jpg
785 0.01%29/Mar/05 09:58/chapters/san-diego/behavior/graphics/fresh_cf.JPG
785 0.02%29/Mar/05 09:54/graphics/fun/netbunnies/Flip.jpg
785 0.02%29/Mar/05 02:58/graphics/fun/netbunnies/benny-appilini1.jpg
785 0.03%29/Mar/05 09:39/graphics/fun/netbunnies/Penelope 2-Jones1.jpg
784 0.04%29/Mar/05 09:40/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_2.JPG
783 0.04%29/Mar/05 09:40/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_9.jpg
782 0.02%29/Mar/05 09:49/graphics/fun/netbunnies/Feather-Pratt1.jpg
782 0.02%29/Mar/05 09:58/chapters/san-diego/behavior/graphics/used_litterbox.JPG
781 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/hugo-gruneberg1.jpg
781 0.01%29/Mar/05 09:51/chapters/san-francisco/graphics/adoptables/SF_Corky_2_Feb05.jpg
781 0.01%29/Mar/05 09:51/chapters/san-francisco/graphics/adoptables/SF_Corky_1_Feb05.jpg
781 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/Penelope-Jones1.jpg
780 0.03%29/Mar/05 09:40/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_4.jpg
779 0.01%29/Mar/05 09:19/graphics/fun/netbunnies/Hasi2.jpg
778 0.03%29/Mar/05 09:40/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_3.jpg
777 0.01%29/Mar/05 09:53/journal/3-11/graphics/2by-crate-gate.gif
777 0.04%29/Mar/05 09:37/graphics/fun/netbunnies/bunny-sentient1.jpg
777 0.10%29/Mar/05 09:40/graphics/fun/netbunnies/fuzzy-lop-outside-lowe.jpg
777 0.02%29/Mar/05 09:37/graphics/fun/netbunnies/spikebruiser1-hounsell1.jpg
777 0.01%29/Mar/05 08:27/graphics/fun/netbunnies/tabitha-leung1.jpg
776 0.01%29/Mar/05 09:40/rabbit-center/hayward_rescue/hayward_graphics/Ubu_day1.JPG
776 0.01%29/Mar/05 09:53/journal/3-11/graphics/one-in-one-out-crate.gif
776 0.01%29/Mar/05 08:41/journal/3-5/graphics/two-in-hole.gif
776 0.03%29/Mar/05 08:52/graphics/fun/netbunnies/saule-kat1.jpg
775 0.02%29/Mar/05 08:00/graphics/fun/netbunnies/dandy-jenny1.jpg
775 0.01%29/Mar/05 09:51/chapters/san-francisco/graphics/adoptables/SF_Bennet_1_Feb05.jpg
774 0.01%29/Mar/05 09:39/rabbit-center/hayward_rescue/hayward_rabbits_media-alert.html
774 0.04%29/Mar/05 09:03/graphics/fun/netbunnies/buns_family.jpg
773 0.03%29/Mar/05 08:45/graphics/fun/netbunnies/millicent-steve2-ha1.jpg
773 0.01%29/Mar/05 09:51/chapters/san-francisco/graphics/adoptables/feb02/jeremy2.jpg
773 0.02%29/Mar/05 09:28/graphics/fun/netbunnies/chloe-odell1.jpg
772 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/Rabbit-Flanagan1.jpg
772 0.01%29/Mar/05 09:51/chapters/san-francisco/graphics/adoptables/Aug02/SF_Milo_Corey_Jul02.JPG
772 0.01%29/Mar/05 09:51/chapters/san-francisco/graphics/adoptables/SF_Bennet_2_Feb05.jpg
771 0.01%29/Mar/05 09:16/graphics/fun/netbunnies/chaos-brammer1.jpg
771 0.05%29/Mar/05 09:40/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_10.jpg
771 0.02%29/Mar/05 09:55/graphics/fun/netbunnies/jess2.jpg
770 0.03%29/Mar/05 08:02/graphics/fun/netbunnies/nyuszo-zsuzsanna1.jpg
770 0.01%29/Mar/05 09:51/chapters/san-francisco/graphics/adoptables/feb02/jeremy.jpg
770 0.01%29/Mar/05 09:53/journal/3-11/graphics/peering-above-crate.gif
769 0.02%29/Mar/05 09:39/graphics/fun/netbunnies/DSC00005.jpg
768 0.01%29/Mar/05 09:53/journal/2-7/graphics/photo-page-1.gif
768 0.02%29/Mar/05 09:56/graphics/fun/netbunnies/rabbits1-szmoon1.jpg
768 0.02%29/Mar/05 09:35/graphics/fun/netbunnies/EasterBennyScollo1.jpg
768 0.04%29/Mar/05 09:40/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_6.jpg
767 0.01%29/Mar/05 09:53/journal/3-11/graphics/looking-in-crate.gif
767 0.01%29/Mar/05 09:51/chapters/san-francisco/graphics/adoptables/SF_Chubby_Feb05.jpg
767 0.01%29/Mar/05 08:49/graphics/fun/netbunnies/pyawns.jpg
767 0.04%29/Mar/05 09:46/graphics/fun/netbunnies/Flopsy-Pielady1.jpg
766 0.04%29/Mar/05 09:40/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_7.jpg
766 0.04%29/Mar/05 09:14/graphics/fun/netbunnies/whitelopandtoilet.jpg
765 0.01%29/Mar/05 09:51/chapters/san-francisco/graphics/adoptables/SF_Amelia_2_Feb05.jpg
765 0.01%29/Mar/05 09:51/chapters/san-francisco/graphics/adoptables/SF_Amelia_1_Feb05.jpg
765 0.02%28/Mar/05 22:15/graphics/fun/netbunnies/Starbunny-Quatre1.jpg
765 0.03%29/Mar/05 09:02/graphics/fun/netbunnies/Chuck-Goldsmith1.jpg
764 0.01%29/Mar/05 09:41/graphics/fun/netbunnies/foozle-singleton1.jpg
764 0.02%29/Mar/05 08:33/graphics/fun/netbunnies/uyy-holden1.jpg
762 0.01%29/Mar/05 06:20/graphics/fun/netbunnies/FoofSanta-Williford1.jpg
761 0.02%29/Mar/05 08:27/graphics/fun/netbunnies/Daisy5-Daniels1.jpg
761 0.04%29/Mar/05 09:51/graphics/fun/netbunnies/Lyla-Stairs1.jpg
761 0.02%29/Mar/05 09:40/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_11.jpg
761 0.03%29/Mar/05 09:29/graphics/fun/netbunnies/thumper-knorr1.jpg
760 0.04%29/Mar/05 09:16/graphics/fun/netbunnies/Dcp67099.jpg
760 0.03%29/Mar/05 07:26/graphics/fun/netbunnies/panda-rudd1.jpg
760 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/Dexter-Ambear1.jpg
760 0.02%29/Mar/05 08:53/graphics/fun/netbunnies/snowflake-Destiny1.jpg
760 0.03%29/Mar/05 09:18/graphics/fun/netbunnies/Izzy+Alley-habermehl1.jpg
758 0.01%29/Mar/05 08:18/graphics/fun/netbunnies/molly-cathey1.jpg
757 0.05%29/Mar/05 09:28/graphics/fun/netbunnies/Duke-Rowan1.jpg
757 0.02%29/Mar/05 08:32/graphics/fun/netbunnies/fuzzy-link1.jpg
757 0.04%29/Mar/05 08:33/graphics/fun/netbunnies/henrybumble-smith1.jpg
757 0.02%29/Mar/05 09:29/graphics/fun/netbunnies/FoobarNoofFriend-Yoshioka1.jpg
756 0.04%29/Mar/05 09:02/graphics/fun/netbunnies/robbie1-oneal1.jpg
756 0.02%29/Mar/05 09:05/graphics/fun/netbunnies/tashi-mypetsrule1.jpg
755 0.01%29/Mar/05 09:26/journal/3-3/graphics/fiber.gif
754 0.03%29/Mar/05 09:38/graphics/fun/netbunnies/bunnies1-prairie1.jpg
754 29/Mar/05 09:40/rabbit-center/hayward_rescue/rabbit.jpg
751 0.03%29/Mar/05 09:38/graphics/fun/netbunnies/Cuddles-Barker1.jpg
750 0.03%29/Mar/05 09:38/graphics/fun/netbunnies/Demolition+Rabbit-Tandem1.jpg
750 0.04%29/Mar/05 09:07/graphics/fun/netbunnies/cinderella-spotty1.jpg
750 0.02%29/Mar/05 09:51/graphics/fun/netbunnies/Hera y demes-Maria1.jpg
748 0.01%29/Mar/05 09:48/graphics/fun/netbunnies/bunbun-whoknows1.jpg
748 0.02%29/Mar/05 09:28/graphics/fun/netbunnies/willow3-bowser1.jpg
748 0.01%29/Mar/05 09:19/graphics/fun/netbunnies/tinker-heinsma1.jpg
746 0.03%29/Mar/05 09:39/graphics/fun/netbunnies/Gang.jpg
746 0.02%29/Mar/05 08:44/graphics/fun/netbunnies/Loli1-lo1.jpg
746 29/Mar/05 09:40/rabbit-center/hayward_rescue/clip_image023.gif
744 0.03%29/Mar/05 09:37/graphics/fun/netbunnies/Image05.jpg
743 0.01%29/Mar/05 08:11/rescue/
742 0.02%29/Mar/05 09:52/graphics/fun/netbunnies/Samson-Yong1.jpg
742 0.02%29/Mar/05 09:15/graphics/fun/netbunnies/Leinie-Chloe2.jpg
742 0.03%29/Mar/05 09:17/graphics/fun/netbunnies/Lacey-Pierce1.jpg
741 0.02%29/Mar/05 09:36/graphics/fun/netbunnies/Dcp67101.jpg
741 0.01%29/Mar/05 09:39/journal/3-7/graphics/gi-tract-ill.gif
741 0.02%29/Mar/05 09:29/graphics/fun/netbunnies/bruno+leah1-nancy1.jpg
740 0.02%29/Mar/05 09:03/graphics/fun/netbunnies/GIZMO.jpg
740 0.02%29/Mar/05 08:55/graphics/fun/netbunnies/zumi-peterson1.jpg
739 0.11%29/Mar/05 09:50/chapters/san-diego/behavior/graphics/p3130003.jpg
739 0.02%29/Mar/05 09:49/graphics/fun/netbunnies/LOVEBUNS-Coopers1.jpg
739 0.01%29/Mar/05 09:50/graphics/fun/netbunnies/flopsy-lane1.jpg
737 0.03%29/Mar/05 09:52/graphics/fun/netbunnies/Dscf0005copia.jpg
737 0.02%29/Mar/05 09:31/graphics/fun/netbunnies/fuzzy_harley4-ko1.jpg
735 0.03%29/Mar/05 04:13/graphics/fun/netbunnies/HoneyBox-Melanson1.jpg
735 0.02%29/Mar/05 08:44/graphics/fun/netbunnies/barney-bunny2.jpg
735 0.01%29/Mar/05 09:54/graphics/fun/netbunnies/merlin+panda2-holly1.jpg
734 0.02%29/Mar/05 09:50/chapters/san-diego/behavior/graphics/CF_hay.JPG
734 0.02%29/Mar/05 09:04/graphics/fun/netbunnies/gilligan-riso1.jpg
733 0.03%29/Mar/05 01:57/graphics/fun/netbunnies/Tim-Oathay1.jpg
732 0.01%29/Mar/05 09:49/chapters/san-diego/adoption/uh-oh.jpg
732 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/bunna-jca1.jpg
731 0.02%29/Mar/05 09:52/graphics/fun/netbunnies/arwyn-brighten1.jpg
730 0.02%29/Mar/05 09:43/graphics/fun/netbunnies/Mvc-012s.jpg
730 0.03%29/Mar/05 08:48/graphics/fun/netbunnies/arthur1-holden1.jpg
730 0.02%29/Mar/05 09:44/graphics/fun/netbunnies/jack2-Hir1.jpg
729 0.01%29/Mar/05 09:58/graphics/fun/netbunnies/DSC00024.jpg
729 0.03%29/Mar/05 09:14/graphics/fun/netbunnies/Hermione-Desjeunes1.jpg
729 0.02%29/Mar/05 09:00/graphics/fun/netbunnies/Kobe-Sumner1.jpg
729 0.04%29/Mar/05 09:34/graphics/fun/netbunnies/clover-smith1.jpg
729 0.01%29/Mar/05 09:57/graphics/fun/netbunnies/murphy-intelligoth1.jpg
727 0.03%29/Mar/05 09:09/graphics/fun/netbunnies/creepy 11-khas1.jpg
727 0.02%29/Mar/05 09:51/graphics/fun/netbunnies/bob+parsley-hill1.jpg
726 0.01%29/Mar/05 09:48/journal/3-11/scuts.html
726 0.02%29/Mar/05 09:52/graphics/fun/netbunnies/bunnybag3-rott1.jpg
726 0.04%29/Mar/05 09:55/graphics/fun/netbunnies/Rab1.jpg
726 0.07%29/Mar/05 09:50/chapters/san-diego/behavior/graphics/pa140024.jpg
726 0.01%29/Mar/05 09:39/graphics/fun/netbunnies/jasper-stein1.jpg
725 0.03%29/Mar/05 08:52/graphics/fun/netbunnies/Snuggypants-Yoder1.jpg
725 0.02%29/Mar/05 09:51/graphics/fun/netbunnies/garth-robinson1.jpg
725 0.01%29/Mar/05 09:38/graphics/fun/netbunnies/Grey-Pratt1.jpg
724 0.03%29/Mar/05 09:57/graphics/fun/netbunnies/my bunnies-sukiennik1.jpg
724 0.01%29/Mar/05 08:47/graphics/fun/netbunnies/rabbit-rodriguez1.jpg
724 0.01%29/Mar/05 09:50/care/recipes.html
724 0.02%29/Mar/05 09:32/graphics/fun/netbunnies/rags-standen1.jpg
723 0.07%29/Mar/05 09:03/graphics/fun/netbunnies/brown-rabbit-bricks.jpg
722 0.02%29/Mar/05 09:56/graphics/fun/netbunnies/buddies-broley1.jpg
722 0.02%29/Mar/05 09:37/graphics/fun/netbunnies/floppy-isabelle1.jpg
721 0.01%29/Mar/05 09:49/chapters/san-diego/adoption/Adoption_Photos/HRS_Molly_3_25Mar03.JPG
720 0.02%29/Mar/05 08:58/graphics/fun/netbunnies/belle-torgomama1.jpg
720 0.03%29/Mar/05 08:29/graphics/fun/netbunnies/toby-penney1.jpg
720 0.03%29/Mar/05 09:50/graphics/fun/netbunnies/bunnies3-schroeder1.jpg
720 0.01%29/Mar/05 09:57/graphics/fun/netbunnies/Lau1.jpg
719 0.03%29/Mar/05 09:57/graphics/fun/netbunnies/zorro-hos1.jpg
719 29/Mar/05 08:55/rabbit-center/lucky/luckyphotos.htm
718 0.01%29/Mar/05 09:39/graphics/fun/netbunnies/Lucek3-Anna1.jpg
718 0.01%29/Mar/05 08:59/rabbit-center/events.html
717 0.02%29/Mar/05 09:56/graphics/fun/netbunnies/moneybunny-anderson1.jpg
717 0.01%29/Mar/05 09:55/rabbit-center/news_release/
717 0.01%29/Mar/05 09:45/graphics/fun/netbunnies/KlemmyInTheBag.jpg
716 0.01%29/Mar/05 09:04/graphics/fun/netbunnies/Errol-su1.jpg
716 0.08%29/Mar/05 09:53/graphics/fun/netbunnies/brown-rabbit-bricks3.jpg
716 0.02%29/Mar/05 09:07/graphics/fun/netbunnies/GingerKiss-McConville1.jpg
716 0.02%29/Mar/05 09:40/graphics/fun/netbunnies/Hasi1.jpg
715 0.01%29/Mar/05 09:51/graphics/fun/netbunnies/Georgariou.jpg
715 0.01%29/Mar/05 08:53/journal/3-5/calcium.html
715 29/Mar/05 08:46/rabbit-center/retail/pixel.gif
715 0.01%29/Mar/05 09:16/graphics/fun/netbunnies/Grace4-Delloli1.jpg
714 0.04%29/Mar/05 09:39/graphics/fun/netbunnies/beachingbunnieshenriettaho.jpg
713 0.02%29/Mar/05 09:14/graphics/fun/netbunnies/Thumper-Goff1.jpg
713 29/Mar/05 08:46/rabbit-center/graphics/icon_retail.gif
713 0.03%29/Mar/05 09:33/graphics/fun/netbunnies/paige-hester1.jpg
713 0.01%29/Mar/05 09:45/graphics/fun/netbunnies/baby1-jarrett1.jpg
713 0.02%29/Mar/05 09:38/graphics/fun/netbunnies/bunny2-suarez1.jpg
712 0.02%29/Mar/05 09:11/graphics/postcard/paddington.jpg
711 0.02%29/Mar/05 04:34/graphics/fun/netbunnies/att2-hotstuff1.jpg
710 0.01%29/Mar/05 09:40/graphics/fun/netbunnies/DSC00020A.jpg
710 0.05%29/Mar/05 09:56/graphics/fun/netbunnies/DSC00011.jpg
709 0.02%29/Mar/05 09:02/graphics/fun/netbunnies/Dot3-Neumann1.jpg
709 0.01%29/Mar/05 08:46/graphics/fun/netbunnies/Romeo.JPG
709 0.01%29/Mar/05 09:06/graphics/fun/netbunnies/baxtersmall1.jpg
708 0.01%29/Mar/05 09:24/chapters/san-diego/products/graphics/Prayer_box_1.jpg
708 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/boys3-martin1.jpg
708 0.03%29/Mar/05 09:47/graphics/fun/netbunnies/ShelbySnickers-Watson1.jpg
708 0.02%29/Mar/05 09:07/graphics/fun/netbunnies/bobby-lomas1.jpg
707 0.02%29/Mar/05 07:18/graphics/fun/netbunnies/sammie+tigger-choy1.jpg
706 0.02%29/Mar/05 08:50/graphics/fun/netbunnies/chester-amylase1.jpg
706 0.02%29/Mar/05 09:17/graphics/fun/netbunnies/usagi1-king1.jpg
706 0.09%29/Mar/05 09:49/chapters/san-diego/adoption/Adoption_Photos/Misty_Winter_happyadoption.jpg
705 0.02%29/Mar/05 08:44/graphics/fun/netbunnies/REX-Griffin1.jpg
704 0.02%29/Mar/05 08:32/graphics/fun/netbunnies/Lau3.jpg
704 0.02%29/Mar/05 07:40/graphics/fun/netbunnies/skye-relaxing.jpg
704 0.02%29/Mar/05 09:52/graphics/fun/netbunnies/Spot2-JackB1.jpg
703 0.03%29/Mar/05 08:59/graphics/fun/netbunnies/Rabbit1-Hogue1.jpg
702 0.01%29/Mar/05 09:56/graphics/fun/netbunnies/SuzyBetty-Harris1.jpg
702 0.02%29/Mar/05 08:51/graphics/fun/netbunnies/zippy-williams1.jpg
701 0.02%29/Mar/05 09:40/graphics/fun/netbunnies/babybunny-doe1.jpg
700 0.02%29/Mar/05 09:07/graphics/fun/netbunnies/abby1.jpg
700 0.03%29/Mar/05 09:36/graphics/fun/netbunnies/Foster-Edge1.jpg
700 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/rabbits-sargeant1.jpg
699 0.05%29/Mar/05 09:48/graphics/fun/netbunnies/black-marks-rabbit-gray-lop.jpg
699 0.02%29/Mar/05 09:25/graphics/fun/netbunnies/FloydMisty.jpg
699 0.01%29/Mar/05 09:52/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Fat_orange_rex.JPG
699 0.01%29/Mar/05 09:57/graphics/fun/netbunnies/chashuroar-tani1.jpg
698 0.02%29/Mar/05 09:00/graphics/fun/netbunnies/annie-jacquard1.jpg
698 0.01%29/Mar/05 09:50/chapters/san-diego/diet/graphics/cecals.jpg
697 0.02%29/Mar/05 08:54/graphics/fun/netbunnies/ruby-renee1.jpg
697 0.02%29/Mar/05 09:48/graphics/fun/netbunnies/willie1-martin1.jpg
697 0.01%29/Mar/05 09:54/graphics/fun/netbunnies/bunnies-stradeski1.jpg
696 0.02%28/Mar/05 06:17/easter/flyer/flyer4.pdf
696 0.04%29/Mar/05 08:48/graphics/fun/netbunnies/buddy-story1.jpg
696 0.02%29/Mar/05 09:06/graphics/fun/netbunnies/RosinaCarmello-Alexander1.jpg
695 0.03%29/Mar/05 06:10/graphics/fun/netbunnies/Snugglesspagetti-Yoder1.jpg
695 0.02%29/Mar/05 09:45/graphics/fun/netbunnies/timmy5-robinson1.jpg
695 0.01%29/Mar/05 09:49/graphics/fun/netbunnies/MaartyLoose-Altitude1.jpg
694 0.02%29/Mar/05 09:51/graphics/fun/netbunnies/QueenPetricia.jpg
693 0.03%29/Mar/05 08:40/graphics/fun/netbunnies/Lizzy13-Dale1.jpg
693 0.03%29/Mar/05 09:00/graphics/fun/netbunnies/bunnies-hayse1.jpg
693 0.01%29/Mar/05 09:52/graphics/fun/netbunnies/Jewel-Pratt1.jpg
693 0.02%29/Mar/05 09:01/graphics/fun/netbunnies/KUSTI1-Saisa1.jpg
693 0.01%29/Mar/05 09:35/graphics/fun/netbunnies/toots1-grecco1.jpg
693 0.05%29/Mar/05 09:58/graphics/fun/netbunnies/white-baby-garden.jpg
693 0.03%29/Mar/05 07:48/graphics/fun/netbunnies/ike-jpward1.jpg
693 29/Mar/05 08:46/rabbit-center/retail/bunnyR.gif
692 0.02%29/Mar/05 09:43/graphics/fun/netbunnies/kaopectate-dales1.jpg
692 0.02%29/Mar/05 09:59/graphics/fun/netbunnies/peanutpuff-gluck1.jpg
692 0.01%29/Mar/05 09:15/rabbit-center/retail/ani_bun.gif
692 29/Mar/05 08:46/rabbit-center/retail/bunnyL.gif
692 0.01%29/Mar/05 09:53/graphics/fun/netbunnies/floortje-swuggers1.jpg
691 0.03%29/Mar/05 09:49/chapters/san-diego/adoption/Adoption_Photos/Violet_adoption_4Aug02.JPG
691 0.03%29/Mar/05 08:48/graphics/fun/netbunnies/nimbus-kmk1.jpg
690 0.01%29/Mar/05 09:58/graphics/fun/netbunnies/IJOOR-Vandenberg1.jpg
690 0.02%29/Mar/05 09:05/graphics/fun/netbunnies/victor-woods1.jpg
690 0.05%29/Mar/05 08:40/graphics/fun/netbunnies/funnybunny2-Willcocks1.jpg
689 0.02%29/Mar/05 09:55/graphics/fun/netbunnies/oreo-corbelli1.jpg
689 0.01%29/Mar/05 09:00/graphics/fun/netbunnies/cadbury-budesa1.jpg
688 0.02%29/Mar/05 06:56/graphics/fun/netbunnies/hobo1-candelmo1.jpg
688 0.02%29/Mar/05 09:07/graphics/fun/netbunnies/missamila-herrington1.jpg
688 0.02%29/Mar/05 09:45/graphics/fun/netbunnies/XmasAngel1-Williamson1.jpg
688 0.01%29/Mar/05 09:39/graphics/fun/netbunnies/KOOS-Alewin1.jpg
687 0.02%29/Mar/05 09:31/graphics/fun/netbunnies/Pl-sch10.jpg
686 0.03%29/Mar/05 06:49/graphics/fun/netbunnies/Olivia-Trina1.jpg
686 0.01%29/Mar/05 06:22/graphics/fun/netbunnies/Ted3.jpg
685 0.02%29/Mar/05 09:32/graphics/fun/netbunnies/Lau5.jpg
685 0.03%29/Mar/05 09:06/graphics/fun/netbunnies/leo+gisele2-peach1.jpg
684 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/Scottie-Mark1.jpg
684 0.02%29/Mar/05 09:38/graphics/fun/netbunnies/Snickers-Flanagan1.jpg
684 0.02%29/Mar/05 07:57/graphics/fun/netbunnies/angus-before-a-shave.jpg
684 0.02%29/Mar/05 08:01/graphics/fun/netbunnies/bunnyflower-sepesy1.jpg
683 0.01%29/Mar/05 09:27/graphics/fun/netbunnies/Jake-Danner1.jpg
683 0.01%29/Mar/05 08:47/graphics/fun/netbunnies/Sackedout.jpg
683 0.02%29/Mar/05 09:31/graphics/fun/netbunnies/Rabbit1-Matson1.jpg
683 0.03%29/Mar/05 08:19/graphics/fun/netbunnies/bentley-cunningham1.jpg
683 0.01%29/Mar/05 09:38/graphics/fun/netbunnies/Precious.jpg
682 0.02%29/Mar/05 09:20/graphics/fun/netbunnies/Mel-cook1.jpg
682 0.02%29/Mar/05 09:53/graphics/fun/netbunnies/Mvc-007f.jpg
682 0.01%29/Mar/05 09:13/graphics/fun/netbunnies/Twins-Singleton1.jpg
682 0.02%29/Mar/05 02:03/graphics/fun/netbunnies/PeterAmalthia-Batchelar1.jpg
682 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/willow-in-bed-with-teddy.jpg
682 0.02%29/Mar/05 09:13/graphics/fun/netbunnies/Toby3-Wingfield1.jpg
682 0.03%29/Mar/05 09:39/rabbit-center/hayward_rescue/hayward_graphics/hayward_shelter.jpg
681 0.02%29/Mar/05 09:20/graphics/fun/netbunnies/oreo-oei1.jpg
681 0.04%29/Mar/05 09:32/graphics/fun/netbunnies/PeterBowl-Melanson1.jpg
681 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/P2140007.jpg
681 0.05%29/Mar/05 09:39/rabbit-center/hayward_rescue/hayward_graphics/boy_tumor.jpg
681 0.04%29/Mar/05 09:32/hrs-info/vet-conference/attendees-by-state.html
681 0.03%29/Mar/05 09:58/graphics/fun/netbunnies/akira-king.jpg
680 0.01%29/Mar/05 09:28/graphics/fun/netbunnies/a2.jpg
679 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/babyandjangles2.jpg
679 0.01%29/Mar/05 09:07/graphics/fun/netbunnies/Pumpkin-Longview1.jpg
679 0.02%29/Mar/05 09:35/graphics/fun/netbunnies/basketofbuns-sharwell1.jpg
678 0.01%29/Mar/05 09:09/rabbit-center/lucky/luckystory.htm
678 0.02%29/Mar/05 09:02/graphics/fun/netbunnies/bunnies1-Amit1.jpg
678 0.01%29/Mar/05 09:40/graphics/fun/netbunnies/StrepPeanutButter.jpg
678 0.04%29/Mar/05 07:59/graphics/fun/netbunnies/Mr. b-Barnette1.jpg
678 0.02%29/Mar/05 09:20/graphics/fun/netbunnies/Scooter.jpg
678 0.02%29/Mar/05 09:47/graphics/fun/netbunnies/SpotChance-Chanspan1.jpg
677 0.02%29/Mar/05 09:28/graphics/fun/netbunnies/Todd2-Lonergan1.jpg
677 0.04%29/Mar/05 09:57/graphics/fun/netbunnies/Hughston-Jellison1.jpg
677 0.02%29/Mar/05 09:00/graphics/fun/netbunnies/babybunny-Shinelun1.jpg
677 0.04%29/Mar/05 09:53/graphics/fun/netbunnies/P8050001.jpg
676 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/bunnies2-doerfler1.jpg
676 0.02%29/Mar/05 09:16/graphics/fun/netbunnies/wiggles2-moore1.jpg
675 0.02%29/Mar/05 06:22/graphics/fun/netbunnies/puppy-brian1.jpg
675 0.03%29/Mar/05 09:06/graphics/fun/netbunnies/Sassy-Kirsch1.jpg
675 0.01%29/Mar/05 09:52/graphics/fun/netbunnies/layla-tori-oster1.jpg
674 0.01%29/Mar/05 09:54/graphics/fun/netbunnies/bunny.jpg
674 0.02%29/Mar/05 05:51/graphics/fun/netbunnies/amos-martin1.jpg
674 0.02%29/Mar/05 09:19/graphics/fun/netbunnies/Toffee-Batchelar1.jpg
673 0.02%29/Mar/05 09:49/graphics/fun/netbunnies/Mvc-017s.jpg
673 0.01%29/Mar/05 09:49/graphics/fun/netbunnies/shag-tammy1.jpg
673 0.02%29/Mar/05 05:56/graphics/fun/netbunnies/RyoOhki4-Burk1.jpg
673 0.02%29/Mar/05 09:44/graphics/fun/netbunnies/scoobydoo-wilkinson1.jpg
673 0.03%29/Mar/05 09:13/graphics/fun/netbunnies/Silver-Hiler1.jpg
673 0.01%29/Mar/05 08:48/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Auction_items_1.jpg
672 0.02%29/Mar/05 09:40/graphics/fun/netbunnies/hamilton-chercat1.jpg
672 0.02%29/Mar/05 08:01/graphics/fun/netbunnies/annabelle-seitz1.jpg
672 0.01%29/Mar/05 09:48/graphics/fun/netbunnies/elle-gonzalez1.jpg
672 0.01%29/Mar/05 09:57/graphics/fun/netbunnies/Kissin-Altitude1.jpg
671 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/xmasweb-hyperchick1.jpg
671 0.02%29/Mar/05 07:23/graphics/fun/netbunnies/leia-sh1.jpg
671 0.02%29/Mar/05 06:16/graphics/fun/netbunnies/Pepper+jack-sean1.jpg
671 0.02%29/Mar/05 09:24/graphics/fun/netbunnies/Tommy2.jpg
671 0.02%29/Mar/05 08:53/graphics/fun/netbunnies/bailey4-erin1.jpg
670 0.02%29/Mar/05 09:15/graphics/fun/netbunnies/Jacob2-Sullivan1.jpg
670 0.03%29/Mar/05 09:51/graphics/fun/netbunnies/Trixie-Robinson1.jpg
670 0.02%29/Mar/05 09:17/graphics/fun/netbunnies/Relaxing.jpg
670 0.02%29/Mar/05 08:40/graphics/fun/netbunnies/Romeo-Mstnghthr1.jpg
669 0.01%29/Mar/05 09:15/graphics/fun/netbunnies/She-Zdila1.jpg
669 0.04%29/Mar/05 09:56/graphics/fun/netbunnies/SweetyBunny-Taylor1.jpg
669 0.01%29/Mar/05 09:29/care/poinsettia.html
669 0.02%29/Mar/05 09:52/graphics/fun/netbunnies/pepper1-stalker1.jpg
669 0.02%29/Mar/05 09:07/graphics/fun/netbunnies/chandler-craig1.jpg
669 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/babies-Kramer1.jpg
668 0.05%29/Mar/05 09:06/graphics/fun/netbunnies/perry-black-baby-box.jpg
667 0.02%29/Mar/05 06:25/graphics/fun/netbunnies/mybunny-parker1.jpg
667 0.02%29/Mar/05 09:51/graphics/fun/netbunnies/bungee-maclellan1.jpg
667 0.03%29/Mar/05 09:31/graphics/fun/netbunnies/SmokeyPepper-Fuzzy1.jpg
667 0.02%29/Mar/05 08:45/graphics/fun/netbunnies/binky-macgregor1.jpg
667 0.02%29/Mar/05 09:49/chapters/san-diego/adoption/Adoption_Photos/Mia_Jack_adoption_2_29Sept02.JPG
666 0.01%29/Mar/05 09:57/journal/2-12/fly-strike.html
666 0.03%29/Mar/05 05:16/graphics/fun/netbunnies/paige+theo-brusk1.jpg
666 0.02%29/Mar/05 09:04/graphics/fun/netbunnies/Sweet2-RustyBux1.jpg
666 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/Shelby+Sweetie-Benny1.jpg
665 0.01%29/Mar/05 09:57/links/palace_pet.html
665 0.01%29/Mar/05 09:13/graphics/fun/netbunnies/mrb-pfirsch1.jpg
665 0.02%29/Mar/05 09:43/graphics/fun/netbunnies/babies2-haase1.jpg
665 0.01%29/Mar/05 09:56/graphics/fun/netbunnies/flopser1-andiko1.jpg
665 0.03%29/Mar/05 09:51/graphics/fun/netbunnies/closecompanionsthumpersara.jpg
665 0.05%29/Mar/05 09:40/graphics/fun/netbunnies/milizard3-joy1.jpg
664 0.02%29/Mar/05 09:25/graphics/fun/netbunnies/floyd1-medel1.jpg
664 0.03%29/Mar/05 09:05/graphics/fun/netbunnies/buckland-steven1.jpg
664 0.01%29/Mar/05 09:19/graphics/fun/netbunnies/babygirl-buker1.jpg
664 0.02%29/Mar/05 09:07/graphics/fun/netbunnies/frodo-oberley1.jpg
663 29/Mar/05 09:42/graphics/cursor.gif
663 0.02%29/Mar/05 09:56/graphics/fun/netbunnies/leah-nancy1.jpg
663 0.01%29/Mar/05 09:50/graphics/fun/netbunnies/snoopy-yonezawa1.jpg
663 0.01%29/Mar/05 08:38/graphics/fun/netbunnies/babybunnies3-Phillips1.jpg
662 0.01%29/Mar/05 08:32/graphics/fun/netbunnies/r2-1-lin1.jpg
661 0.02%29/Mar/05 09:52/graphics/fun/netbunnies/websterlopwabbit.jpg
661 0.02%29/Mar/05 09:40/graphics/fun/netbunnies/jojo-Georgiev1.jpg
661 0.02%29/Mar/05 09:39/graphics/fun/netbunnies/Snickers-Watson1.jpg
661 0.02%29/Mar/05 09:40/graphics/fun/netbunnies/Thumper2-Hoffman1.jpg
661 0.01%29/Mar/05 09:40/graphics/fun/netbunnies/licorice-gluck1.jpg
661 0.02%29/Mar/05 06:20/graphics/fun/netbunnies/baby3.jpg
661 0.02%29/Mar/05 09:56/graphics/fun/netbunnies/RyoOhki2-Burk1.jpg
661 0.02%29/Mar/05 09:00/graphics/fun/netbunnies/im-not-ready.jpg
661 0.02%29/Mar/05 03:52/graphics/fun/netbunnies/bambibeau-guidry1.jpg
660 0.02%29/Mar/05 09:24/graphics/fun/netbunnies/job1-saar1.jpg
660 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/bunduck1-davison1.jpg
660 0.02%29/Mar/05 08:45/graphics/fun/netbunnies/benjy3-louise1.jpg
660 0.02%29/Mar/05 09:31/graphics/fun/netbunnies/bunnums.jpg
660 0.01%29/Mar/05 09:23/graphics/fun/netbunnies/bagelbun1-attila1.jpg
660 0.01%29/Mar/05 09:04/graphics/fun/netbunnies/kuzya-katz1.jpg
660 0.04%29/Mar/05 09:44/graphics/fun/netbunnies/frosty-santoro1.jpg
660 0.02%29/Mar/05 09:04/graphics/fun/netbunnies/amelia-mel-shay1.jpg
659 0.01%29/Mar/05 09:25/graphics/fun/netbunnies/cb4-fraleigh1.jpg
659 0.01%29/Mar/05 09:12/graphics/fun/netbunnies/boanddoja.jpg
659 0.03%29/Mar/05 09:40/graphics/fun/netbunnies/Siu-Choi1.jpg
659 0.03%29/Mar/05 09:39/graphics/fun/netbunnies/ziggy-hansberry1.jpg
659 0.02%29/Mar/05 08:57/graphics/fun/netbunnies/fudge2-leigh1.jpg
658 0.02%29/Mar/05 09:50/graphics/fun/netbunnies/piglet-philipson1.jpg
658 0.02%29/Mar/05 08:29/graphics/fun/netbunnies/amelia1-mcsherry1.jpg
658 0.02%29/Mar/05 09:07/graphics/fun/netbunnies/moby1-odell1.jpg
658 0.03%29/Mar/05 09:34/graphics/fun/netbunnies/buddy2-elliott1.jpg
658 0.02%29/Mar/05 09:54/graphics/fun/netbunnies/chicha-gerald1.jpg
657 0.04%29/Mar/05 09:50/graphics/fun/netbunnies/basil-cook1.jpg
657 0.03%29/Mar/05 09:43/graphics/fun/netbunnies/lucy-rebecca1.jpg
657 0.03%29/Mar/05 09:59/graphics/fun/netbunnies/benjamin-donovan1.jpg
657 0.04%29/Mar/05 08:53/graphics/fun/netbunnies/Sammioutondecknorth.jpg
657 0.01%29/Mar/05 05:59/graphics/fun/netbunnies/willow3-coder1.jpg
657 0.02%29/Mar/05 09:45/graphics/fun/netbunnies/crystal2-haske1.jpg
656 0.02%29/Mar/05 09:21/graphics/fun/netbunnies/bunny-roy1.jpg
656 0.03%29/Mar/05 09:55/graphics/fun/netbunnies/ambrosia-sagartz1.jpg
656 0.01%29/Mar/05 09:37/graphics/fun/netbunnies/SCHMOO.jpg
656 0.03%29/Mar/05 09:17/graphics/fun/netbunnies/moose-daus1.jpg
656 0.02%29/Mar/05 04:35/graphics/fun/netbunnies/RyoOhki3-Burk1.jpg
656 0.02%29/Mar/05 09:55/graphics/fun/netbunnies/zoidburg+leela-mellor1.jpg
655 0.01%29/Mar/05 09:05/graphics/fun/netbunnies/sophie-marroney1.jpg
655 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/armchair-wood1.jpg
655 0.01%29/Mar/05 09:43/graphics/fun/netbunnies/catbunny.jpg
655 0.07%29/Mar/05 08:46/graphics/fun/netbunnies/barney-long-lop-chair.jpg
654 0.02%29/Mar/05 07:26/graphics/fun/netbunnies/blueberry-perillat1.jpg
654 0.02%29/Mar/05 09:28/graphics/fun/netbunnies/xmasrab-Rtocups1.jpg
653 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/willow4-stardancer1.jpg
653 0.01%29/Mar/05 09:03/graphics/fun/netbunnies/Toto-Sun1.jpg
653 0.01%29/Mar/05 08:53/graphics/fun/netbunnies/ebonyandrosita.jpg
653 0.01%29/Mar/05 09:57/graphics/fun/netbunnies/Shadow.jpg
653 0.03%29/Mar/05 09:27/graphics/fun/netbunnies/bonnie-gazan1.jpg
653 0.02%29/Mar/05 09:01/graphics/fun/netbunnies/duncan2-ciuffo1.jpg
653 0.04%29/Mar/05 09:05/graphics/fun/netbunnies/dark-babies.jpg
652 0.02%29/Mar/05 09:47/graphics/fun/netbunnies/cumi +cheeky-lia1.jpg
652 0.03%29/Mar/05 09:57/graphics/fun/netbunnies/floppy-lim1.jpg
652 0.01%29/Mar/05 09:57/graphics/fun/netbunnies/charlie-gluck1.jpg
652 0.02%29/Mar/05 09:25/graphics/fun/netbunnies/winniefred-morris1.jpg
652 0.02%29/Mar/05 09:54/graphics/fun/netbunnies/amos.jpg
652 0.01%29/Mar/05 09:35/journal/4-3/gizmo.html
651 0.02%29/Mar/05 09:54/graphics/fun/netbunnies/daphne-chen1.jpg
651 0.01%29/Mar/05 08:52/graphics/fun/netbunnies/Snoopy3.jpg
651 0.02%29/Mar/05 09:01/journal/2-6/tusks.html
651 29/Mar/05 08:56/translations/spanish/
651 0.01%29/Mar/05 09:04/graphics/fun/netbunnies/MAP0000.jpg
651 0.01%29/Mar/05 09:24/graphics/fun/netbunnies/TakingaPowder.jpg
650 0.01%29/Mar/05 09:56/graphics/fun/netbunnies/ichy1-spallone1.jpg
650 0.03%29/Mar/05 08:01/graphics/fun/netbunnies/cuddles2-koza1.jpg
650 0.02%29/Mar/05 09:40/graphics/fun/netbunnies/Rascal-Ryska1.jpg
650 0.02%29/Mar/05 00:59/graphics/fun/netbunnies/tilly-macintosh1.jpg
650 0.01%29/Mar/05 09:48/graphics/fun/netbunnies/bambi-winter1.jpg
650 0.01%29/Mar/05 06:31/graphics/fun/netbunnies/bally-dellis1.jpg
650 0.01%29/Mar/05 09:36/graphics/fun/netbunnies/thumper-miller1.jpg
650 0.03%29/Mar/05 09:02/graphics/fun/netbunnies/cb-fraleigh1.jpg
650 0.02%29/Mar/05 09:47/graphics/fun/netbunnies/bunny2-osborne1.jpg
649 0.02%29/Mar/05 09:52/graphics/fun/netbunnies/Royalty-Ttandem1.jpg
649 0.03%29/Mar/05 09:48/graphics/fun/netbunnies/yogi2-mondragon1.jpg
649 0.02%29/Mar/05 09:44/graphics/fun/netbunnies/beezle-cat.jpg
649 0.01%29/Mar/05 09:29/graphics/fun/netbunnies/buntoungue-wendy1.jpg
649 0.01%29/Mar/05 09:59/graphics/fun/netbunnies/george-orell1.jpg
648 0.04%29/Mar/05 09:57/graphics/fun/netbunnies/wabbits-holden1.jpg
648 0.02%29/Mar/05 09:24/graphics/fun/netbunnies/arwen1-pritchard1.jpg
648 0.02%29/Mar/05 09:53/graphics/fun/netbunnies/earth2-toong1.jpg
648 0.05%29/Mar/05 09:35/graphics/fun/netbunnies/sylvia-spade-easter-basket.jpg
648 0.01%29/Mar/05 09:40/graphics/fun/netbunnies/attila+thumper1-schindl1.jpg
648 0.02%29/Mar/05 09:37/graphics/fun/netbunnies/jaz1-fraleigh1.jpg
648 0.02%29/Mar/05 09:54/graphics/fun/netbunnies/luna-lyerly1.jpg
647 0.01%29/Mar/05 09:52/graphics/fun/netbunnies/kanit1-makela1.jpg
647 0.04%29/Mar/05 09:38/graphics/fun/netbunnies/arthur2-holden1.jpg
647 0.03%29/Mar/05 09:44/graphics/fun/netbunnies/angel-stottlemyer1.jpg
647 0.02%29/Mar/05 09:02/graphics/fun/netbunnies/chompy+zebedee-thompson1.jpg
647 0.02%29/Mar/05 06:31/graphics/fun/netbunnies/schmoofriend-Gadsby1.jpg
647 0.02%29/Mar/05 09:28/graphics/fun/netbunnies/vegan2-christina1.jpg
646 0.03%29/Mar/05 09:58/graphics/fun/netbunnies/bunny in garden-winden1.jpg
646 0.15%13/Mar/05 03:47/chapters/san-diego/adoption/Adoption_Photos/HRS_Rory_3_Dec04.jpg
646 29/Mar/05 09:55/rabbit-center/news_release/index_clip_image002.jpg
646 0.04%29/Mar/05 09:56/graphics/fun/netbunnies/yoki-elyn1.jpg
646 0.02%29/Mar/05 06:14/graphics/fun/netbunnies/lulu+inez-moore1.jpg
646 0.01%29/Mar/05 09:49/graphics/fun/netbunnies/clooney-curtin1.jpg
646 0.01%29/Mar/05 08:47/graphics/fun/netbunnies/dewfie-Ho1.jpg
646 0.02%29/Mar/05 09:54/graphics/fun/netbunnies/winston-phelan1.jpg
645 0.02%29/Mar/05 09:56/graphics/fun/netbunnies/sugar-wendy1.jpg
645 0.03%29/Mar/05 08:54/graphics/fun/netbunnies/hiphop-fischer1.jpg
645 0.02%29/Mar/05 07:56/graphics/fun/netbunnies/SuperbeHermione-Buton1.jpg
645 0.02%29/Mar/05 09:54/graphics/fun/netbunnies/bunnies4-doerfler1.jpg
645 0.02%29/Mar/05 09:05/graphics/fun/netbunnies/kits-rowan1.jpg
645 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/conejo2-Collado1.jpg
645 0.03%29/Mar/05 09:57/graphics/fun/netbunnies/tinkerbell-habel1.jpg
645 0.02%29/Mar/05 09:13/graphics/fun/netbunnies/becky-sugalski1.jpg
645 29/Mar/05 09:17/graphics/fun/netbunnies/beauty2.jpg
645 0.02%29/Mar/05 08:29/graphics/fun/netbunnies/cookie-mazurek1.jpg
644 0.01%29/Mar/05 09:15/graphics/fun/netbunnies/fellafoot-silver1.jpg
644 0.02%29/Mar/05 09:39/graphics/fun/netbunnies/babyhat-gavrilovich1.jpg
644 0.01%29/Mar/05 09:39/graphics/fun/netbunnies/foofoo-mattos1.jpg
644 0.03%29/Mar/05 09:32/rabbit-center/adoptables/P2050012med.jpg
644 0.02%29/Mar/05 09:37/graphics/fun/netbunnies/penny1-lake1.jpg
644 0.05%29/Mar/05 09:27/graphics/fun/netbunnies/bill.jpg
644 0.01%29/Mar/05 04:42/graphics/fun/netbunnies/toto-siu1.jpg
643 0.05%29/Mar/05 08:50/graphics/fun/netbunnies/truffles-white-lop-drinking.jpg
643 0.02%29/Mar/05 09:51/graphics/fun/netbunnies/rabbit-makuh1.jpg
643 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/billy2-sharwell1.jpg
643 0.02%29/Mar/05 09:49/graphics/fun/netbunnies/zippy-story1.jpg
643 0.03%29/Mar/05 09:51/graphics/fun/netbunnies/brewster-chiang1.jpg
643 0.02%29/Mar/05 09:13/graphics/fun/netbunnies/zappa1-taylor1.jpg
642 0.01%29/Mar/05 09:17/graphics/fun/netbunnies/bunny1-potts1.jpg
642 0.02%29/Mar/05 09:24/graphics/fun/netbunnies/oscar-sigler1.jpg
642 0.01%29/Mar/05 09:36/graphics/fun/netbunnies/batuffolo1-massimo1.jpg
642 0.02%29/Mar/05 09:04/graphics/fun/netbunnies/bighead1.jpg
642 0.03%29/Mar/05 06:50/graphics/fun/netbunnies/whiterabbitbymirrorlasko.jpg
642 0.02%29/Mar/05 08:45/graphics/fun/netbunnies/cora-winarchick1.jpg
642 0.04%29/Mar/05 08:27/graphics/fun/netbunnies/bunnybonding-Darren1.jpg
642 0.01%29/Mar/05 09:55/graphics/fun/netbunnies/alfred.jpg
642 0.02%29/Mar/05 09:28/graphics/fun/netbunnies/kuro2-arai1.jpg
642 0.02%29/Mar/05 09:44/graphics/fun/netbunnies/bunnies-marroney1.jpg
641 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/cilantro-linares1.jpg
641 0.02%29/Mar/05 09:47/graphics/fun/netbunnies/auntdot-peterson1.jpg
641 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/eve-Walzer1.jpg
641 0.06%29/Mar/05 09:51/graphics/fun/netbunnies/brown-lop-christmas.jpg
641 29/Mar/05 07:25/fun/answer1.html
640 0.02%29/Mar/05 09:21/graphics/fun/netbunnies/bunnybutts3-spence1.jpg
640 0.03%29/Mar/05 09:58/graphics/fun/netbunnies/bunny-wai1.jpg
640 0.02%29/Mar/05 09:39/graphics/fun/netbunnies/beatrix-snyder1.jpg
640 0.01%29/Mar/05 09:35/graphics/fun/netbunnies/wilshire-bugsi-dslextreme1.jpg
639 0.02%29/Mar/05 09:04/graphics/fun/netbunnies/slinky-Smudge1.jpg
639 0.02%29/Mar/05 09:51/graphics/fun/netbunnies/mabel-anderson1.jpg
639 0.03%29/Mar/05 09:56/graphics/fun/netbunnies/sweetie2-toillon1.jpg
639 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/tepp1-noa1.jpg
639 0.02%29/Mar/05 07:10/graphics/fun/netbunnies/christmaskids-sandy1.jpg
639 0.03%29/Mar/05 09:51/graphics/fun/netbunnies/amusematte-herrington1.jpg
639 0.01%29/Mar/05 09:40/graphics/fun/netbunnies/knuffel-Hoyer1.jpg
638 0.01%29/Mar/05 09:18/graphics/fun/netbunnies/sammy-lea1.jpg
638 0.01%29/Mar/05 09:20/journal/3-8/soft-stools.html
638 0.02%29/Mar/05 08:31/graphics/fun/netbunnies/pete-sexton1.jpg
638 0.03%29/Mar/05 09:40/graphics/fun/netbunnies/patches-lemke1.jpg
638 0.04%29/Mar/05 09:47/graphics/fun/netbunnies/montythumper3-carpenter1.jpg
637 0.01%29/Mar/05 09:38/graphics/fun/netbunnies/spunky-miller1.jpg
637 0.01%29/Mar/05 08:01/graphics/fun/netbunnies/willow-in-pool.jpg
637 0.02%29/Mar/05 09:52/graphics/fun/netbunnies/baxter.jpg
637 0.02%29/Mar/05 09:49/graphics/fun/netbunnies/werls-arobinson1.jpg
637 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/stew-morgans1.jpg
637 0.02%29/Mar/05 09:05/graphics/fun/netbunnies/wonton2-nadeau1.jpg
636 0.01%29/Mar/05 09:28/graphics/fun/netbunnies/dixon-davis1.jpg
636 0.02%29/Mar/05 09:26/graphics/fun/netbunnies/kobalt-ugarenko1.jpg
636 0.03%29/Mar/05 09:56/graphics/fun/netbunnies/chloe-priscilla1.jpg
636 0.01%29/Mar/05 09:22/graphics/fun/netbunnies/basket-linares1.jpg
636 0.03%29/Mar/05 09:27/graphics/fun/netbunnies/tusse2-Persson1.jpg
636 0.02%29/Mar/05 09:15/graphics/fun/netbunnies/rasberry-perillat1.jpg
636 0.02%29/Mar/05 09:37/graphics/fun/netbunnies/harley2-ko1.jpg
636 0.04%29/Mar/05 09:51/graphics/fun/netbunnies/rabbitwithcataroundcorner.jpg
635 0.02%29/Mar/05 09:56/graphics/fun/netbunnies/Tiara-Trina1.jpg
635 0.01%29/Mar/05 09:08/graphics/fun/netbunnies/scone2-brown1.jpg
635 0.02%29/Mar/05 06:16/graphics/fun/netbunnies/willie2-martin1.jpg
635 0.03%29/Mar/05 09:59/graphics/fun/netbunnies/ralph_lunn1.jpg
635 0.01%29/Mar/05 07:58/graphics/fun/netbunnies/arbutus.jpg
635 28/Mar/05 22:02/easter/flyer/logo-w-name.gif
635 0.01%29/Mar/05 09:37/graphics/fun/netbunnies/cheyenne-anderson1.jpg
635 0.03%29/Mar/05 09:56/graphics/fun/netbunnies/WallyZorro-Mack1.jpg
634 0.01%29/Mar/05 07:53/graphics/fun/netbunnies/asher-underwood1.jpg
634 29/Mar/05 09:59/chapters/san-francisco/
634 0.01%29/Mar/05 09:38/graphics/fun/netbunnies/ziggy2-Rebolj1.jpg
634 0.01%29/Mar/05 08:00/graphics/fun/netbunnies/rabbits-chang1.jpg
634 0.01%29/Mar/05 09:44/graphics/fun/netbunnies/george1.jpg
634 0.02%29/Mar/05 09:13/graphics/fun/netbunnies/bunny0420.jpg
634 0.01%29/Mar/05 09:57/graphics/fun/netbunnies/angel1-moskalik1.jpg
634 0.01%29/Mar/05 09:57/graphics/fun/netbunnies/bunandmoose.jpg
634 0.01%29/Mar/05 09:54/chapters/san-diego/products/office_store.html
634 0.02%29/Mar/05 07:26/graphics/fun/netbunnies/emma2-beavis1.jpg
634 0.01%29/Mar/05 09:57/graphics/fun/netbunnies/benny-scollo1.jpg
634 0.02%29/Mar/05 09:37/graphics/fun/netbunnies/unshin2-nilgesl1.jpg
634 0.02%29/Mar/05 09:03/graphics/fun/netbunnies/willby-cook1.jpg
633 0.01%29/Mar/05 09:39/graphics/fun/netbunnies/muffin-matacia1.jpg
633 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/vlekkie-rose1.jpg
633 0.01%29/Mar/05 09:01/graphics/fun/netbunnies/Myrabbit.jpg
633 0.03%29/Mar/05 09:30/graphics/fun/netbunnies/isaac-barbara1.jpg
633 0.02%29/Mar/05 09:21/graphics/fun/netbunnies/winnie-curtin1.jpg
632 0.02%29/Mar/05 09:36/graphics/fun/netbunnies/penelope-Plourde1.jpg
632 0.03%29/Mar/05 09:49/graphics/fun/netbunnies/rabbit1-lau1.jpg
632 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/wasabi-yee1.jpg
632 0.03%29/Mar/05 09:56/graphics/fun/netbunnies/wiggles-giles1.jpg
631 0.02%29/Mar/05 09:49/graphics/fun/netbunnies/bubba3.jpg
631 0.02%29/Mar/05 09:04/graphics/fun/netbunnies/bart-williams1.jpg
631 0.03%29/Mar/05 07:56/graphics/fun/netbunnies/SmellyPiglet-Lam1.jpg
631 0.02%29/Mar/05 08:47/graphics/fun/netbunnies/rex-joe1.jpg
631 0.03%29/Mar/05 08:50/graphics/fun/netbunnies/boys2-martin1.jpg
631 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/aspen+pandora3-millikin1.jpg
631 0.05%29/Mar/05 09:40/graphics/fun/netbunnies/alexander-7mon-lop-palmiere.jpg
631 0.03%29/Mar/05 09:38/graphics/fun/netbunnies/maverick2-kirk1.jpg
630 0.03%29/Mar/05 09:58/graphics/fun/netbunnies/daisy2-schnellbach1.jpg
630 0.01%29/Mar/05 09:23/graphics/fun/netbunnies/rory-jnr1.jpg
630 0.02%29/Mar/05 09:28/graphics/fun/netbunnies/sassy-william1.jpg
630 0.02%29/Mar/05 08:56/graphics/fun/netbunnies/gangFour-Zdila1.jpg
630 0.02%29/Mar/05 06:41/graphics/fun/netbunnies/bunnies1-doerfler1.jpg
630 0.01%29/Mar/05 09:01/graphics/fun/netbunnies/phoebe-gumpel1.jpg
630 0.02%29/Mar/05 07:57/graphics/fun/netbunnies/harley-ko1.jpg
630 0.02%29/Mar/05 09:21/graphics/fun/netbunnies/bunbun-auken1.jpg
629 0.02%29/Mar/05 09:02/graphics/fun/netbunnies/ziggy-rebolj1.jpg
629 0.02%29/Mar/05 09:00/graphics/fun/netbunnies/eric1.jpg
629 0.02%29/Mar/05 09:37/graphics/fun/netbunnies/taco-needler1.jpg
629 0.02%29/Mar/05 08:28/graphics/fun/netbunnies/yuri-Lawson1.jpg
629 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/custard-connor1.jpg
629 0.01%29/Mar/05 08:57/graphics/fun/netbunnies/sam-penelope3-stellato1.jpg
629 0.02%29/Mar/05 09:40/graphics/fun/netbunnies/fluffy-Wong1.jpg
629 0.03%29/Mar/05 09:03/graphics/fun/netbunnies/bailey2-smith1.jpg
629 0.01%29/Mar/05 09:21/graphics/fun/netbunnies/joey1-cook1.jpg
629 0.03%29/Mar/05 09:57/graphics/fun/netbunnies/brushbaby.jpg
629 0.01%29/Mar/05 06:56/graphics/fun/netbunnies/bunhead-Wiles1.jpg
628 0.01%29/Mar/05 09:52/graphics/fun/netbunnies/luna5-kateri1.jpg
628 0.02%29/Mar/05 07:56/graphics/fun/netbunnies/edith-Jurasinski1.jpg
628 0.03%29/Mar/05 08:25/graphics/fun/netbunnies/sweetie-toillon1.jpg
628 0.02%29/Mar/05 09:48/graphics/fun/netbunnies/becky-semler1.jpg
628 0.03%29/Mar/05 09:57/graphics/fun/netbunnies/krinkle-schroeder1.jpg
628 0.02%29/Mar/05 07:58/graphics/fun/netbunnies/baylee-copple1.jpg
627 0.02%29/Mar/05 08:58/graphics/fun/netbunnies/rabbit-jcp1.jpg
627 0.01%29/Mar/05 07:23/care/declawing.html
627 0.01%29/Mar/05 09:25/graphics/fun/netbunnies/snowflake.jpg
627 0.02%29/Mar/05 09:06/graphics/fun/netbunnies/Willow-sandy1.jpg
627 0.02%29/Mar/05 08:50/graphics/fun/netbunnies/Smokey-Rogers1.jpg
627 0.01%29/Mar/05 08:58/graphics/fun/netbunnies/bunny-gonzalez1.jpg
627 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/miles-grubin1.jpg
627 0.01%29/Mar/05 08:51/graphics/fun/netbunnies/bbyjack.jpg
627 0.01%29/Mar/05 09:38/graphics/fun/netbunnies/blaze2-heldt1.jpg
627 0.02%29/Mar/05 08:56/graphics/fun/netbunnies/thumper-roxy2-bailey1.jpg
627 0.02%29/Mar/05 09:50/graphics/fun/netbunnies/rabbits1-reeves1.jpg
626 0.02%29/Mar/05 08:51/graphics/fun/netbunnies/buster-liu1.jpg
626 0.01%29/Mar/05 09:57/graphics/fun/netbunnies/minik-sahinalp1.jpg
626 0.01%29/Mar/05 09:57/graphics/fun/netbunnies/cassidy.jpg
626 0.01%29/Mar/05 09:36/graphics/fun/netbunnies/wiener1-sposato1.jpg
626 0.02%29/Mar/05 09:48/graphics/fun/netbunnies/thumper3-chandler1.jpg
626 0.04%29/Mar/05 09:22/graphics/fun/netbunnies/crystal-11mon-palmier.jpg
626 0.03%29/Mar/05 09:46/graphics/fun/netbunnies/willow1-stardancer1.jpg
626 0.02%29/Mar/05 09:05/graphics/fun/netbunnies/varmint-dunn1.jpg
626 0.02%29/Mar/05 07:07/graphics/fun/netbunnies/spencer-collins1.jpg
626 0.01%29/Mar/05 09:20/graphics/fun/netbunnies/bunbun6-wendy1.jpg
626 0.02%29/Mar/05 09:22/graphics/fun/netbunnies/barley-caligiuri1.jpg
626 0.02%29/Mar/05 09:45/graphics/fun/netbunnies/cloverbun-Mulholland1.jpg
626 0.03%29/Mar/05 09:52/graphics/fun/netbunnies/pebbles8-cliff1.jpg
625 0.02%29/Mar/05 09:32/graphics/fun/netbunnies/alfie1-finn1.jpg
625 0.01%29/Mar/05 07:37/graphics/fun/netbunnies/S001i001.jpg
625 0.01%29/Mar/05 09:48/journal/3-11/graphics/apple-by-fence-ill.gif
625 0.02%29/Mar/05 09:51/graphics/fun/netbunnies/padittle_prisbrey1.jpg
625 0.01%29/Mar/05 09:28/graphics/fun/netbunnies/fripouille-having-a-nap.jpg
625 0.03%29/Mar/05 08:51/graphics/fun/netbunnies/bailey1-erin1.jpg
625 0.01%29/Mar/05 09:39/graphics/fun/netbunnies/spike-doubleday1.jpg
625 0.02%29/Mar/05 09:43/graphics/fun/netbunnies/sully-paige1.jpg
625 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/bunnybasket-uijen1.jpg
625 0.03%29/Mar/05 08:52/graphics/fun/netbunnies/peppermint-Walzer1.jpg
625 0.01%29/Mar/05 08:41/graphics/fun/netbunnies/fuzz1.jpg
625 0.03%29/Mar/05 09:59/graphics/fun/netbunnies/shooshoo-snar1.jpg
625 0.02%29/Mar/05 09:17/graphics/fun/netbunnies/bunners-lloyd1.jpg
625 0.01%29/Mar/05 04:54/graphics/fun/netbunnies/achog-elamk2c1.jpg
624 0.02%29/Mar/05 09:01/graphics/fun/netbunnies/ZZ-small-Cvetan1.jpg
624 0.03%29/Mar/05 09:58/graphics/fun/netbunnies/nelly2-salter1.jpg
624 0.01%29/Mar/05 08:26/graphics/fun/netbunnies/buttons1-martin1.jpg
624 0.01%29/Mar/05 08:46/graphics/fun/netbunnies/benjamin-Noir1.jpg
624 0.01%29/Mar/05 08:53/graphics/fun/netbunnies/bloop-rockel1.jpg
624 0.02%29/Mar/05 09:01/graphics/fun/netbunnies/crissinina-santos1.jpg
624 0.01%29/Mar/05 09:56/graphics/fun/netbunnies/r956amber42tiny.jpg
624 0.01%29/Mar/05 08:54/graphics/fun/netbunnies/princess-pendergast1.jpg
624 0.01%29/Mar/05 09:56/graphics/fun/netbunnies/toto-charonnet1.jpg
624 0.03%29/Mar/05 09:57/graphics/fun/netbunnies/whats-up.jpg
623 0.02%29/Mar/05 09:54/graphics/fun/netbunnies/baso+stinky-wangchuk1.jpg
623 0.02%29/Mar/05 09:15/graphics/fun/netbunnies/starr1-pangia1.jpg
623 0.05%29/Mar/05 05:58/graphics/fun/netbunnies/bartup.jpg
623 0.04%29/Mar/05 06:49/graphics/fun/netbunnies/santarabbitandpresentkarask.jpg
623 0.02%29/Mar/05 09:49/graphics/fun/netbunnies/rabbit6-oehler1.jpg
623 0.02%28/Mar/05 22:34/graphics/fun/netbunnies/wabbit2-luumi1.jpg
623 0.02%29/Mar/05 08:07/graphics/fun/netbunnies/bunnybabies-Linares1.jpg
623 0.02%29/Mar/05 09:16/graphics/fun/netbunnies/binkyaustin3-rhonda1.jpg
623 0.02%29/Mar/05 08:54/graphics/fun/netbunnies/bunny1-ramirez1.jpg
623 0.03%29/Mar/05 09:00/graphics/fun/netbunnies/rabbit-b-spence1.jpg
623 0.02%29/Mar/05 09:49/graphics/fun/netbunnies/abby2-geekie1.jpg
623 0.02%29/Mar/05 08:33/graphics/fun/netbunnies/alfie3-finn1.jpg
623 0.01%29/Mar/05 08:41/graphics/fun/netbunnies/bunny3-pearson1.jpg
623 0.02%29/Mar/05 09:37/graphics/fun/netbunnies/duke1-hop1.jpg
623 0.01%29/Mar/05 09:49/graphics/fun/netbunnies/stravinsky2-taylor1.jpg
623 0.02%29/Mar/05 09:38/graphics/fun/netbunnies/cuddles1-porter1.jpg
622 0.02%29/Mar/05 07:56/graphics/fun/netbunnies/harry3-mayers1.jpg
622 0.03%29/Mar/05 09:07/graphics/fun/netbunnies/leo-herb1.jpg
622 0.02%29/Mar/05 07:59/graphics/fun/netbunnies/mushielopincorner.jpg
622 0.03%29/Mar/05 09:46/graphics/fun/netbunnies/bugs2-Ingham1.jpg
622 0.02%29/Mar/05 09:24/graphics/fun/netbunnies/xpp3-huang1.jpg
622 0.04%29/Mar/05 09:47/graphics/fun/netbunnies/theo1-smith1.jpg
622 0.03%29/Mar/05 09:16/graphics/fun/netbunnies/frankie-phelan1.jpg
622 0.02%29/Mar/05 09:15/graphics/fun/netbunnies/haemish-erin1.jpg
622 0.03%29/Mar/05 09:56/graphics/fun/netbunnies/winston-turner1.jpg
622 0.02%29/Mar/05 09:56/graphics/fun/netbunnies/pooper1-chakraverty1.jpg
622 0.02%29/Mar/05 08:48/graphics/fun/netbunnies/buster-macintosh1.jpg
622 0.03%29/Mar/05 09:57/graphics/fun/netbunnies/bunnies2-Linares1.jpg
622 0.02%29/Mar/05 09:00/graphics/fun/netbunnies/abbey3-swordams1.jpg
622 0.01%29/Mar/05 01:35/graphics/fun/netbunnies/bugsy1-meier1.jpg
622 0.02%29/Mar/05 09:40/graphics/fun/netbunnies/muffy4.jpg
622 0.02%29/Mar/05 09:04/graphics/fun/netbunnies/noodles-ford1.jpg
621 0.02%29/Mar/05 09:00/graphics/fun/netbunnies/RabbitsGarten-Henkel1.jpg
621 0.03%29/Mar/05 09:54/graphics/fun/netbunnies/georgethumper-wesorick1.jpg
621 0.03%29/Mar/05 05:59/graphics/fun/netbunnies/nine2-merkus1.jpg
621 0.03%29/Mar/05 01:17/graphics/fun/netbunnies/reggie-odell1.jpg
621 0.02%29/Mar/05 09:37/graphics/fun/netbunnies/whospilled-copple1.jpg
621 0.03%29/Mar/05 07:59/graphics/fun/netbunnies/chester-jones1.jpg
621 0.04%29/Mar/05 08:50/graphics/fun/netbunnies/khaki-fischer1.jpg
621 0.03%29/Mar/05 09:48/graphics/fun/netbunnies/bunny-nelson1.jpg
620 0.01%29/Mar/05 09:58/graphics/fun/netbunnies/rocketpeaches5-sears1.jpg
620 0.02%29/Mar/05 09:39/graphics/fun/netbunnies/daphne-tck1.jpg
620 0.03%29/Mar/05 09:24/graphics/fun/netbunnies/bunflowers-flaherty1.jpg
620 0.03%29/Mar/05 03:04/graphics/fun/netbunnies/harold-drake1.jpg
620 29/Mar/05 09:54/graphics/books/126X32-b-logo.gif
620 0.01%29/Mar/05 09:52/graphics/fun/netbunnies/georgie-lake1.jpg
620 0.02%29/Mar/05 08:29/graphics/fun/netbunnies/bigwig+sugaree-bielawski1.jpg
620 0.04%29/Mar/05 09:25/graphics/fun/netbunnies/bartback.jpg
620 0.01%29/Mar/05 08:54/graphics/fun/netbunnies/baileymason-Chaplin1.jpg
620 0.02%29/Mar/05 09:40/graphics/fun/netbunnies/jed6-forrai1.jpg
620 0.02%29/Mar/05 09:31/graphics/fun/netbunnies/morty2-alcorn1.jpg
620 0.01%29/Mar/05 09:36/graphics/fun/netbunnies/cozybun2.jpg
620 0.01%29/Mar/05 09:56/graphics/fun/netbunnies/smokey3h.jpg
620 0.02%29/Mar/05 09:41/graphics/fun/netbunnies/melbacheckers-tolle1.jpg
620 0.01%29/Mar/05 08:48/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Auction_items_4.JPG
620 0.03%29/Mar/05 09:51/graphics/fun/netbunnies/lily3-schroeder1.jpg
620 0.04%29/Mar/05 09:55/graphics/fun/netbunnies/bunbun-apaluch1.jpg
619 0.01%29/Mar/05 09:22/graphics/fun/netbunnies/gizmo-levesque1.jpg
619 0.01%29/Mar/05 09:36/graphics/fun/netbunnies/franklin1-harris1.jpg
619 0.01%29/Mar/05 09:06/graphics/fun/netbunnies/Sgt72-Jenney1.jpg
619 0.02%29/Mar/05 07:55/graphics/fun/netbunnies/granger-wiener1.jpg
619 0.02%29/Mar/05 09:00/graphics/fun/netbunnies/rabbit-Timcoe1.jpg
619 0.02%29/Mar/05 09:28/graphics/fun/netbunnies/sumi-lynne1.jpg
619 0.01%29/Mar/05 09:49/graphics/fun/netbunnies/spencer-pinecone.jpg
619 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/sexy-szafranski1.jpg
619 0.01%29/Mar/05 09:06/graphics/fun/netbunnies/mvc.jpg
619 0.02%29/Mar/05 09:55/graphics/fun/netbunnies/dalebunny-crisnjay1.jpg
619 0.02%29/Mar/05 09:28/graphics/fun/netbunnies/dopey-chen1.jpg
619 0.02%29/Mar/05 09:02/graphics/fun/netbunnies/harveywatchingtvnorth.jpg
619 0.02%29/Mar/05 09:13/graphics/fun/netbunnies/picasso2-autumn1.jpg
619 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/peanut-poole1.jpg
619 0.02%29/Mar/05 07:09/graphics/fun/netbunnies/toby3-penney1.jpg
619 0.02%29/Mar/05 09:48/graphics/fun/netbunnies/bengong.jpg
619 0.01%29/Mar/05 09:57/graphics/fun/netbunnies/sophia.jpg
618 0.02%29/Mar/05 06:55/chapters/san-diego/faq/
618 0.04%29/Mar/05 09:51/graphics/fun/netbunnies/kids-wittenkeller1.jpg
618 0.02%29/Mar/05 09:51/graphics/fun/netbunnies/brownie2.jpg
618 0.02%29/Mar/05 09:34/graphics/fun/netbunnies/floppy-small1.jpg
618 0.03%29/Mar/05 09:49/graphics/fun/netbunnies/laraotoole2-swieconek1.jpg
618 0.03%29/Mar/05 09:39/rabbit-center/hayward_rescue/hayward_graphics/Sweet_wht_bunny_2.jpg
618 0.04%29/Mar/05 09:36/graphics/fun/netbunnies/bunnies-jamie1.jpg
618 0.01%29/Mar/05 08:43/graphics/fun/netbunnies/baxtersmall2.jpg
618 0.01%29/Mar/05 09:58/graphics/fun/netbunnies/black-ho1.jpg
618 0.02%29/Mar/05 08:56/graphics/fun/netbunnies/owen-slessor1.jpg
618 0.03%29/Mar/05 09:52/graphics/fun/netbunnies/bambam-hearn1.jpg
618 0.02%29/Mar/05 06:26/graphics/fun/netbunnies/esmeralda-langseth1.jpg
618 0.01%29/Mar/05 09:39/graphics/fun/netbunnies/peach-herrington1.jpg
618 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/charlie2-louise1.jpg
618 0.02%29/Mar/05 09:39/graphics/fun/netbunnies/lenie-jalasco1.jpg
618 29/Mar/05 09:54/graphics/books/go-button.gif
617 0.01%29/Mar/05 09:54/graphics/fun/netbunnies/tofu-kessler1.jpg
617 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/monica2-feldman1.jpg
617 0.01%29/Mar/05 09:51/graphics/fun/netbunnies/bunny1-Baker1.jpg
617 0.02%29/Mar/05 09:55/graphics/fun/netbunnies/bunny2-baker1.jpg
617 0.02%29/Mar/05 09:41/graphics/fun/netbunnies/melizard1-joy1.jpg
617 0.02%29/Mar/05 09:07/graphics/fun/netbunnies/rabbit2-johnson1.jpg
617 0.02%29/Mar/05 09:55/graphics/fun/netbunnies/thumper.jpg
617 0.02%29/Mar/05 09:40/graphics/fun/netbunnies/commander-hanford1.jpg
617 0.01%29/Mar/05 09:51/graphics/fun/netbunnies/fluffy-hosein1.jpg
617 0.01%29/Mar/05 09:47/graphics/fun/netbunnies/turbo2-tam1.jpg
617 0.01%29/Mar/05 09:55/graphics/fun/netbunnies/joey2-grinnel1.jpg
617 0.01%29/Mar/05 09:58/graphics/fun/netbunnies/conejo3-Collado1.jpg
617 0.01%29/Mar/05 09:51/graphics/fun/netbunnies/harvey.jpg
617 0.04%29/Mar/05 08:47/graphics/fun/netbunnies/nigel-hickman1.jpg
616 0.01%29/Mar/05 09:31/graphics/fun/netbunnies/angel-jan1.jpg
616 0.01%29/Mar/05 08:31/graphics/fun/netbunnies/barnie3-lee1.jpg
616 0.01%29/Mar/05 09:57/graphics/fun/netbunnies/bunny-karra1.jpg
616 0.01%29/Mar/05 09:38/graphics/fun/netbunnies/bunnies2-kimberley1.jpg
616 0.02%29/Mar/05 08:54/graphics/fun/netbunnies/marble-haviva1.jpg
616 0.01%29/Mar/05 09:47/graphics/fun/netbunnies/dusty.jpg
616 0.01%29/Mar/05 09:15/graphics/fun/netbunnies/bunny-posey1.jpg
616 0.03%29/Mar/05 09:14/graphics/fun/netbunnies/pandora2-chiquita1.jpg
616 0.01%29/Mar/05 09:45/graphics/fun/netbunnies/bosco-belle-graham1.jpg
616 0.01%29/Mar/05 09:29/graphics/fun/netbunnies/munchkin-singer1.jpg
616 0.02%29/Mar/05 09:26/graphics/fun/netbunnies/bunster-kerry1.jpg
616 0.02%29/Mar/05 09:51/graphics/fun/netbunnies/rabbit-carpenter1.jpg
616 0.02%29/Mar/05 06:09/graphics/fun/netbunnies/peanut+duke-Bud1.jpg
616 0.02%29/Mar/05 09:17/graphics/fun/netbunnies/dennis-turner1.jpg
616 0.02%29/Mar/05 09:54/graphics/fun/netbunnies/abbott-myers1.jpg
616 0.01%29/Mar/05 09:07/graphics/fun/netbunnies/snuffie-SheilaS1.jpg
616 0.03%29/Mar/05 09:51/graphics/fun/netbunnies/riley1.jpg
616 0.01%29/Mar/05 09:27/graphics/fun/netbunnies/carolron-balch1.jpg
616 0.03%29/Mar/05 09:58/graphics/fun/netbunnies/rabbits2-sargeant1.jpg
616 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/brulee+hudson-beeline1.jpg
616 0.02%29/Mar/05 09:49/graphics/fun/netbunnies/artie-forsythe1.jpg
615 0.02%29/Mar/05 09:45/graphics/fun/netbunnies/chang-dixon1.jpg
615 0.01%29/Mar/05 09:49/journal/2-6/fear-into-play.html
615 0.01%29/Mar/05 09:54/graphics/fun/netbunnies/weblio1-aki1.jpg
615 0.03%29/Mar/05 09:24/graphics/fun/netbunnies/max1-hanna1.jpg
615 0.02%29/Mar/05 08:53/graphics/fun/netbunnies/bunnies4-broley1.jpg
615 0.01%29/Mar/05 09:43/graphics/fun/netbunnies/relaxing.jpg
615 0.04%29/Mar/05 09:56/graphics/fun/netbunnies/stormy-skyquest1.jpg
615 0.03%29/Mar/05 09:40/graphics/fun/netbunnies/lavender.jpg
615 0.02%29/Mar/05 08:30/graphics/fun/netbunnies/sunny1-hansen1.jpg
615 0.02%29/Mar/05 09:28/graphics/fun/netbunnies/bubbles-ng1.jpg
615 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/bunny-zietlow1.jpg
615 0.01%29/Mar/05 09:48/graphics/fun/netbunnies/lucky-woofenden1.jpg
615 0.01%29/Mar/05 09:36/graphics/fun/netbunnies/bunny1-vegton1.jpg
615 0.02%29/Mar/05 09:51/graphics/fun/netbunnies/booboo1-strohmeyer1.jpg
615 0.01%29/Mar/05 09:49/graphics/fun/netbunnies/dickens-bon1.jpg
615 0.03%29/Mar/05 09:31/graphics/fun/netbunnies/bunbun-szafranski1.jpg
615 0.01%29/Mar/05 09:47/graphics/fun/netbunnies/Willy.jpg
615 0.01%29/Mar/05 09:57/graphics/fun/netbunnies/hops5.jpg
615 0.01%29/Mar/05 09:36/graphics/fun/netbunnies/midnight-pasquarello1.jpg
614 0.02%29/Mar/05 09:39/graphics/fun/netbunnies/cuddles+lillian-porter1.jpg
614 0.01%29/Mar/05 09:31/graphics/fun/netbunnies/bunny-sugalski1.jpg
614 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/pebbles-hearn1.jpg
614 0.02%29/Mar/05 08:50/graphics/fun/netbunnies/freckles-Cathy1.jpg
614 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/turbo1-tam1.jpg
614 0.02%29/Mar/05 04:19/chapters/san-diego/adoption/happy_adoptions.html
614 0.02%29/Mar/05 09:17/graphics/fun/netbunnies/f1.jpg
614 0.02%29/Mar/05 09:49/graphics/fun/netbunnies/chester1-Tree1.jpg
614 0.01%29/Mar/05 09:35/graphics/fun/netbunnies/tups-oasisfreak1.jpg
614 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/pasha-story1.jpg
613 0.04%29/Mar/05 09:57/graphics/fun/netbunnies/bartside.jpg
613 0.01%29/Mar/05 09:06/graphics/fun/netbunnies/calvin1-pope1.jpg
613 0.03%29/Mar/05 09:40/graphics/fun/netbunnies/mister-kaoricat1.jpg
613 0.03%29/Mar/05 08:47/graphics/fun/netbunnies/bunny3-Blair1.jpg
613 0.02%29/Mar/05 09:49/graphics/fun/netbunnies/hare-harebrain1.jpg
613 0.01%29/Mar/05 09:52/graphics/fun/netbunnies/basil1.jpg
613 0.01%29/Mar/05 09:50/graphics/fun/netbunnies/harvey-zorro1.jpg
613 0.02%29/Mar/05 06:20/graphics/fun/netbunnies/bunny-martinez1.jpg
613 0.03%29/Mar/05 07:59/graphics/fun/netbunnies/benny-applin1.jpg
613 0.02%29/Mar/05 09:44/graphics/fun/netbunnies/marley-phelan1.jpg
613 0.02%29/Mar/05 09:04/graphics/fun/netbunnies/dakota1-angelo1.jpg
613 0.02%29/Mar/05 07:49/graphics/fun/netbunnies/bunnies7-doerfler1.jpg
613 0.02%29/Mar/05 05:58/graphics/fun/netbunnies/maybe-kat1.jpg
613 0.03%29/Mar/05 08:46/graphics/fun/netbunnies/bobby-Chuck1.jpg
613 0.01%29/Mar/05 06:17/graphics/fun/netbunnies/bunnyday-bastian1.jpg
613 0.02%29/Mar/05 09:30/graphics/fun/netbunnies/ears1-magee1.jpg
612 0.02%29/Mar/05 08:20/graphics/fun/netbunnies/bungalo-salisbury1.jpg
612 0.02%29/Mar/05 09:28/graphics/fun/netbunnies/eric15.jpg
612 0.02%29/Mar/05 09:41/graphics/fun/netbunnies/thumper1-gitter1.jpg
612 0.02%29/Mar/05 09:49/graphics/fun/netbunnies/mackenzie-cunningham1.jpg
612 0.01%29/Mar/05 09:55/graphics/fun/netbunnies/molly-caulders1.jpg
612 0.01%29/Mar/05 06:09/graphics/fun/netbunnies/beastd-Hawkins1.jpg
612 0.02%29/Mar/05 09:50/graphics/fun/netbunnies/kate-haviva1.jpg
612 0.03%29/Mar/05 09:57/graphics/fun/netbunnies/kobe2-segers1.jpg
612 0.01%29/Mar/05 09:55/graphics/fun/netbunnies/basil1-bivona1.jpg
612 0.03%29/Mar/05 06:23/graphics/fun/netbunnies/hazel-digicult1.jpg
612 0.01%29/Mar/05 09:51/graphics/fun/netbunnies/dusty-castro1.jpg
612 0.02%29/Mar/05 09:30/graphics/fun/netbunnies/boba4-shi1.jpg
612 0.01%29/Mar/05 09:51/graphics/fun/netbunnies/soleil-racicot1.jpg
611 0.01%29/Mar/05 09:50/graphics/fun/netbunnies/maggie-Dooley1.jpg
611 0.02%29/Mar/05 09:19/graphics/fun/netbunnies/glamorous.jpg
611 0.01%29/Mar/05 09:51/graphics/fun/netbunnies/bunny1-chica1.jpg
611 0.01%29/Mar/05 06:13/graphics/fun/netbunnies/bunbun-young1.jpg
611 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/bunny3-wu1.jpg
611 0.01%29/Mar/05 09:48/graphics/fun/netbunnies/waabooz1-erin1.jpg
611 0.02%29/Mar/05 09:39/graphics/fun/netbunnies/oreo-hunnie1.jpg
611 0.01%29/Mar/05 07:53/graphics/fun/netbunnies/bramwell-nelson1.jpg
611 0.02%29/Mar/05 09:56/graphics/fun/netbunnies/scotty-kuryuzawa1.jpg
611 0.01%29/Mar/05 09:54/graphics/fun/netbunnies/bandit-wachowiak1.jpg
611 0.03%29/Mar/05 06:13/graphics/fun/netbunnies/harvey-birch1.jpg
611 0.01%29/Mar/05 06:21/graphics/fun/netbunnies/thunder2-jacqueline1.jpg
611 0.03%29/Mar/05 05:18/graphics/fun/netbunnies/betabrownrabbitbybookcase.jpg
611 0.02%29/Mar/05 08:59/graphics/fun/netbunnies/willow3-stardancer1.jpg
611 0.01%29/Mar/05 09:04/graphics/fun/netbunnies/bunnies3-kimberley1.jpg
611 0.02%29/Mar/05 09:59/graphics/fun/netbunnies/bunny-bonniebee1.jpg
611 0.01%29/Mar/05 09:59/graphics/fun/netbunnies/georgia-janes1.jpg
611 0.01%29/Mar/05 09:44/graphics/fun/netbunnies/jewel-pratt1.jpg
611 0.02%29/Mar/05 09:56/graphics/fun/netbunnies/punkin-dujardin1.jpg
611 0.01%29/Mar/05 08:45/graphics/fun/netbunnies/thumper-roxy3-bailey1.jpg
610 0.02%29/Mar/05 09:14/graphics/fun/netbunnies/rusty-forsythe1.jpg
610 0.02%29/Mar/05 09:14/graphics/fun/netbunnies/ned-betts1.jpg
610 0.01%29/Mar/05 09:01/graphics/fun/netbunnies/betty-Harris1.jpg
610 0.01%29/Mar/05 09:54/graphics/fun/netbunnies/emily2-marroney1.jpg
610 0.01%29/Mar/05 09:46/graphics/fun/netbunnies/bunbun-Caines1.jpg
610 0.03%29/Mar/05 07:26/graphics/fun/netbunnies/cinnamon3-carisbug1.jpg
610 0.02%29/Mar/05 09:59/chapters/san-diego/behavior/bunnyproofing.html
610 0.02%29/Mar/05 06:16/graphics/fun/netbunnies/superbunny-hiebert1.jpg
610 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/huggies-Caulders1.jpg
610 0.03%29/Mar/05 09:14/graphics/fun/netbunnies/deckland-steven1.jpg
610 0.02%29/Mar/05 07:58/graphics/fun/netbunnies/minirex-lane1.jpg
610 0.01%29/Mar/05 09:55/graphics/fun/netbunnies/peanut-montgomery1.jpg
610 0.01%29/Mar/05 09:38/graphics/fun/netbunnies/pichi1-lopez1.jpg
610 0.02%29/Mar/05 04:53/graphics/fun/netbunnies/fibby2-orozco1.jpg
610 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/rabbie-cooper1.jpg
610 0.02%29/Mar/05 09:23/graphics/fun/netbunnies/ponpon-herrera1.jpg
609 0.02%29/Mar/05 08:57/graphics/fun/netbunnies/music-yoshimura1.jpg
609 0.01%29/Mar/05 09:46/graphics/fun/netbunnies/lulu-velas1.jpg
609 28/Mar/05 22:02/easter/flyer/title.gif
609 0.02%28/Mar/05 23:52/graphics/fun/netbunnies/annie.jpg
609 0.02%29/Mar/05 09:48/graphics/fun/netbunnies/amelia1-shay1.jpg
609 0.03%29/Mar/05 09:21/graphics/fun/netbunnies/copper-rsaqglong1.jpg
609 0.01%29/Mar/05 09:43/graphics/fun/netbunnies/kurosawa-king1.jpg
609 0.03%29/Mar/05 09:45/graphics/fun/netbunnies/hamilton-camelot1.jpg
609 0.03%29/Mar/05 09:37/graphics/fun/netbunnies/TrixieGourmet-Oathay1.jpg
609 0.02%29/Mar/05 09:48/graphics/fun/netbunnies/tepp2-noa1.jpg
608 0.01%29/Mar/05 09:49/graphics/fun/netbunnies/shaz-seay1.jpg
608 0.02%29/Mar/05 09:56/graphics/fun/netbunnies/fall-anderson1.jpg
608 0.01%29/Mar/05 09:57/graphics/fun/netbunnies/rabbits-beth1jpg.jpg
608 0.02%29/Mar/05 09:31/graphics/fun/netbunnies/dottie-tao1.jpg
608 0.01%29/Mar/05 09:05/graphics/fun/netbunnies/mrsbunny-beebe1.jpg
608 0.02%29/Mar/05 09:28/graphics/fun/netbunnies/sesarog-hos1.jpg
608 0.02%29/Mar/05 09:49/graphics/fun/netbunnies/magic-christina1.jpg
608 0.01%29/Mar/05 09:49/graphics/fun/netbunnies/rab4-vinkaz1.jpg
608 0.02%29/Mar/05 09:12/graphics/fun/netbunnies/bunny5-baker1.jpg
608 0.01%29/Mar/05 05:32/graphics/fun/netbunnies/snugglebuns-intelligoth1.jpg
608 0.01%29/Mar/05 09:51/graphics/fun/netbunnies/fufus23.jpg
608 0.01%29/Mar/05 09:55/graphics/fun/netbunnies/cedy-holden1.jpg
608 0.02%29/Mar/05 08:29/graphics/fun/netbunnies/cc30.jpg
608 0.11%29/Mar/05 08:00/graphics/fun/netbunnies/pitfou-reinhart1.jpg
607 0.04%29/Mar/05 09:03/graphics/fun/netbunnies/buns1-schnellbach1.jpg
607 0.01%29/Mar/05 09:49/graphics/fun/netbunnies/kaysi-fairhurst1.jpg
607 0.02%29/Mar/05 09:05/graphics/fun/netbunnies/nestle-avery1.jpg
607 0.04%29/Mar/05 09:51/graphics/fun/netbunnies/santarabbitandpresentkarasi.jpg
607 29/Mar/05 09:10/easter/kids.html
607 0.01%29/Mar/05 09:54/graphics/books/soup.gif
607 0.02%29/Mar/05 08:22/graphics/fun/netbunnies/baileybunny-Chaplin1.jpg
607 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/mojave2-brown1.jpg
607 0.02%29/Mar/05 09:59/graphics/fun/netbunnies/lily-noir1.jpg
607 0.01%29/Mar/05 09:03/graphics/fun/netbunnies/jonathan-meimei1.jpg
607 0.02%29/Mar/05 09:43/graphics/fun/netbunnies/bailie-micci1.jpg
606 0.04%29/Mar/05 09:46/graphics/fun/netbunnies/rishchris-Hunt1.jpg
606 0.02%29/Mar/05 09:03/graphics/fun/netbunnies/callie-caple1.jpg
606 0.03%29/Mar/05 09:16/graphics/fun/netbunnies/bella1-beth1.jpg
606 0.02%29/Mar/05 09:06/graphics/fun/netbunnies/freckles-mullins1.jpg
606 0.01%29/Mar/05 07:25/graphics/fun/netbunnies/bubba-capps1.jpg
606 0.02%29/Mar/05 09:52/graphics/fun/netbunnies/isidore-wright1.jpg
606 0.02%29/Mar/05 09:36/graphics/fun/netbunnies/umichum2-lapitan1.jpg
606 0.02%29/Mar/05 09:54/graphics/fun/netbunnies/usagi-king1.jpg
606 0.01%29/Mar/05 09:31/graphics/fun/netbunnies/rabbit1-klarman1.jpg
606 0.02%29/Mar/05 09:47/graphics/fun/netbunnies/bones-Chuck1.jpg
606 0.02%29/Mar/05 08:49/graphics/fun/netbunnies/hazel-garver1.jpg
606 0.03%29/Mar/05 09:52/graphics/fun/netbunnies/nelly3-salter1.jpg
606 0.02%29/Mar/05 08:58/graphics/fun/netbunnies/bunny3-basmayer1.jpg
606 0.02%29/Mar/05 09:29/graphics/fun/netbunnies/floppy-taylor1.jpg
606 0.02%29/Mar/05 06:59/graphics/fun/netbunnies/bunny22.jpg
606 0.04%29/Mar/05 09:54/graphics/fun/netbunnies/pebbles3-cliff1.jpg
606 0.01%29/Mar/05 08:41/graphics/fun/netbunnies/smokey-donovan1.jpg
606 0.02%29/Mar/05 09:13/graphics/fun/netbunnies/dillon-fairhurst1.jpg
606 0.02%29/Mar/05 09:43/graphics/fun/netbunnies/george-wesirucj1.jpg
606 0.02%29/Mar/05 09:07/graphics/fun/netbunnies/maeve-ellis1.jpg
605 0.02%29/Mar/05 09:44/graphics/fun/netbunnies/blackberry2-leen1.jpg
605 0.02%29/Mar/05 09:14/graphics/fun/netbunnies/bunky2-needler1.jpg
605 0.03%29/Mar/05 09:16/graphics/fun/netbunnies/kili-kamp1.jpg
605 0.02%29/Mar/05 09:51/graphics/fun/netbunnies/chloe-rhonda1.jpg
605 0.02%29/Mar/05 09:29/graphics/fun/netbunnies/thegirls.jpg
605 0.01%29/Mar/05 09:57/graphics/fun/netbunnies/fluffy-mauler1.jpg
605 0.02%29/Mar/05 09:24/graphics/fun/netbunnies/crissinina-correa1.jpg
605 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/daisy1-schnellbach1.jpg
605 0.02%29/Mar/05 08:25/graphics/fun/netbunnies/cadbury-gilbert1.jpg
605 0.03%29/Mar/05 09:37/graphics/fun/netbunnies/roy1-bunnylvr1.jpg
605 0.01%29/Mar/05 09:50/graphics/fun/netbunnies/dusty-sitsiuq1.jpg
605 0.01%29/Mar/05 09:57/graphics/fun/netbunnies/ivy1-scarfone1.jpg
605 0.03%29/Mar/05 09:20/graphics/fun/netbunnies/busterwithlowerteeth.jpg
604 0.01%29/Mar/05 09:54/graphics/fun/netbunnies/hsbox-thomas1.jpg
604 0.01%29/Mar/05 08:47/graphics/fun/netbunnies/belle1-capps1.jpg
604 0.03%29/Mar/05 09:36/graphics/fun/netbunnies/bunbun-allbriggidy1.jpg
604 0.03%29/Mar/05 09:56/graphics/fun/netbunnies/wyatt-watson1.jpg
604 0.01%29/Mar/05 09:58/graphics/fun/netbunnies/nibblet2-ward1.jpg
604 0.03%29/Mar/05 09:30/graphics/fun/netbunnies/eeyore-guinn1.jpg
604 0.01%29/Mar/05 09:52/graphics/fun/netbunnies/einstein-kristen1.jpg
604 0.02%29/Mar/05 08:45/graphics/fun/netbunnies/conejo4-Collado1.jpg
604 0.01%29/Mar/05 09:41/graphics/fun/netbunnies/buddy1-elliott1.jpg
603 0.01%29/Mar/05 09:01/graphics/fun/netbunnies/mfaces.jpg
603 0.01%29/Mar/05 09:56/graphics/fun/netbunnies/litlu-hos1.jpg
603 0.01%29/Mar/05 09:13/graphics/fun/netbunnies/p_mlou.jpg
603 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/thumber-corkery1.jpg
603 0.02%29/Mar/05 06:26/graphics/fun/netbunnies/kralina-springerova1.jpg
603 0.02%29/Mar/05 09:56/graphics/fun/netbunnies/peaches-blanchard1.jpg
603 0.02%29/Mar/05 09:49/graphics/fun/netbunnies/rabbit-hurley1.jpg
603 0.02%29/Mar/05 09:43/graphics/fun/netbunnies/rabbit4-birgit1.jpg
603 0.02%29/Mar/05 09:59/graphics/fun/netbunnies/bigbun-Hardai1.jpg
603 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/speckles+yoshi-strope1.jpg
603 0.02%29/Mar/05 08:54/graphics/fun/netbunnies/boo-wal1.jpg
603 0.01%29/Mar/05 07:59/graphics/fun/netbunnies/cleanfoot.jpg
603 0.01%29/Mar/05 09:13/graphics/fun/netbunnies/bunnies1-kimberley1.jpg
603 0.01%29/Mar/05 09:52/graphics/fun/netbunnies/blackie.jpg
603 0.02%29/Mar/05 06:09/graphics/fun/netbunnies/winnie-sugalski1.jpg
603 0.02%29/Mar/05 09:51/graphics/fun/netbunnies/bed.jpg
603 0.04%29/Mar/05 09:51/graphics/fun/netbunnies/bunny20-Kaldal1.jpg
603 0.01%29/Mar/05 00:06/graphics/fun/netbunnies/deliverance-avery1.jpg
603 0.03%29/Mar/05 09:57/graphics/fun/netbunnies/butz1-french1.jpg
603 0.01%29/Mar/05 09:23/graphics/fun/netbunnies/rura1-Anna1.jpg
603 0.01%29/Mar/05 09:50/graphics/fun/netbunnies/bunny1-oneill1.jpg
603 0.01%29/Mar/05 09:56/graphics/fun/netbunnies/pintobow.jpg
602 0.01%29/Mar/05 09:01/graphics/fun/netbunnies/oeddie-henry1.jpg
602 0.02%29/Mar/05 08:44/graphics/fun/netbunnies/bun4-Breese1.jpg
602 0.02%29/Mar/05 09:04/graphics/fun/netbunnies/willie-martin1.jpg
602 0.01%29/Mar/05 05:11/graphics/fun/netbunnies/buster-nad1.jpg
602 0.01%29/Mar/05 09:03/graphics/fun/netbunnies/caramel-flannery1.jpg
602 0.02%29/Mar/05 09:52/graphics/fun/netbunnies/rabbit-kissoon1.jpg
602 0.02%29/Mar/05 08:51/graphics/fun/netbunnies/boomer-frolich1.jpg
602 0.01%29/Mar/05 08:22/graphics/fun/netbunnies/lennard2-McSweeney1.jpg
602 0.02%29/Mar/05 09:59/graphics/fun/netbunnies/buggzy-pinto1.jpg
602 0.03%29/Mar/05 09:43/graphics/fun/netbunnies/bunny7-stasinos1.jpg
602 0.03%29/Mar/05 09:39/graphics/fun/netbunnies/bunnies-borealis1.jpg
601 0.04%29/Mar/05 09:22/graphics/fun/netbunnies/rabbit2-Blair1.jpg
601 0.01%29/Mar/05 08:46/graphics/fun/netbunnies/smokey+daisy-jack1.jpg
601 0.01%29/Mar/05 09:14/graphics/fun/netbunnies/lilly-peterson1.jpg
601 0.01%29/Mar/05 09:45/graphics/fun/netbunnies/buninpot4.jpg
601 0.02%29/Mar/05 09:13/graphics/fun/netbunnies/dande1-smigo1.jpg
601 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/maplecocoa-cook1.jpg
601 0.03%29/Mar/05 09:40/graphics/fun/netbunnies/bundles-denicourt1.jpg
601 0.02%29/Mar/05 09:43/graphics/fun/netbunnies/rabbit5-nycx1.jpg
601 0.02%29/Mar/05 09:45/graphics/fun/netbunnies/timmysitting-Anderson1.jpg
601 0.01%29/Mar/05 09:47/graphics/fun/netbunnies/rabbit-elamk1.jpg
601 0.05%29/Mar/05 03:53/graphics/fun/netbunnies/receptionist-rabbit-chen.jpg
601 0.02%29/Mar/05 09:56/graphics/fun/netbunnies/bunny4-lee1.jpg
601 0.01%29/Mar/05 09:05/graphics/fun/netbunnies/bunzone2.jpg
601 0.02%29/Mar/05 09:37/graphics/fun/netbunnies/slopers-mcconville1.jpg
600 0.01%29/Mar/05 09:57/graphics/fun/netbunnies/kizzy1-hughes1.jpg
600 0.01%29/Mar/05 08:41/graphics/fun/netbunnies/bobo-gabriella1.jpg
600 0.02%29/Mar/05 09:51/graphics/fun/netbunnies/tink+ollie-habel1.jpg
600 0.01%29/Mar/05 09:45/graphics/fun/netbunnies/fiona1-broley1.jpg
600 0.02%29/Mar/05 06:20/graphics/fun/netbunnies/chocolate1-ko1.jpg
600 0.01%29/Mar/05 09:48/graphics/fun/netbunnies/gilligan-douglas1.jpg
600 0.02%29/Mar/05 09:06/graphics/fun/netbunnies/bunnies9-doerfler1.jpg
600 0.02%29/Mar/05 08:55/graphics/fun/netbunnies/snix-fields1.jpg
600 0.02%29/Mar/05 09:36/graphics/fun/netbunnies/blade-Ian1.jpg
600 0.01%29/Mar/05 05:18/graphics/fun/netbunnies/skywalker-wachowiak1.jpg
600 0.01%29/Mar/05 09:30/graphics/fun/netbunnies/javajoe-forsythe1.jpg
600 0.03%29/Mar/05 09:36/graphics/fun/netbunnies/bun3-Hodgett1.jpg
600 0.02%29/Mar/05 09:55/graphics/fun/netbunnies/buns2-martinez1.jpg
600 0.01%29/Mar/05 09:01/graphics/fun/netbunnies/cam.jpg
600 0.02%29/Mar/05 09:13/graphics/fun/netbunnies/coolrabbit.jpg
600 0.01%29/Mar/05 08:14/adoption/overpopulation.html
600 0.02%29/Mar/05 09:59/graphics/fun/netbunnies/boozie-dewhurst1.jpg
600 0.02%29/Mar/05 09:06/graphics/fun/netbunnies/biscus-schtomp-davidson1.jpg
600 0.01%29/Mar/05 08:59/graphics/fun/netbunnies/austin1-rhonda1.jpg
600 0.02%29/Mar/05 09:23/graphics/fun/netbunnies/nibbles-floyd1.jpg
600 0.03%29/Mar/05 09:38/graphics/fun/netbunnies/lollie-harris1.jpg
600 0.01%29/Mar/05 09:16/graphics/fun/netbunnies/otto-ninespike1.jpg
599 0.01%29/Mar/05 09:29/graphics/fun/netbunnies/dopey_daphne-chen1.jpg
599 0.05%29/Mar/05 06:12/graphics/fun/netbunnies/eliott-9mon-hopp-bag.jpg
599 0.02%29/Mar/05 08:53/graphics/fun/netbunnies/brandi2-rhoda1.jpg
599 0.02%29/Mar/05 09:07/graphics/fun/netbunnies/benny-vanauken1.jpg
599 0.02%29/Mar/05 09:43/graphics/fun/netbunnies/doe+panda-howo1.jpg
599 0.02%29/Mar/05 09:56/graphics/fun/netbunnies/rabbits4-reeves1.jpg
599 0.01%29/Mar/05 05:56/fun/tiny-tim.html
599 0.01%29/Mar/05 09:55/graphics/fun/netbunnies/bunnybutts2-spence1.jpg
599 0.02%29/Mar/05 08:56/graphics/fun/netbunnies/ginger2-herrington1.jpg
599 0.02%29/Mar/05 08:32/graphics/fun/netbunnies/bugs-danaher1.jpg
599 0.01%29/Mar/05 09:49/graphics/fun/netbunnies/trixie-traylor1.jpg
599 0.01%29/Mar/05 09:51/graphics/fun/netbunnies/scotchcutie-thomas1.jpg
598 0.01%29/Mar/05 09:35/graphics/fun/netbunnies/dcp.jpg
598 0.02%29/Mar/05 09:37/graphics/fun/netbunnies/bunny2-heinsma1.jpg
598 0.03%29/Mar/05 07:25/graphics/fun/netbunnies/foosasha-Miller1.jpg
598 0.01%29/Mar/05 09:47/adoption/finding-a-new-home.html
598 0.04%29/Mar/05 09:38/graphics/fun/netbunnies/nero-daker1.jpg
598 0.02%29/Mar/05 08:12/graphics/fun/netbunnies/sylvie4-robinson1.jpg
598 0.02%29/Mar/05 09:59/graphics/fun/netbunnies/fluff2-lee1.jpg
598 0.02%29/Mar/05 09:02/graphics/fun/netbunnies/pic00018.jpg
598 0.01%29/Mar/05 09:49/graphics/fun/netbunnies/peterbenben-eng1.jpg
598 0.01%29/Mar/05 09:49/graphics/fun/netbunnies/thumper-vaga1.jpg
598 0.02%29/Mar/05 09:05/graphics/fun/netbunnies/buckyshadow-jackson1.jpg
598 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/midnight1-mue1.jpg
598 0.01%29/Mar/05 09:35/graphics/fun/netbunnies/busterbabs-schneckloth1.jpg
598 0.02%29/Mar/05 09:38/graphics/fun/netbunnies/sofee-friedmann1.jpg
598 0.02%29/Mar/05 09:48/graphics/fun/netbunnies/munches-gilreath1.jpg
597 0.02%29/Mar/05 09:17/graphics/fun/netbunnies/snugglesnoodles-Yoder1.jpg
597 0.02%29/Mar/05 09:44/graphics/fun/netbunnies/rabbit-chercat1.jpg
597 0.02%29/Mar/05 09:04/graphics/fun/netbunnies/paul24-Tini1.jpg
597 0.02%29/Mar/05 09:09/graphics/fun/netbunnies/clover2-sumanski1.jpg
597 0.01%29/Mar/05 09:04/graphics/fun/netbunnies/pandora-heidi1.jpg
597 0.02%29/Mar/05 08:57/graphics/fun/netbunnies/croppedbunny-emily1.jpg
597 0.01%29/Mar/05 08:53/graphics/fun/netbunnies/rose-doubleday1.jpg
597 0.02%29/Mar/05 09:28/graphics/fun/netbunnies/trinityhiphop-fischer1.jpg
597 0.01%29/Mar/05 09:31/graphics/fun/netbunnies/buns2-schnellbach1.jpg
597 0.02%29/Mar/05 09:32/graphics/fun/netbunnies/bunny2-spence1.jpg
597 0.01%29/Mar/05 07:58/graphics/fun/netbunnies/bunnie2-hatton1.jpg
597 0.02%29/Mar/05 07:22/graphics/fun/netbunnies/bun-barnett1.jpg
597 0.02%29/Mar/05 08:31/graphics/fun/netbunnies/kiss2-Kirkham1.jpg
597 0.01%29/Mar/05 09:14/graphics/fun/netbunnies/shgizzo-massimo1.jpg
597 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/hops3-attila1.jpg
596 0.06%29/Mar/05 09:24/graphics/fun/netbunnies/minnie-doe-3yr-outside.jpg
596 0.01%29/Mar/05 09:05/graphics/fun/netbunnies/lucy+stinky-wangchuk1.jpg
596 0.01%29/Mar/05 08:01/graphics/fun/netbunnies/fruitloop-debbie1.jpg
596 0.02%29/Mar/05 09:38/graphics/fun/netbunnies/dave-hamilton1.jpg
596 0.01%29/Mar/05 09:52/graphics/fun/netbunnies/bunny8-Baker1.jpg
596 0.02%29/Mar/05 09:30/graphics/fun/netbunnies/stewit-Clifford1.jpg
596 0.01%29/Mar/05 09:46/graphics/fun/netbunnies/janks1-kelly1.jpg
596 0.02%29/Mar/05 09:05/graphics/fun/netbunnies/garden-fischer1.jpg
596 0.02%29/Mar/05 09:50/graphics/fun/netbunnies/rocky-Cathy1.jpg
596 0.01%29/Mar/05 09:41/graphics/fun/netbunnies/cammie-thiene1.jpg
596 0.02%29/Mar/05 08:21/graphics/fun/netbunnies/rabbits-millikin1.jpg
596 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/gimli2-schroede1.jpg
596 0.02%29/Mar/05 09:27/graphics/fun/netbunnies/tubby-tima1.jpg
595 0.02%29/Mar/05 09:14/graphics/fun/netbunnies/trin-fischer1.jpg
595 0.02%29/Mar/05 09:31/graphics/fun/netbunnies/bunny-brry1.jpg
595 0.01%29/Mar/05 06:23/graphics/fun/netbunnies/thumper-button1.jpg
595 0.01%29/Mar/05 08:58/graphics/fun/netbunnies/little punk-sukiennik1.jpg
595 0.01%29/Mar/05 09:29/graphics/fun/netbunnies/roozelda1-gannon1.jpg
595 0.05%29/Mar/05 09:04/graphics/fun/netbunnies/strawberry-white-baby.jpg
595 0.01%29/Mar/05 09:45/graphics/fun/netbunnies/bunny2-libby1.jpg
595 0.01%29/Mar/05 09:49/graphics/fun/netbunnies/fatlady1-piglet1.jpg
595 0.03%29/Mar/05 08:31/graphics/fun/netbunnies/scampers-fahlman1.jpg
595 0.01%29/Mar/05 09:57/graphics/fun/netbunnies/bunny4-heinsma1.jpg
595 0.02%29/Mar/05 09:18/graphics/fun/netbunnies/hailey-politzer1.jpg
595 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/bunnibun-jones1.jpg
595 0.01%29/Mar/05 07:58/graphics/fun/netbunnies/sparkiesnow-small1.jpg
594 0.02%29/Mar/05 09:06/graphics/fun/netbunnies/bianca-dudette1.jpg
594 0.01%29/Mar/05 03:19/graphics/fun/netbunnies/bugzie3-ashby1.jpg
594 0.03%29/Mar/05 09:52/graphics/fun/netbunnies/onemore-yong1.jpg
594 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/max-harkrader1.jpg
594 0.02%29/Mar/05 05:58/graphics/fun/netbunnies/muppet-warwick1.jpg
594 0.01%29/Mar/05 09:46/graphics/fun/netbunnies/oreo-samantha1.jpg
594 29/Mar/05 09:50/graphics/fun/netbunnies/spencer-bianca.jpg
594 0.01%29/Mar/05 08:48/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Premium_booth.JPG
594 0.01%29/Mar/05 08:00/graphics/fun/netbunnies/gimmel1-feitelberg1.jpg
594 0.01%29/Mar/05 09:40/graphics/fun/netbunnies/midnight1-pasquarello1.jpg
594 0.02%29/Mar/05 09:31/graphics/fun/netbunnies/ruby2-renee1.jpg
594 0.03%29/Mar/05 09:55/graphics/fun/netbunnies/frog-mypetsrule1.jpg
594 0.02%29/Mar/05 09:51/graphics/fun/netbunnies/duncan13.jpg
594 0.01%29/Mar/05 09:51/graphics/fun/netbunnies/jack-clasby1.jpg
594 0.03%29/Mar/05 06:42/graphics/fun/netbunnies/benbun-sadoway1.jpg
594 0.01%29/Mar/05 05:48/graphics/fun/netbunnies/queenofthehill2.jpg
594 0.02%29/Mar/05 09:27/graphics/fun/netbunnies/puput-merikanto1.jpg
593 0.03%29/Mar/05 09:58/graphics/fun/netbunnies/bunnies2-grimes1.jpg
593 0.01%29/Mar/05 09:55/graphics/fun/netbunnies/jo-m.jpg
593 0.02%29/Mar/05 08:50/graphics/fun/netbunnies/four-Zdila1.jpg
593 0.03%29/Mar/05 09:05/graphics/fun/netbunnies/bunnies2-schroeder1.jpg
593 0.01%29/Mar/05 09:39/graphics/fun/netbunnies/bunny-anderson1.jpg
593 0.02%29/Mar/05 09:37/graphics/fun/netbunnies/ivan1-sierra1.jpg
593 0.03%29/Mar/05 09:41/graphics/fun/netbunnies/bunny2-wu1.jpg
593 0.01%29/Mar/05 09:51/graphics/fun/netbunnies/bigwig2.jpg
593 0.01%29/Mar/05 09:13/graphics/fun/netbunnies/cute-diva1.jpg
593 0.02%29/Mar/05 08:27/graphics/fun/netbunnies/farmer-canade1.jpg
593 0.01%29/Mar/05 06:24/graphics/fun/netbunnies/ben2-mack1.jpg
593 0.02%29/Mar/05 09:39/graphics/fun/netbunnies/blueberry2-perillat1.jpg
593 0.01%29/Mar/05 09:15/graphics/fun/netbunnies/boncuk1-sahinalp1.jpg
593 0.02%29/Mar/05 09:50/graphics/fun/netbunnies/rabbits-tonge1.jpg
593 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/sherlock.jpg
593 0.03%29/Mar/05 09:52/graphics/fun/netbunnies/tracy.jpg
593 0.04%29/Mar/05 09:57/graphics/fun/netbunnies/bunny1-blair1.jpg
593 0.04%29/Mar/05 09:09/rabbit-center/lucky/images/lucky20ondock_000.jpg
593 0.03%29/Mar/05 09:15/graphics/fun/netbunnies/lulu2-giordano1.jpg
593 0.02%29/Mar/05 09:41/graphics/fun/netbunnies/rabbit-kogan1.jpg
592 0.02%29/Mar/05 09:22/graphics/fun/netbunnies/petey-caulders1.jpg
592 0.02%29/Mar/05 09:02/graphics/fun/netbunnies/tcereal-lamay1.jpg
592 0.02%29/Mar/05 09:09/rabbit-center/lucky/images/abusersondock_000.jpg
592 0.01%29/Mar/05 09:14/graphics/fun/netbunnies/ollie-cherry1.jpg
592 0.03%29/Mar/05 09:28/graphics/fun/netbunnies/feebie-cooke1.jpg
592 0.02%29/Mar/05 09:30/graphics/fun/netbunnies/oreo-riefle1.jpg
592 0.02%29/Mar/05 09:15/graphics/fun/netbunnies/billy-sharwell1.jpg
592 0.01%29/Mar/05 09:45/graphics/fun/netbunnies/georgie_lake1.jpg
592 0.01%29/Mar/05 08:44/graphics/fun/netbunnies/r957cadbury50tiny.jpg
592 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/dexter-correa1.jpg
592 0.01%29/Mar/05 09:45/graphics/fun/netbunnies/punkin-harmon1.jpg
591 0.02%29/Mar/05 09:56/graphics/fun/netbunnies/dulcy-storms1.jpg
591 0.01%29/Mar/05 09:49/graphics/fun/netbunnies/parsley1.jpg
591 0.01%29/Mar/05 09:55/graphics/fun/netbunnies/wally-relaxing.jpg
591 29/Mar/05 09:25/graphics/fun/netbunnies/spencer-profile.jpg
591 0.01%29/Mar/05 09:05/graphics/fun/netbunnies/bubzy-sydney1.jpg
591 0.02%29/Mar/05 05:48/graphics/fun/netbunnies/josey-kwmsp1.jpg
591 0.01%29/Mar/05 09:39/graphics/fun/netbunnies/milo-magyar1.jpg
591 0.01%29/Mar/05 09:36/graphics/fun/netbunnies/sleep.jpg
591 0.02%29/Mar/05 09:36/graphics/fun/netbunnies/niblet-muto1.jpg
591 0.03%29/Mar/05 09:52/graphics/fun/netbunnies/starsky-carrington1.jpg
591 0.02%29/Mar/05 09:14/graphics/fun/netbunnies/peetie-chaney1.jpg
591 0.01%29/Mar/05 08:32/graphics/fun/netbunnies/cadbury-mustang1.jpg
591 0.01%29/Mar/05 08:28/graphics/fun/netbunnies/chewie-linda1.jpg
591 0.02%29/Mar/05 09:55/graphics/fun/netbunnies/nicke-igen1.jpg
590 0.01%29/Mar/05 06:04/graphics/fun/netbunnies/oatmeal3-heather1.jpg
590 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/musashi-king1.jpg
590 0.01%29/Mar/05 07:48/graphics/fun/netbunnies/att00218.jpeg
590 0.01%29/Mar/05 09:50/graphics/fun/netbunnies/bunny-gasparick1.jpg
590 0.02%29/Mar/05 09:04/graphics/fun/netbunnies/selleck-allen1.jpg
590 0.01%29/Mar/05 09:56/chapters/san-diego/health/sex.html
590 0.03%29/Mar/05 09:45/graphics/fun/netbunnies/pokey1-chiang1.jpg
590 0.02%29/Mar/05 07:59/graphics/fun/netbunnies/bunny-morton1.jpg
590 0.01%29/Mar/05 09:50/graphics/fun/netbunnies/pashmina-garbos1.jpg
590 0.02%29/Mar/05 09:48/graphics/fun/netbunnies/guy1-bokhart1.jpg
590 0.02%29/Mar/05 09:52/graphics/fun/netbunnies/ben-trent1.jpg
590 0.03%29/Mar/05 09:40/graphics/fun/netbunnies/dip1-tagliamonte1.jpg
590 0.03%29/Mar/05 09:29/graphics/fun/netbunnies/hazel-majane1.jpg
590 0.04%29/Mar/05 09:35/graphics/fun/netbunnies/rabbit-Kylensarah1.jpg
590 0.01%29/Mar/05 01:58/graphics/fun/netbunnies/bunny3-karra1.jpg
589 0.01%29/Mar/05 09:56/graphics/fun/netbunnies/casey&min-Cathy2.jpg
589 0.01%29/Mar/05 08:55/graphics/fun/netbunnies/melanie-rath1.jpg
589 0.01%29/Mar/05 09:20/graphics/fun/netbunnies/trio-nye1.jpg
589 0.01%29/Mar/05 09:36/graphics/fun/netbunnies/dust-Caines1.jpg
589 0.02%29/Mar/05 08:53/graphics/fun/netbunnies/rabbit2-young1.jpg
589 0.02%29/Mar/05 09:40/graphics/fun/netbunnies/rabbits1-deb1.jpg
589 0.01%29/Mar/05 09:55/graphics/fun/netbunnies/reflection-Zdila1.jpg
589 0.02%29/Mar/05 09:30/graphics/fun/netbunnies/daisy5-schnellbach1.jpg
589 0.02%29/Mar/05 09:06/graphics/fun/netbunnies/campion2-ginger1.jpg
589 0.01%29/Mar/05 09:49/graphics/fun/netbunnies/smokey4-morris1.jpg
589 0.01%29/Mar/05 09:07/graphics/fun/netbunnies/cookie-smt1.jpg
589 0.03%29/Mar/05 09:42/graphics/fun/netbunnies/sagechris1-Hunt1.jpg
588 0.01%29/Mar/05 07:58/graphics/fun/netbunnies/bubbles-Ng1.jpg
588 0.01%29/Mar/05 09:30/graphics/fun/netbunnies/gingerricky-montgomery1.jpg
588 0.02%29/Mar/05 09:30/graphics/fun/netbunnies/chelsee-gordon1.jpg
588 0.04%29/Mar/05 03:57/graphics/fun/netbunnies/bunjie-Obsenica1.jpg
588 0.02%29/Mar/05 09:30/graphics/fun/netbunnies/sootysweep-small1.jpg
588 0.02%29/Mar/05 09:21/graphics/fun/netbunnies/daisy4-schnellbach1.jpg
588 0.02%29/Mar/05 09:36/graphics/fun/netbunnies/milo1-mack1.jpg
588 0.01%29/Mar/05 08:44/care/abuse.html
588 0.01%29/Mar/05 09:50/graphics/fun/netbunnies/rex-hanson1.jpg
588 0.01%29/Mar/05 09:53/graphics/fun/netbunnies/ding1-kujawa1.jpg
588 0.02%29/Mar/05 09:14/graphics/fun/netbunnies/spikebruiser5-hounsell1.jpg
588 0.03%29/Mar/05 09:05/graphics/fun/netbunnies/magic-sanders1.jpg
588 0.02%29/Mar/05 08:59/graphics/fun/netbunnies/fuzzy-ko1.jpg
588 0.01%29/Mar/05 07:27/graphics/fun/netbunnies/luna6-oui1.jpg
588 0.01%29/Mar/05 09:37/graphics/fun/netbunnies/threebunny-winarchick1.jpg
588 0.01%29/Mar/05 09:06/graphics/fun/netbunnies/elwood4-cook1.jpg
588 0.02%29/Mar/05 09:56/graphics/fun/netbunnies/jb2-cho1.jpg
587 0.01%29/Mar/05 09:01/graphics/fun/netbunnies/piper-watson1.jpg
587 0.02%29/Mar/05 04:53/graphics/fun/netbunnies/dodger2-montoya1.jpg
587 0.02%29/Mar/05 09:54/graphics/fun/netbunnies/bunnies6-doerfler1.jpg
587 0.02%29/Mar/05 08:53/graphics/fun/netbunnies/hoppy-chetnik1.jpg
587 0.01%29/Mar/05 08:53/graphics/fun/netbunnies/floyd-ugval1.jpg
587 0.01%29/Mar/05 08:59/graphics/fun/netbunnies/rocky-rayvon1.jpg
587 0.02%29/Mar/05 09:23/graphics/fun/netbunnies/teriyaki-tima1.jpg
587 0.01%29/Mar/05 09:21/graphics/fun/netbunnies/darcy-benson1.jpg
587 0.01%29/Mar/05 07:21/journal/3-5/graphics/stone.gif
587 0.01%29/Mar/05 08:45/graphics/fun/netbunnies/pg1.jpg
587 0.01%29/Mar/05 09:44/graphics/fun/netbunnies/lucky-davis1.jpg
587 0.01%29/Mar/05 09:58/graphics/fun/netbunnies/serena-pan1.jpg
586 0.02%29/Mar/05 09:52/graphics/fun/netbunnies/kassidy-rich1.jpg
586 0.01%29/Mar/05 09:17/graphics/fun/netbunnies/chloe2-cote1.jpg
586 0.01%29/Mar/05 09:56/graphics/fun/netbunnies/scooter-edelmuller1.jpg
586 0.01%29/Mar/05 09:00/chapters/san-diego/behavior/bonding-tips.html
586 0.01%29/Mar/05 02:01/graphics/fun/netbunnies/chewy-teada1.jpg
586 0.01%29/Mar/05 09:51/graphics/fun/netbunnies/sassy-campbell1.jpg
586 0.01%29/Mar/05 09:16/graphics/fun/netbunnies/bunpic-aird1.jpg
586 0.01%29/Mar/05 09:59/graphics/fun/netbunnies/new-2yourabbitsresized.jpg
586 0.01%29/Mar/05 09:46/graphics/fun/netbunnies/flopsys-harem.jpg
586 0.02%29/Mar/05 05:32/graphics/fun/netbunnies/flopsie.jpg
586 0.01%29/Mar/05 08:32/graphics/fun/netbunnies/ruby1-strope1.jpg
586 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/elwood-mcclure1.jpg
586 0.02%29/Mar/05 09:21/graphics/fun/netbunnies/poppy-howard1.jpg
586 0.02%29/Mar/05 09:44/graphics/fun/netbunnies/daisy-dixon-ho1.jpg
586 0.01%29/Mar/05 09:42/graphics/fun/netbunnies/hank-Caine1.jpg
586 0.01%29/Mar/05 09:43/graphics/fun/netbunnies/smokey-jack1.jpg
586 0.01%29/Mar/05 09:49/graphics/fun/netbunnies/rudi-scherkamp.jpg
586 0.03%29/Mar/05 09:01/graphics/fun/netbunnies/roy-ford1.jpg
586 0.02%29/Mar/05 06:06/graphics/fun/netbunnies/totta3-tanaka1.jpg
586 0.02%29/Mar/05 06:17/graphics/fun/netbunnies/wabbit1-luumi1.jpg
585 0.02%29/Mar/05 09:18/graphics/fun/netbunnies/thor-vanessa1.jpg
585 0.02%29/Mar/05 06:08/graphics/fun/netbunnies/bunny-yee1.jpg
585 0.02%29/Mar/05 07:13/graphics/fun/netbunnies/shela-morales1.jpg
585 0.02%29/Mar/05 08:20/graphics/fun/netbunnies/minirex-sandamander1.jpg
585 0.01%29/Mar/05 09:44/graphics/fun/netbunnies/rabbits2-yu1.jpg
585 0.03%29/Mar/05 09:01/graphics/fun/netbunnies/petunia-wittenkeller1.jpg
585 0.02%29/Mar/05 07:47/graphics/fun/netbunnies/riley-santoro1.jpg
585 0.05%29/Mar/05 09:06/graphics/fun/netbunnies/puff-lindren-white-toilet.jpg
585 0.02%29/Mar/05 09:43/graphics/fun/netbunnies/muffin-miller1.jpg
585 0.01%29/Mar/05 09:51/graphics/fun/netbunnies/waabooz-erin1.jpg
585 0.01%29/Mar/05 08:49/graphics/fun/netbunnies/marshmellow1-corbelli1.jpg
585 0.02%29/Mar/05 09:54/graphics/fun/netbunnies/clover-pavhol1.jpg
585 0.02%29/Mar/05 09:31/graphics/fun/netbunnies/muggsie2-nilgesl1.jpg
585 0.03%29/Mar/05 01:24/graphics/fun/netbunnies/kili-sandkamp1.jpg
585 0.02%29/Mar/05 09:21/graphics/fun/netbunnies/peanutpeaches-potuzak1.jpg
585 0.01%29/Mar/05 09:41/graphics/fun/netbunnies/merlinmatilda2-robeson1.jpg
585 0.01%29/Mar/05 04:36/graphics/fun/netbunnies/french04.jpg
584 0.03%29/Mar/05 09:48/graphics/fun/netbunnies/nidoran-correa1.jpg
584 0.01%29/Mar/05 08:49/graphics/fun/netbunnies/dande3-smigo1.jpg
584 0.04%29/Mar/05 09:26/graphics/fun/netbunnies/buddha1-nolan1.jpg
584 0.01%29/Mar/05 09:04/graphics/fun/netbunnies/fidge1.jpg
584 0.01%29/Mar/05 09:57/graphics/fun/netbunnies/ginger-george1.jpg
584 0.01%29/Mar/05 09:49/graphics/fun/netbunnies/rabbit2-klarman1.jpg
584 0.03%29/Mar/05 09:23/graphics/fun/netbunnies/violet-seitz1.jpg
584 0.01%29/Mar/05 09:44/graphics/fun/netbunnies/pixie04c.jpg
584 0.01%29/Mar/05 09:30/graphics/fun/netbunnies/fidge-n-fuzz.jpg
584 0.01%29/Mar/05 09:21/graphics/fun/netbunnies/mollie1-galer1.jpg
584 0.03%29/Mar/05 09:23/graphics/fun/netbunnies/oreo-marroney1.jpg
584 0.01%29/Mar/05 09:47/graphics/fun/netbunnies/weenie-smith1.jpg
584 0.01%29/Mar/05 04:38/graphics/fun/netbunnies/sadie-mia1.jpg
584 0.03%29/Mar/05 09:39/graphics/fun/netbunnies/cinnamon-maddyx1.jpg
584 0.02%29/Mar/05 09:37/graphics/fun/netbunnies/lester1-bowser1.jpg
584 0.03%29/Mar/05 09:58/graphics/fun/netbunnies/rusty-hanson1.jpg
584 0.02%29/Mar/05 09:25/graphics/fun/netbunnies/bunbun-crijo1.jpg
583 0.02%29/Mar/05 09:15/graphics/fun/netbunnies/tob-hopfei1.jpg
583 0.01%29/Mar/05 09:37/graphics/fun/netbunnies/rudi-scherkamp1.jpg
583 0.02%29/Mar/05 09:55/graphics/fun/netbunnies/bunnies1-clements1.jpg
583 29/Mar/05 09:43/graphics/easter/anti-victoria-circle.jpg
583 0.02%29/Mar/05 08:36/graphics/fun/netbunnies/marjoram1-ginger1.jpg
583 0.01%29/Mar/05 09:04/graphics/fun/netbunnies/oliver-habel1.jpg
583 0.02%29/Mar/05 09:39/graphics/fun/netbunnies/dixon-ho1.jpg
583 0.01%29/Mar/05 09:52/graphics/fun/netbunnies/fred-bubble1.jpg
582 0.02%29/Mar/05 09:48/graphics/fun/netbunnies/bun1-cabin1.jpg
582 0.01%29/Mar/05 09:38/graphics/fun/netbunnies/janchair2-marturano1.jpg
582 0.03%29/Mar/05 08:57/graphics/fun/netbunnies/high2.jpg
582 0.02%29/Mar/05 09:37/graphics/fun/netbunnies/meme-Bridenbaugh1.jpg
582 0.02%29/Mar/05 06:31/graphics/fun/netbunnies/bunbun7-lo1.jpg
582 0.02%29/Mar/05 09:38/graphics/fun/netbunnies/mokie1-lin1.jpg
582 0.01%29/Mar/05 07:59/graphics/fun/netbunnies/emma1-robinson1.jpg
582 0.03%29/Mar/05 09:56/graphics/fun/netbunnies/noble-schaaf1.jpg
582 0.02%29/Mar/05 07:57/graphics/fun/netbunnies/lily-cathey1.jpg
582 0.03%29/Mar/05 04:35/graphics/fun/netbunnies/benny-foofoo-rick1.jpg
581 0.01%29/Mar/05 09:25/graphics/fun/netbunnies/ryok3.jpg
581 0.01%29/Mar/05 09:57/graphics/fun/netbunnies/hugh.jpg
581 0.01%29/Mar/05 09:57/graphics/fun/netbunnies/ek-ashwroth1.jpg
581 0.02%29/Mar/05 09:00/graphics/fun/netbunnies/chkrspearl.jpg
581 0.02%29/Mar/05 09:25/graphics/fun/netbunnies/ginger1-herrington1.jpg
581 0.02%29/Mar/05 06:37/graphics/fun/netbunnies/polly_card2.jpg
581 0.01%29/Mar/05 09:28/graphics/fun/netbunnies/sleepbu-ndren1.jpg
581 0.02%29/Mar/05 09:54/graphics/fun/netbunnies/cashew-qtip-ona1.jpg
581 0.02%29/Mar/05 09:06/graphics/fun/netbunnies/hernandobunny-joanna1.jpg
581 0.02%29/Mar/05 09:40/graphics/fun/netbunnies/trudyposa-pierguiseppe1.jpg
580 0.02%29/Mar/05 08:55/graphics/fun/netbunnies/oscar-sigler1 .jpg
580 0.02%29/Mar/05 09:34/graphics/fun/netbunnies/bunniesgroup-darcey1.jpg
580 29/Mar/05 07:32/rabbit-center/retail/
580 0.03%29/Mar/05 08:27/graphics/fun/netbunnies/pepper+sweetpea-wickerson1.jpg
580 0.02%29/Mar/05 09:56/graphics/fun/netbunnies/dexterothers-santos1.jpg
580 0.01%29/Mar/05 09:17/graphics/fun/netbunnies/hershey-bella-brandt1.jpg
580 0.02%29/Mar/05 08:45/graphics/fun/netbunnies/josper-metsavir1.jpg
580 0.01%29/Mar/05 09:39/graphics/fun/netbunnies/mel1-shay1.jpg
580 0.01%29/Mar/05 08:52/graphics/fun/netbunnies/bently2-shi1.jpg
580 0.02%29/Mar/05 07:13/graphics/fun/netbunnies/funia-izabella1.jpg
580 0.02%29/Mar/05 08:55/graphics/fun/netbunnies/riley3-charisemaria1.jpg
580 0.01%29/Mar/05 09:35/graphics/fun/netbunnies/thumper-prince1.jpg
580 0.02%29/Mar/05 09:27/graphics/fun/netbunnies/lulabelle.jpg
580 0.01%29/Mar/05 09:58/graphics/fun/netbunnies/penny1_lake1.jpg
580 0.01%29/Mar/05 09:56/graphics/fun/netbunnies/flop1-julian1.jpg
580 0.01%29/Mar/05 09:17/graphics/fun/netbunnies/carnie-wright1.jpg
579 0.01%29/Mar/05 09:47/graphics/fun/netbunnies/floppy-boleyn1.jpg
579 0.02%29/Mar/05 05:18/graphics/fun/netbunnies/hayeaters4-rainey1.jpg
579 0.02%29/Mar/05 09:05/graphics/fun/netbunnies/baxter-snyder1.jpg
579 0.02%29/Mar/05 09:31/graphics/fun/netbunnies/cooper-bailor1.jpg
579 0.01%29/Mar/05 09:48/graphics/fun/netbunnies/simone3.jpg
579 0.01%29/Mar/05 09:41/graphics/fun/netbunnies/pearl-espinosa1.jpg
579 0.02%29/Mar/05 09:24/graphics/fun/netbunnies/lapinface.jpg
579 0.02%29/Mar/05 09:02/graphics/fun/netbunnies/rabbit-ellen1.jpg
579 0.01%29/Mar/05 09:36/graphics/fun/netbunnies/fidge2.jpg
579 0.02%29/Mar/05 06:11/graphics/fun/netbunnies/daisywaisy-rmccl1.jpg
578 0.01%29/Mar/05 09:44/graphics/fun/netbunnies/lilieozzycharity-lilbit1.jpg
578 0.01%29/Mar/05 08:58/graphics/fun/netbunnies/both-blue1.jpg
578 0.03%29/Mar/05 09:19/graphics/fun/netbunnies/rudy-cooke1.jpg
578 0.02%29/Mar/05 07:19/graphics/fun/netbunnies/nona-barrett1.jpg
578 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/midnite-barnett1.jpg
578 0.01%29/Mar/05 09:53/graphics/fun/netbunnies/pearl+spiro-anderson1.jpg
578 0.01%29/Mar/05 09:30/graphics/fun/netbunnies/herby-wright1jpg.jpg
578 0.01%29/Mar/05 07:08/graphics/fun/netbunnies/jangles2.jpg
578 0.03%29/Mar/05 08:42/graphics/fun/netbunnies/chocolate-ko1.jpg
578 0.03%29/Mar/05 09:52/graphics/fun/netbunnies/lopornotbarber.jpg
578 0.02%29/Mar/05 07:57/graphics/fun/netbunnies/clover3-sumanski1.jpg
578 0.02%29/Mar/05 09:34/graphics/fun/netbunnies/dixie-ryder1.jpg
577 0.03%29/Mar/05 09:13/graphics/fun/netbunnies/floppy-brandon1.jpg
577 0.02%28/Mar/05 20:16/graphics/fun/netbunnies/samantha2-sousa1.jpg
577 0.02%29/Mar/05 09:04/graphics/fun/netbunnies/bunny1-applini1.jpg
577 0.02%29/Mar/05 09:45/graphics/fun/netbunnies/bunny1-Zisser1.jpg
577 0.02%29/Mar/05 08:02/graphics/fun/netbunnies/fuzzy2-ko1.jpg
577 0.02%29/Mar/05 09:45/graphics/fun/netbunnies/jasper-cartwright1.jpg
577 0.01%29/Mar/05 08:52/graphics/fun/netbunnies/ding-Kujawa1.jpg
577 0.03%29/Mar/05 09:30/graphics/fun/netbunnies/pepperout2-beautylies1.jpg
577 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/fancy1-fraleigh1.jpg
577 0.01%29/Mar/05 09:53/graphics/fun/netbunnies/nibbs1.jpg
577 0.02%29/Mar/05 08:44/graphics/fun/netbunnies/happyfeet-Daniels1.jpg
577 0.01%29/Mar/05 09:11/graphics/postcard/Pl-sch10.jpg
577 0.03%29/Mar/05 09:49/graphics/fun/netbunnies/rabbits2-ceftakhar1.jpg
577 0.02%29/Mar/05 06:13/graphics/fun/netbunnies/birdie-Saisa1.jpg
576 0.01%29/Mar/05 09:32/graphics/fun/netbunnies/cotton-renee1.jpg
576 0.01%29/Mar/05 08:51/graphics/fun/netbunnies/jessica-Guthrie1.jpg
576 0.01%29/Mar/05 08:21/graphics/fun/netbunnies/grethel-broley1.jpg
576 0.01%29/Mar/05 08:31/graphics/fun/netbunnies/hoppy-wood1.jpg
576 0.02%29/Mar/05 09:01/graphics/fun/netbunnies/dandylion1-jessica1.jpg
576 0.04%29/Mar/05 09:21/graphics/fun/netbunnies/cookie-lovell1.jpg
576 0.02%29/Mar/05 08:50/graphics/fun/netbunnies/maggie-underwood1.jpg
576 0.01%29/Mar/05 09:05/graphics/fun/netbunnies/toby3-carolyn1.jpg
575 0.01%29/Mar/05 09:46/graphics/fun/netbunnies/lightning-sagartz1.jpg
575 0.02%29/Mar/05 09:37/graphics/fun/netbunnies/firstLitter-Stack1.jpg
575 0.02%29/Mar/05 09:01/graphics/fun/netbunnies/mbi-moore1.jpg
575 0.02%29/Mar/05 07:27/graphics/fun/netbunnies/frank-myers1.jpg
575 0.03%29/Mar/05 09:44/graphics/fun/netbunnies/rabbit-Castillo1.jpg
575 0.02%29/Mar/05 08:46/graphics/fun/netbunnies/nibbler-jia1.jpg
575 0.02%29/Mar/05 08:30/graphics/fun/netbunnies/harvey-Elliott1.jpg
575 0.02%29/Mar/05 08:35/graphics/fun/netbunnies/snowflake3-smopar1.jpg
575 0.03%29/Mar/05 09:43/graphics/fun/netbunnies/rabbit-christenson1.jpg
575 0.02%29/Mar/05 08:30/graphics/fun/netbunnies/p_minc.jpg
575 0.05%13/Mar/05 02:22/chapters/san-diego/adoption/Adoption_Photos/HRS_Star_Jan05.jpg
575 0.01%29/Mar/05 08:45/graphics/fun/netbunnies/missbuffy-showalter1.jpg
575 0.02%29/Mar/05 09:37/graphics/fun/netbunnies/oatmeal-heather1.jpg
575 0.03%29/Mar/05 09:37/graphics/fun/netbunnies/pepper-lop-leikers.jpg
575 0.02%29/Mar/05 07:38/graphics/fun/netbunnies/powder-Daniels1.jpg
575 0.03%29/Mar/05 08:25/graphics/fun/netbunnies/chloe-mann1.jpg
574 0.03%29/Mar/05 09:37/graphics/fun/netbunnies/pru3-ha1.jpg
574 0.01%29/Mar/05 09:54/graphics/fun/netbunnies/oreofluff-varghese1.jpg
574 0.01%29/Mar/05 09:58/graphics/fun/netbunnies/leiniegoof.jpg
574 0.01%29/Mar/05 09:15/graphics/fun/netbunnies/sylvester-Hadjigeorgiou1.jpg
574 0.02%29/Mar/05 09:37/graphics/fun/netbunnies/mel2-shay1.jpg
574 0.02%29/Mar/05 07:58/graphics/fun/netbunnies/merlin-manning1.jpg
574 0.03%29/Mar/05 09:39/rabbit-center/hayward_rescue/hayward_graphics/hayward_bunnies_2.jpg
574 0.02%29/Mar/05 09:59/graphics/fun/netbunnies/emma-manning1.jpg
574 0.01%29/Mar/05 09:27/graphics/fun/netbunnies/sable2.jpg
574 0.01%29/Mar/05 09:18/graphics/fun/netbunnies/jackie.jpg
573 0.01%29/Mar/05 09:23/graphics/fun/netbunnies/julius-hurley1.jpg
573 0.02%29/Mar/05 01:51/graphics/fun/netbunnies/cocobunny1-goodman1.jpg
573 29/Mar/05 09:40/chapters/oakland/ystripes.gif
573 0.01%29/Mar/05 09:46/graphics/fun/netbunnies/r2-3-lin1.jpg
573 0.01%29/Mar/05 06:43/graphics/fun/netbunnies/betsy2-byrne1.jpg
573 0.02%29/Mar/05 09:28/graphics/fun/netbunnies/thumperandpaul-Mason1.jpg
573 0.02%29/Mar/05 09:43/graphics/fun/netbunnies/henry1-may1.jpg
573 0.02%29/Mar/05 09:41/graphics/fun/netbunnies/thumper-Mason1.jpg
573 0.02%29/Mar/05 09:34/graphics/fun/netbunnies/jazzie-fraleigh1.jpg
573 0.02%29/Mar/05 09:17/faq/sections/travel.html
572 0.01%29/Mar/05 08:03/graphics/fun/netbunnies/coco-Whitehead1.jpg
572 0.01%29/Mar/05 09:56/graphics/fun/netbunnies/oatmeal-lyerly1.jpg
572 0.02%29/Mar/05 09:21/graphics/fun/netbunnies/manny-anderson1.jpg
572 0.01%29/Mar/05 07:59/graphics/fun/netbunnies/mrogantaylor-winarchick1.jpg
572 0.02%29/Mar/05 08:52/graphics/fun/netbunnies/daphne_dopey-chen1.jpg
572 0.02%29/Mar/05 09:56/graphics/fun/netbunnies/patty2-mckinnon1.jpg
572 0.03%29/Mar/05 09:27/graphics/fun/netbunnies/dustyandmirrordownes.jpg
572 0.01%29/Mar/05 06:32/graphics/fun/netbunnies/rab7-overett1.jpg
572 0.02%29/Mar/05 09:36/graphics/fun/netbunnies/lilith-emaleth1.jpg
572 0.02%29/Mar/05 09:19/graphics/fun/netbunnies/pidder-howard1.jpg
572 0.02%29/Mar/05 07:56/graphics/fun/netbunnies/lucky-katievic1.jpg
571 0.03%29/Mar/05 09:24/graphics/fun/netbunnies/bunny07-Kaldal1.jpg
571 0.01%29/Mar/05 08:54/graphics/fun/netbunnies/thumper-roxy4-bailey1.jpg
571 0.02%29/Mar/05 09:55/graphics/fun/netbunnies/mopsey-feely1.jpg
571 0.01%29/Mar/05 09:46/graphics/fun/netbunnies/jellybean1-ozab1.jpg
571 0.02%29/Mar/05 08:43/graphics/fun/netbunnies/daisy-davis1.jpg
571 0.02%29/Mar/05 08:45/graphics/fun/netbunnies/rabbit3-rybizek1.jpg
571 0.02%29/Mar/05 09:54/graphics/fun/netbunnies/mudslide-rhoades1.jpg
571 0.02%29/Mar/05 09:23/graphics/fun/netbunnies/sophie1-noakes1.jpg
571 0.01%29/Mar/05 09:03/graphics/fun/netbunnies/bunny4.jpg
570 0.01%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/rory3.jpg
570 0.02%29/Mar/05 06:27/graphics/fun/netbunnies/higgins-Dwyer1.jpg
570 0.02%29/Mar/05 04:55/graphics/fun/netbunnies/negao1-marcia1.jpg
570 0.02%29/Mar/05 09:04/graphics/fun/netbunnies/missflop-hess1.jpg
570 0.02%29/Mar/05 09:53/graphics/fun/netbunnies/thumper+louis-desio1.jpg
570 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/punky-brianna1.jpg
570 0.01%29/Mar/05 09:13/graphics/fun/netbunnies/littlebunbook.jpg
570 0.01%29/Mar/05 09:13/graphics/fun/netbunnies/bunkie-needler1.jpg
570 0.01%29/Mar/05 09:36/graphics/fun/netbunnies/dusty-khan1.jpg
570 0.04%29/Mar/05 08:00/graphics/fun/netbunnies/reese-engler1.jpg
570 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/twix1-lanai1.jpg
569 0.02%29/Mar/05 08:42/graphics/fun/netbunnies/small.jpg
569 0.02%29/Mar/05 01:27/graphics/fun/netbunnies/rex-poole1.jpg
569 0.02%29/Mar/05 09:05/graphics/fun/netbunnies/meandl-dlud1.jpg
569 0.02%29/Mar/05 09:50/graphics/fun/netbunnies/bunnies1-broley1.jpg
569 0.02%29/Mar/05 09:52/graphics/fun/netbunnies/lily1-gobler1.jpg
569 0.01%29/Mar/05 05:58/graphics/fun/netbunnies/lubimysie3-Anna1.jpg
569 0.02%29/Mar/05 09:59/graphics/fun/netbunnies/oreo-nicki1.jpg
568 0.01%29/Mar/05 09:52/graphics/fun/netbunnies/bess-smith1.jpg
568 0.02%29/Mar/05 09:07/graphics/fun/netbunnies/stinky-wangchuk1.jpg
568 0.02%29/Mar/05 09:04/graphics/fun/netbunnies/sammy-richard1.jpg
568 0.02%29/Mar/05 09:44/graphics/fun/netbunnies/max2-hanna1.jpg
568 0.02%29/Mar/05 09:24/graphics/fun/netbunnies/oreo-donovan1.jpg
568 0.01%29/Mar/05 09:03/graphics/fun/netbunnies/ippie-sewps1.jpg
567 0.01%29/Mar/05 07:38/graphics/fun/netbunnies/rocco-boland1.jpg
567 0.01%29/Mar/05 09:50/chapters/san-diego/diet/cecals.html
567 0.02%29/Mar/05 09:46/graphics/fun/netbunnies/bunny1-suarez1.jpg
567 0.02%29/Mar/05 06:09/graphics/fun/netbunnies/fufu2-crownover1.jpg
567 0.02%29/Mar/05 09:56/graphics/fun/netbunnies/rabbit1-ergun1.jpg
567 0.02%29/Mar/05 09:40/graphics/fun/netbunnies/buns1-oberley1.jpg
566 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/moose-katievic1.jpg
566 0.01%29/Mar/05 09:58/graphics/fun/netbunnies/m2.jpg
566 0.02%29/Mar/05 06:50/graphics/fun/netbunnies/maroon-lin1.jpg
566 0.01%29/Mar/05 08:57/graphics/fun/netbunnies/oliver-4.jpg
566 0.01%29/Mar/05 09:52/graphics/fun/netbunnies/nuala10.jpg
566 0.01%29/Mar/05 08:58/graphics/fun/netbunnies/lolococo-dy1.jpg
566 0.03%29/Mar/05 09:40/graphics/fun/netbunnies/owen-anderson1.jpg
566 0.02%29/Mar/05 09:38/graphics/fun/netbunnies/maeve+draighnean-mcnulty1.jpg
565 0.01%29/Mar/05 09:35/graphics/fun/netbunnies/cookie+mocha1-gatto1.jpg
565 0.01%29/Mar/05 06:31/graphics/fun/netbunnies/destino4-shullaw1.jpg
565 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/nick-athensgold1.jpg
565 0.01%29/Mar/05 07:55/graphics/fun/netbunnies/mojo-Georgiev1.jpg
564 29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Jasper_17Aug04.jpg
564 0.03%29/Mar/05 09:40/graphics/fun/netbunnies/bunny10.jpg
564 0.02%29/Mar/05 08:59/graphics/fun/netbunnies/nut2-makuh1.jpg
564 0.01%29/Mar/05 04:01/graphics/fun/netbunnies/roger-harris1.jpg
564 29/Mar/05 09:18/hrs-info/background.html
564 0.02%29/Mar/05 01:28/graphics/fun/netbunnies/hopalong-ho1.jpg
564 0.01%29/Mar/05 09:37/graphics/fun/netbunnies/nicklovesannie-kyrene1.jpg
564 0.03%29/Mar/05 01:22/graphics/fun/netbunnies/ruby2-strope1.jpg
564 0.02%29/Mar/05 09:37/graphics/fun/netbunnies/marzncopper-ng1.jpg
563 0.02%29/Mar/05 09:22/graphics/fun/netbunnies/matty+regina-freidel1.jpg
563 0.02%29/Mar/05 09:22/graphics/fun/netbunnies/sonora-hanson1.jpg
563 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/ginger3-herrington1.jpg
562 0.02%29/Mar/05 09:06/graphics/fun/netbunnies/bugsy+chloe-greene1.jpg
562 0.01%29/Mar/05 09:49/graphics/fun/netbunnies/rabbit-adam1.jpg
562 0.01%29/Mar/05 09:36/graphics/fun/netbunnies/nevat-puyol1.jpg
562 29/Mar/05 08:53/graphics/banners/care.gif
561 0.02%29/Mar/05 07:25/graphics/fun/netbunnies/nicke1-Olsson1.jpg
561 0.02%29/Mar/05 09:48/graphics/fun/netbunnies/rabbit1-sheetz1.jpg
561 0.03%29/Mar/05 09:05/graphics/fun/netbunnies/rabbitssnow-Gerritsen1.jpg
560 0.02%29/Mar/05 09:47/graphics/fun/netbunnies/enki-Lucy1.jpg
560 0.01%29/Mar/05 08:50/graphics/fun/netbunnies/rabbit-rackley1.jpg
560 0.01%29/Mar/05 09:50/chapters/san-diego/diet/graphics/poops.jpg
560 29/Mar/05 08:59/rabbit-center/graphics/icon_eventspage.gif
560 0.01%29/Mar/05 09:58/graphics/fun/netbunnies/peter1-prichard1.jpg
560 0.01%29/Mar/05 09:56/graphics/fun/netbunnies/r955ashley38tiny.jpg
559 0.01%29/Mar/05 09:50/graphics/fun/netbunnies/harvey2-newstead1.jpg
559 0.02%29/Mar/05 09:14/graphics/fun/netbunnies/daisydixon-davis1.jpg
559 0.01%29/Mar/05 07:56/graphics/fun/netbunnies/midnight-dawn1.jpg
559 0.02%29/Mar/05 09:03/graphics/fun/netbunnies/rabbit1-johnson1.jpg
559 0.03%29/Mar/05 09:49/graphics/fun/netbunnies/montythumper1-carpenter1.jpg
559 0.01%29/Mar/05 09:38/graphics/fun/netbunnies/hops2-attila1.jpg
558 29/Mar/05 09:54/links/sections/nc-find120x90.gif
558 0.01%29/Mar/05 09:19/graphics/fun/netbunnies/pele02.jpg
558 0.01%29/Mar/05 09:46/graphics/fun/netbunnies/dusty-venlou1.jpg
558 0.01%29/Mar/05 08:48/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Ask-a-Vet_1.JPG
558 0.02%29/Mar/05 09:31/graphics/fun/netbunnies/peter2-pritchard1.jpg
558 0.01%29/Mar/05 09:56/graphics/fun/netbunnies/george-Ivy1.jpg
558 0.01%29/Mar/05 09:46/graphics/fun/netbunnies/elwood1-cook1.jpg
558 0.01%29/Mar/05 09:36/graphics/fun/netbunnies/bunny2-chica1.jpg
557 0.02%29/Mar/05 08:51/graphics/fun/netbunnies/ruby1-vogel1.jpg
557 0.01%29/Mar/05 09:04/graphics/fun/netbunnies/muffy5.jpg
557 0.01%29/Mar/05 09:59/graphics/fun/netbunnies/dinkyscale-melin1.jpg
557 0.01%29/Mar/05 08:50/graphics/fun/netbunnies/stitch-aki1.jpg
557 29/Mar/05 09:50/cgi-bin/suid/~rabbit2/san-diego/search
557 0.02%29/Mar/05 09:57/graphics/fun/netbunnies/bunny2-dibunny1.jpg
557 0.01%29/Mar/05 09:22/graphics/fun/netbunnies/r937erin58tiny.jpg
556 0.01%29/Mar/05 09:57/graphics/fun/netbunnies/simone5.jpg
556 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/bunny2.jpg
556 0.06%29/Mar/05 09:03/rabbit-center/hayward_rescue/hayward_graphics/corpse2.jpg
555 0.01%29/Mar/05 09:44/graphics/fun/netbunnies/ralphie-garver1.jpg
555 0.02%29/Mar/05 09:05/graphics/fun/netbunnies/patrick-rudeck1.jpg
554 0.01%29/Mar/05 09:38/graphics/fun/netbunnies/frenchy1-lorian1.jpg
554 0.01%29/Mar/05 09:21/graphics/fun/netbunnies/sleepingbabies-napieralski1.jpg
554 0.03%29/Mar/05 09:27/graphics/fun/netbunnies/buster-saikaley1.jpg
554 0.01%29/Mar/05 09:54/graphics/fun/netbunnies/peetie1-chaney1.jpg
554 0.01%29/Mar/05 09:31/graphics/fun/netbunnies/olycloseup-melin1.jpg
554 0.01%29/Mar/05 09:43/graphics/fun/netbunnies/nutmeg-Nilgesda1.jpg
554 0.01%29/Mar/05 09:24/graphics/fun/netbunnies/frenchyhall-lorian1.jpg
553 0.02%29/Mar/05 06:43/graphics/fun/netbunnies/magee-melesurgo1.jpg
552 0.03%29/Mar/05 09:58/graphics/fun/netbunnies/sasha--shorty1.jpg
552 0.01%29/Mar/05 09:50/graphics/fun/netbunnies/maybetire-ladykat1.jpg
551 0.02%29/Mar/05 09:13/graphics/fun/netbunnies/cinnabun-haviva1.jpg
551 0.01%29/Mar/05 09:00/graphics/fun/netbunnies/peanut-Daniels1.jpg
551 0.02%29/Mar/05 08:30/graphics/fun/netbunnies/buns-morgan1.jpg
551 0.02%29/Mar/05 08:55/graphics/fun/netbunnies/natasha-anderson1.jpg
551 0.02%29/Mar/05 09:38/graphics/fun/netbunnies/sean-odell1.jpg
551 0.01%29/Mar/05 09:54/graphics/books/right-pet.gif
550 0.01%29/Mar/05 08:06/journal/1/critically-ill.html
550 0.01%29/Mar/05 08:02/journal/3-12/litter-training-revisited.html
549 29/Mar/05 09:54/graphics/books/peacable.gif
549 0.03%29/Mar/05 09:30/graphics/fun/netbunnies/inky1.jpg
548 0.01%29/Mar/05 09:54/graphics/books/hoptoit.gif
547 0.01%29/Mar/05 08:27/journal/3-7/stray.html
547 0.02%29/Mar/05 09:37/graphics/fun/netbunnies/ginger-Cathy1.jpg
547 0.03%29/Mar/05 08:53/graphics/fun/netbunnies/molson-martin1.jpg
546 0.02%29/Mar/05 09:38/graphics/fun/netbunnies/thumper1-knorr1.jpg
545 29/Mar/05 09:27/graphics/fun/
17 28/Mar/05 01:22  /graphics/fun/?N=D
15 27/Mar/05 21:55  /graphics/fun/?D=A
14 27/Mar/05 21:55  /graphics/fun/?N=A
14 27/Mar/05 21:55  /graphics/fun/?M=D
13 27/Mar/05 21:55  /graphics/fun/?S=A
12 27/Mar/05 21:55  /graphics/fun/?M=A
12 27/Mar/05 21:55  /graphics/fun/?D=D
545 0.03%29/Mar/05 09:48/graphics/fun/netbunnies/ninus-andersen1.jpg
544 0.01%29/Mar/05 09:16/rabbit-center/lucky/adopted.htm
542 0.01%29/Mar/05 09:47/faq/sections/loss.html
542 0.01%29/Mar/05 08:02/graphics/fun/netbunnies/cal.jpg
542 0.01%29/Mar/05 09:34/journal/2-5/mr-b.html
542 0.01%29/Mar/05 09:57/chapters/san-diego/health/vet-talk/eyes.html
541 0.01%29/Mar/05 08:59/graphics/fun/netbunnies/daisy-ho1.jpg
541 0.01%29/Mar/05 06:17/graphics/fun/netbunnies/dakota2-angelo1.jpg
540 0.01%29/Mar/05 08:58/graphics/fun/netbunnies/muggs-casey1.jpg
540 0.02%29/Mar/05 09:58/graphics/fun/netbunnies/jackieabigail-johnsen1.jpg
539 0.02%29/Mar/05 09:24/graphics/fun/netbunnies/monty-poh1.jpg
538 0.02%29/Mar/05 09:25/easter/flyer/food-not-free.pdf
536 29/Mar/05 09:59/chapters/san-francisco/logo.gif
536 0.02%29/Mar/05 09:47/graphics/fun/netbunnies/rishcage-sandy1.jpg
536 29/Mar/05 09:56/hrs-info/philosophy.html
535 0.05%28/Mar/05 19:43/easter/flyer/flyer3.doc
534 0.01%29/Mar/05 06:03/graphics/fun/netbunnies/colonel-carlshausen1.jpg
534 0.01%29/Mar/05 08:16/graphics/postcard/willow-in-bed-with-teddy.jpg
530 0.01%29/Mar/05 09:48/graphics/fun/netbunnies/oreo-froggy1.jpg
528 0.01%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Savannah_Feb05.jpg
527 29/Mar/05 09:40/chapters/oakland/smevents.gif
525 0.01%29/Mar/05 08:59/journal/1/kingdoms.html
525 0.01%29/Mar/05 09:44/rabbit-center/resources/vets.html
524 29/Mar/05 09:40/chapters/oakland/smresour.gif
524 0.01%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Taylor_Dec04.jpg
524 29/Mar/05 09:40/chapters/oakland/smarticl.gif
523 29/Mar/05 09:40/chapters/oakland/bunnybak.gif
523 0.01%29/Mar/05 09:48/chapters/san-diego/health/vetlist.html
523 29/Mar/05 09:40/chapters/oakland/smadopt.gif
522 0.02%29/Mar/05 09:45/chapters/san-diego/health/dental_disease.html
522 29/Mar/05 09:40/chapters/oakland/smhall.gif
521 0.01%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Samantha_Nov04.jpg
518 0.01%29/Mar/05 09:44/translations/spanish/criar-o-no-criar.html
516 0.01%29/Mar/05 08:48/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Cottontail_cafe.JPG
516 0.07%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Donnie_April_3_Nov04.JPG
514 0.01%29/Mar/05 09:27/graphics/fun/tinytim.gif
514 0.01%29/Mar/05 09:54/chapters/san-diego/products/graphics/HRS_Office_5_Jan04.JPG
512 29/Mar/05 08:50/rabbit-center/lucky/images/back_photos.gif
512 0.02%29/Mar/05 09:11/graphics/mine/foo/1-baby-foo.jpg
511 0.01%29/Mar/05 08:48/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/lagomorph_lounge.JPG
511 0.01%29/Mar/05 09:54/chapters/san-diego/products/graphics/HRS_Office_4_Jan04.JPG
507 29/Mar/05 09:40/chapters/oakland/smabout.gif
507 0.01%29/Mar/05 09:54/chapters/san-diego/products/graphics/HRS_Office_boxed_hay_Jan04.JPG
506 0.02%29/Mar/05 09:54/chapters/san-diego/products/graphics/HRS_Office_Cages_Jan04.JPG
504 0.01%29/Mar/05 09:52/chapters/san-diego/behavior/litter_train.html
503 29/Mar/05 08:43/fun/reader-photos.html
502 0.02%29/Mar/05 09:03/rabbit-center/hayward_rescue/hayward_graphics/yellow_bunny_exam_2.jpg
501 0.03%29/Mar/05 09:54/chapters/san-diego/products/graphics/HRS_Office_toys_supplies_Jan04.JPG
497 0.01%29/Mar/05 07:19/chapters/san-diego/behavior/quiz/quiz_graphic.jpg
497 0.02%29/Mar/05 09:54/chapters/san-diego/products/graphics/HRS_Office_Books_1_Jan04.JPG
496 0.01%29/Mar/05 08:33/faq/sections/disabled.html
495 0.02%29/Mar/05 09:03/rabbit-center/hayward_rescue/hayward_graphics/abscess_exam.jpg
493 0.03%29/Mar/05 09:56/hrs-info/hrs.pdf
492 0.01%29/Mar/05 09:54/chapters/san-diego/products/graphics/HRS_Office_CF_Jan04.JPG
489 0.01%29/Mar/05 07:08/journal/3-10/pain.html
489 0.01%29/Mar/05 09:11/graphics/mine/foo/2-pumpkin-foo.jpg
488 0.01%29/Mar/05 09:54/chapters/san-diego/products/graphics/HRS_Office_pens_Jan04.JPG
486 0.02%29/Mar/05 09:03/rabbit-center/hayward_rescue/hayward_graphics/syphilis_nose.jpg
485 0.01%29/Mar/05 06:58/graphics/fun/netbunnies/Bonbon.JPG
485 29/Mar/05 08:30/fun/answer2.html
484 0.01%29/Mar/05 08:48/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Auction_items_2.JPG
484 0.01%29/Mar/05 09:54/chapters/san-diego/products/graphics/HRS_Office_crocks_1_Jan04.JPG
482 29/Mar/05 09:01/journal/2-6/graphics/malocclusion.gif
479 0.01%29/Mar/05 08:48/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/AK_Specialties.JPG
477 0.01%29/Mar/05 09:54/chapters/san-diego/products/graphics/HRS_Office_tshirts_2_Jan04.JPG
476 29/Mar/05 07:19/chapters/san-diego/behavior/quiz/quiz-numbers.gif
475 29/Mar/05 09:08/hrs-info/donation.html
475 0.01%29/Mar/05 08:11/help/advanced-search.html
474 0.01%29/Mar/05 09:54/chapters/san-diego/products/graphics/HRS_Office_donated_toys_Jan04.JPG
472 0.08%29/Mar/05 09:59/chapters/san-diego/behavior/graphics/Corrugated_cord_cover.jpg
470 0.01%29/Mar/05 06:55/chapters/san-diego/faq/graphics/faq_headergraphic_v2.jpg
469 0.01%29/Mar/05 04:19/chapters/san-diego/adoption/Adoption_Photos/Lacey_adoption_2_Feb05.jpg
469 29/Mar/05 09:42/cgi-bin/email-article.cgi
469 0.01%29/Mar/05 09:59/chapters/san-diego/aboutus/bunnyfest/bfest_photos/CCLaceyBeau55.jpg
468 29/Mar/05 07:48/chapters/san-diego/adoption/beforeadopt.html
468 0.01%29/Mar/05 04:19/chapters/san-diego/adoption/Adoption_Photos/Lacey_happy_adoption_Feb05.jpg
466 0.01%29/Mar/05 04:19/chapters/san-diego/adoption/Adoption_Photos/Donovan_adoption_composite.jpg
465 29/Mar/05 00:02/easter/flyer/flyer2.html
464 29/Mar/05 09:36/fun/answer3.html
464 0.01%29/Mar/05 09:59/chapters/san-diego/behavior/graphics/bunnyproofing_supplies.JPG
462 29/Mar/05 08:33/rabbit-center/boarding.html
461 29/Mar/05 09:45/chapters/san-diego/health/graphics/Bad_teeth_2.JPG
460 29/Mar/05 09:34/rabbit-center/hayward_rescue/hayward_graphics/Toby_2.JPG
459 0.01%29/Mar/05 09:59/chapters/san-diego/behavior/graphics/Cord_keeper.JPG
459 0.01%29/Mar/05 04:19/chapters/san-diego/adoption/Adoption_Photos/HRS_Harley_adoption_12Feb05.jpg
459 29/Mar/05 09:16/rabbit-center/lucky/latestphotos.htm
458 0.01%29/Mar/05 04:19/chapters/san-diego/adoption/Adoption_Photos/Brandy_adoption_Feb05.jpg
458 0.06%29/Mar/05 04:19/chapters/san-diego/adoption/Adoption_Photos/Starr_adoption_23Jan05.jpg
454 0.01%29/Mar/05 09:58/chapters/san-diego/adoption/indoors.html
454 29/Mar/05 09:59/chapters/san-diego/behavior/graphics/Lamp_cord.JPG
453 0.01%29/Mar/05 09:59/chapters/san-diego/behavior/graphics/Toss_toys.JPG
453 0.01%29/Mar/05 09:59/chapters/san-diego/behavior/graphics/Corner_guards.jpg
451 29/Mar/05 09:45/chapters/san-diego/health/graphics/good-teeth.jpg
451 0.01%29/Mar/05 08:44/journal/3-1/learning-to-love-again.html
451 0.01%29/Mar/05 09:59/chapters/san-diego/behavior/graphics/Entertainment_center1.JPG
451 0.01%29/Mar/05 09:59/chapters/san-diego/behavior/graphics/Cord_clips.JPG
451 0.01%29/Mar/05 07:18/care/sick.html
450 0.01%29/Mar/05 07:07/chapters/san-diego/adoption/company.html
446 0.01%29/Mar/05 09:59/chapters/san-diego/behavior/graphics/Chair_protection2.JPG
446 0.02%29/Mar/05 09:03/rabbit-center/hayward_rescue/hayward_graphics/boy_tumor_exam.jpg
446 0.05%29/Mar/05 09:59/chapters/san-diego/behavior/graphics/Bitter_preparations.JPG
445 29/Mar/05 07:33/rabbit-center/retail/carrot.gif
445 0.01%29/Mar/05 08:21/journal/3-12/allergies.html
444 29/Mar/05 05:07/easter/flyer/flyer1.html
444 0.01%29/Mar/05 09:59/chapters/san-diego/behavior/graphics/mats.jpg
442 0.03%29/Mar/05 08:51/rabbit-center/lucky/images/adopted-1.gif
442 0.02%29/Mar/05 08:51/rabbit-center/lucky/images/adopted-4.gif
441 29/Mar/05 09:59/chapters/san-diego/behavior/graphics/Chair_protection1.JPG
441 0.02%29/Mar/05 08:51/rabbit-center/lucky/images/adopted-3.gif
441 29/Mar/05 09:42/chapters/san-diego/products/coloring_book.html
441 0.02%29/Mar/05 09:03/rabbit-center/hayward_rescue/hayward_graphics/yellow_boy_exam_3.jpg
441 0.03%29/Mar/05 08:51/rabbit-center/lucky/images/adopted-2.gif
440 29/Mar/05 09:34/rabbit-center/hayward_rescue/hayward_graphics/Toby_1.JPG
439 0.01%29/Mar/05 08:02/journal/3-12/graphics/litter-training1.gif
439 29/Mar/05 09:39/chapters/oregon/rabbits.html
439 0.01%29/Mar/05 08:02/journal/3-12/graphics/litter-training2.gif
439 0.03%29/Mar/05 08:51/rabbit-center/lucky/images/adopted-7.gif
438 0.01%29/Mar/05 07:33/rabbit-center/retail/store1S.jpg
437 0.02%29/Mar/05 08:51/rabbit-center/lucky/images/adopted-5.gif
437 0.02%29/Mar/05 09:33/hrs-info/vet-conference/attendees-alpha.html
436 0.05%29/Mar/05 09:03/rabbit-center/hayward_rescue/hayward_graphics/bonepile.jpg
436 0.02%29/Mar/05 08:51/rabbit-center/lucky/images/adopted-6.gif
435 0.01%29/Mar/05 07:33/rabbit-center/retail/store2S.jpg
434 0.01%29/Mar/05 09:52/chapters/san-diego/aboutus/
434 0.01%29/Mar/05 08:48/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/avian_2.jpg
432 29/Mar/05 07:36/links/sections/fun-facts.html
431 29/Mar/05 09:03/rabbit-center/hayward_rescue/hayward_graphics/shed.jpg
431 0.01%29/Mar/05 07:33/rabbit-center/retail/store3S.jpg
431 29/Mar/05 09:59/chapters/san-diego/behavior/graphics/haytube.JPG
429 29/Mar/05 09:34/rabbit-center/hayward_rescue/hayward_graphics/Julie-k_Toby.jpg
429 0.01%28/Mar/05 23:15/graphics/fun/netbunnies/ChipEat2.JPG
428 0.01%29/Mar/05 09:59/chapters/san-diego/behavior/graphics/chew_toys.JPG
425 0.01%29/Mar/05 05:58/journal/3-3/law-rabbit.html
425 0.01%29/Mar/05 09:11/chapters/san-diego/behavior/rabbit_digs.html
424 29/Mar/05 05:27/chapters/oregon/images/buttonbar_01.gif
424 0.01%29/Mar/05 09:54/journal/2-1/loss-support.html
424 0.01%27/Mar/05 13:09/chapters/san-diego/adoption/Adoption_Photos/Eva_adoption_Jan05.jpg
424 29/Mar/05 09:46/chapters/san-diego/health/graphics/morebadteeth.jpg
424 0.01%29/Mar/05 09:03/chapters/san-diego/behavior/bonding.html
423 0.01%29/Mar/05 09:04/chapters/san-diego/behavior/graphics/Basket_toys.JPG
422 29/Mar/05 07:11/links/sections/zipzoefoo.html
422 27/Mar/05 13:09/chapters/san-diego/adoption/Adoption_Photos/Spencer_adoption_Feb05.jpg
420 29/Mar/05 05:27/chapters/oregon/images/buttonbar_02.gif
420 0.01%29/Mar/05 08:48/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Massage_1.JPG
420 29/Mar/05 05:27/chapters/oregon/images/banner_450x120.jpg
419 0.01%27/Mar/05 13:09/chapters/san-diego/adoption/Adoption_Photos/Bubba_Yamaha_adoption_6Feb05.jpg
419 29/Mar/05 09:59/chapters/san-francisco/carrot.gif
419 0.01%27/Mar/05 20:03/chapters/san-diego/adoption/Adoption_Photos/Camille_adoption_Jan05.jpg
419 27/Mar/05 13:09/chapters/san-diego/adoption/Adoption_Photos/Shane_adoption_23Jan05.jpg
419 29/Mar/05 05:27/chapters/oregon/images/buttonbar_07.gif
419 0.01%29/Mar/05 09:04/chapters/san-diego/behavior/graphics/Choices.JPG
418 29/Mar/05 05:27/chapters/oregon/images/buttonbar_04.gif
418 29/Mar/05 05:27/chapters/oregon/images/buttonbar_05.gif
418 0.01%29/Mar/05 09:59/links/sections/memorial.html
418 29/Mar/05 05:27/chapters/oregon/images/buttonbar_03.gif
418 29/Mar/05 05:27/chapters/oregon/images/buttonbar_06.gif
417 0.01%29/Mar/05 09:03/rabbit-center/hayward_rescue/hayward_graphics/corpse1.jpg
416 29/Mar/05 09:36/links/sections/karma.html
416 0.01%27/Mar/05 19:33/chapters/san-diego/adoption/Adoption_Photos/Autumn_adoption_Jan05.jpg
415 0.01%29/Mar/05 07:16/chapters/san-diego/behavior/altering.html
414 0.01%29/Mar/05 09:04/chapters/san-diego/behavior/graphics/mischief.jpg
413 29/Mar/05 09:59/chapters/san-francisco/bun.gif
412 0.01%29/Mar/05 08:52/rabbit-center/adoptables/graphics/big/R697 Moki 35 sml.jpg
412 0.01%29/Mar/05 09:44/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Brown-eyed_bun.JPG
412 0.22%27/Mar/05 13:09/chapters/san-diego/adoption/Adoption_Photos/Ricky_adoption_collage.jpg
411 29/Mar/05 09:59/chapters/san-francisco/home-banner.gif
409 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Raffle_table.JPG
406 29/Mar/05 06:50/rabbit-center/resources/images/no-pict.gif
405 0.01%29/Mar/05 09:30/chapters/san-diego/health/vet-talk/coccidia.html
405 28/Mar/05 23:58/chapters/mid-penninsula/adoptables.html
404 0.01%29/Mar/05 07:33/graphics/fun/netbunnies/Bonbon-Kayleigh.JPG
403 29/Mar/05 09:59/chapters/san-francisco/leap2.gif
403 0.03%29/Mar/05 08:55/rabbit-center/lucky/images/recent-1_000.gif
401 0.01%29/Mar/05 09:55/chapters/san-diego/behavior/know_thumper.html
400 0.02%29/Mar/05 08:55/rabbit-center/lucky/images/recent-3_000.gif
399 0.02%29/Mar/05 08:55/rabbit-center/lucky/images/recent-4.gif
399 0.01%27/Mar/05 19:58/chapters/san-diego/adoption/Adoption_Photos/HA_Michael_Dec04.jpg
399 0.04%29/Mar/05 08:55/rabbit-center/lucky/images/recent-2.gif
399 29/Mar/05 09:59/chapters/san-francisco/run2.gif
398 0.01%27/Mar/05 20:10/chapters/san-diego/adoption/Adoption_Photos/HA_Sinjin_Dec04.jpg
398 0.02%27/Mar/05 13:09/chapters/san-diego/adoption/Adoption_Photos/Ginger_Marley_adoption_composite.jpg
397 29/Mar/05 09:39/links/history.html
396 0.03%29/Mar/05 08:55/rabbit-center/lucky/images/recent-6.gif
396 0.02%29/Mar/05 08:55/rabbit-center/lucky/images/recent-5.gif
395 29/Mar/05 08:55/rabbit-center/lucky/images/back_photos_002.gif
394 0.01%29/Mar/05 05:56/chapters/san-diego/diet/rabbit_GI_physiology.html
394 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Book_signing.JPG
393 0.01%29/Mar/05 08:44/chapters/san-diego/diet/pellets.html
393 0.06%27/Mar/05 19:42/chapters/san-diego/adoption/Adoption_Photos/AngelBaby_adoption_Oct04.JPG
393 27/Mar/05 19:28/chapters/san-diego/adoption/Adoption_Photos/Wendy_Moe_adoption_Dec04.jpg
392 0.05%27/Mar/05 20:10/chapters/san-diego/adoption/Adoption_Photos/Hornsby_Angel_3.JPG
387 0.01%29/Mar/05 08:40/journal/3-9/bonding.html
386 0.01%29/Mar/05 06:55/journal/2-5/yes-to-rabbits.html
383 29/Mar/05 08:19/chapters/san-diego/behavior/expect.html
383 29/Mar/05 09:42/chapters/san-diego/products/graphics/smbookcover.jpg
380 29/Mar/05 09:16/links/sections/mailing-lists.html
379 0.02%27/Mar/05 19:48/chapters/san-diego/adoption/Adoption_Photos/Timmons_adoption_3Oct04.JPG
378 0.01%27/Mar/05 20:07/chapters/san-diego/adoption/Adoption_Photos/Biscuit_Alexander_adoption_3Oct04.JPG
378 27/Mar/05 20:01/chapters/san-diego/adoption/Adoption_Photos/Biscuit_Alexander_adoption_2_oct04.jpg
377 0.01%29/Mar/05 08:20/rabbit-center/adoptables/graphics/big/luke3-r1396-47sml.jpg
376 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/CRM_booth.JPG
373 0.01%27/Mar/05 20:01/chapters/san-diego/adoption/Adoption_Photos/HA_Baxter_Scooter_04Jul04b.jpg
373 29/Mar/05 05:53/journal/2-5/gift.html
373 0.01%27/Mar/05 12:48/chapters/san-diego/adoption/Adoption_Photos/HA_Oreo_05Sep04.jpg
373 29/Mar/05 07:20/journal/3-11/trucking.html
372 0.01%29/Mar/05 08:13/rabbit-center/adoptables/graphics/big/R695 Christian 11 sml.jpg
372 0.02%27/Mar/05 20:11/chapters/san-diego/adoption/Adoption_Photos/Timmy_adoption_18Jul04.jpg
371 29/Mar/05 09:00/journal/2-5/enteritis.html
371 29/Mar/05 08:07/adoption/adoption-policies.html
371 0.06%27/Mar/05 19:36/chapters/san-diego/adoption/Adoption_Photos/Bun Inca George Nicole.JPG
366 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Garden_variety.JPG
365 27/Mar/05 20:11/chapters/san-francisco/adopt.gif
365 29/Mar/05 04:25/health/abscess.html
364 0.01%29/Mar/05 09:31/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Black_agouti.JPG
364 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Kids_Korner_1.JPG
363 27/Mar/05 20:00/chapters/san-francisco/care.gif
363 0.01%29/Mar/05 09:34/rabbit-center/hayward_rescue/hayward_rabbits_toby_tribute.html
362 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/2_white_bunnies.JPG
362 27/Mar/05 19:40/chapters/san-francisco/events.gif
359 0.01%29/Mar/05 09:11/graphics/mine/foo/3-under-bed.jpg
358 29/Mar/05 08:27/journal/3-7/graphics/rescue-circle.gif
357 0.01%29/Mar/05 06:09/chapters/san-diego/behavior/travel.html
356 29/Mar/05 06:26/journal/1/sara.html
356 28/Mar/05 23:14/graphics/fun/netbunnies/Bunny.gif
356 0.01%29/Mar/05 09:55/chapters/san-diego/adoption/Adoption_Photos/HRS_Honey_3_11Jul03.JPG
353 0.03%29/Mar/05 07:03/graphics/fun/netbunnies/Bunny_in_a_Bowl_1.gif
353 0.01%29/Mar/05 09:35/journal/2-10/gutherie.html
352 0.07%29/Mar/05 07:22/chapters/san-diego/diet/Food_Chart.pdf
352 29/Mar/05 06:50/rabbit-center/resources/
352 29/Mar/05 09:18/vets/vet-list-additions.html
352 29/Mar/05 07:11/graphics/thumbnails/tiny-king-foo.gif
350 29/Mar/05 08:21/journal/3-12/graphics/allergies.gif
349 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/T-Touch_demo_1.JPG
348 29/Mar/05 09:34/journal/3-11/thorax.html
348 29/Mar/05 08:33/rabbit-center/graphics/icon_boardpage.gif
346 29/Mar/05 07:55/journal/3-9/oral-health.html
343 29/Mar/05 07:21/graphics/
16 27/Mar/05 21:55  /graphics/?M=A
15 27/Mar/05 21:55  /graphics/?D=A
11 27/Mar/05 21:55  /graphics/?N=D
341 0.01%29/Mar/05 09:54/chapters/san-diego/diet/hayisbasis.html
341 0.01%29/Mar/05 09:51/journal/4-7/hay.html
341 29/Mar/05 09:51/journal/4-7/bereavedbunny.html
339 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/T-Touch_demo_2.JPG
338 0.01%29/Mar/05 07:08/journal/3-10/graphics/pain.gif
337 0.02%29/Mar/05 09:55/graphics/postcard/tracy.jpg
336 29/Mar/05 07:11/graphics/thumbnails/tiny-izzy.gif
336 0.01%29/Mar/05 09:33/help/subject-index.html
336 0.01%29/Mar/05 05:58/journal/3-3/graphics/law.gif
334 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Dr_Loudis.JPG
333 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/T-Touch_demo_3.JPG
333 0.01%29/Mar/05 08:54/chapters/san-diego/health/vet-talk/dental.html
331 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Bunny_demo.JPG
329 28/Mar/05 23:14/graphics/fun/netbunnies/BunnySniff.JPG
329 0.01%29/Mar/05 09:50/chapters/san-diego/behavior/litter_compare.html
327 29/Mar/05 08:50/journal/2-9/rebel-with-paws.html
326 29/Mar/05 09:12/journal/2-9/recordkeeping.html
325 29/Mar/05 09:39/links/sections/links.html
323 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/ed_booth.jpg
322 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Silver_lop.JPG
322 29/Mar/05 07:11/graphics/thumbnails/tiny-zippy.gif
319 29/Mar/05 09:46/chapters/san-diego/health/vet-talk/sludge.html
317 29/Mar/05 08:04/help/search.html
317 29/Mar/05 07:59/journal/3-9/palmer.html
317 29/Mar/05 09:51/care/angora.html
316 0.01%29/Mar/05 08:29/care/vhd.html
315 29/Mar/05 08:15/journal/2-8/quality-of-life.html
314 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Ask-a-Vet_3.JPG
314 0.01%28/Mar/05 12:41/chapters/san-diego/diet/plants.html
314 29/Mar/05 07:11/graphics/thumbnails/tiny-zowie.gif
313 0.02%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/auction_photos-2004.html
313 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Ask-a-Vet_2.JPG
313 29/Mar/05 06:18/chapters/oregon/images/leslieelliot.jpg
312 29/Mar/05 06:24/chapters/oregon/
312 29/Mar/05 07:19/chapters/san-diego/behavior/quiz/nextquestion.gif
312 29/Mar/05 07:19/chapters/san-diego/behavior/quiz/next-arrow.gif
310 29/Mar/05 08:26/translations/portugese/
310 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Bunny_tech.JPG
307 29/Mar/05 08:07/journal/1/jb.html
307 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Pottery_vendor.JPG
304 0.01%29/Mar/05 06:54/rabbit-center/lucky/letter-writting.htm
304 29/Mar/05 05:43/journal/3-1/graphics/dorothy.gif
304 0.01%29/Mar/05 09:34/rabbit-center/hayward_rescue/hayward_graphics/tt_6.JPG
304 0.01%29/Mar/05 09:34/rabbit-center/hayward_rescue/hayward_graphics/tt_1.JPG
304 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Bfest_view.JPG
303 29/Mar/05 09:03/fun/answer13.html
302 29/Mar/05 08:04/cgi-bin/suid/~rabbit2/search
302 0.01%29/Mar/05 09:47/chapters/san-diego/health/vet-talk/elderly.html
302 29/Mar/05 05:43/journal/3-1/graphics/learn-1.gif
301 29/Mar/05 05:43/journal/3-1/graphics/learn-2.gif
301 0.01%29/Mar/05 09:34/rabbit-center/hayward_rescue/hayward_graphics/tt-3.JPG
301 0.01%28/Mar/05 14:53/hrs-info/stats/day.html
301 29/Mar/05 09:05/chapters/san-diego/aboutus/feedback.html
301 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Spotted_bunny.JPG
300 29/Mar/05 05:53/journal/3-7/ungetaway.html
300 0.01%29/Mar/05 09:34/rabbit-center/hayward_rescue/hayward_graphics/tt_3.JPG
300 29/Mar/05 08:51/rabbit-center/lucky/luckysaved.htm
300 0.02%29/Mar/05 09:34/rabbit-center/hayward_rescue/hayward_graphics/toby_ramp.JPG
300 0.07%29/Mar/05 08:12/adopt-a-rabbit-month/MythFlyer2003.pdf
300 0.01%29/Mar/05 08:52/chapters/san-diego/adoption/Easter/easter.html
300 0.02%29/Mar/05 09:34/rabbit-center/hayward_rescue/hayward_graphics/tt_2.JPG
299 29/Mar/05 01:32/rabbit-center/links.html
298 0.01%29/Mar/05 09:40/rabbit-center/adoptables/graphics/thumb/mohawk r1424 09tiny.jpg
298 29/Mar/05 08:15/chapters/san-diego/health/vet-talk/zinc.html
297 0.02%29/Mar/05 09:34/rabbit-center/hayward_rescue/hayward_graphics/tt_5.JPG
297 29/Mar/05 05:52/journal/2-6/reel-rabbits.html
296 29/Mar/05 09:12/journal/2-5/ever-be-friends.html
296 29/Mar/05 08:33/rabbit-center/buddy/
295 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/kw_cages.jpg
294 29/Mar/05 09:52/journal/3-1/floorscapes.html
291 29/Mar/05 08:34/journal/1/making-a-houserabbit.html
290 0.01%29/Mar/05 07:24/journal/2-12/to-fly-or-not-to-fly.html
290 29/Mar/05 04:19/chapters/san-diego/adoption/Adoption_Photos/HA_Jemma_Mar05.jpg
287 28/Mar/05 22:23/chapters/socal/vets.html
287 0.01%29/Mar/05 08:40/journal/3-9/graphics/2snuggling-from-back.gif
286 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Boy_spotted_bunny.JPG
286 29/Mar/05 08:40/journal/3-9/graphics/chase1.gif
285 29/Mar/05 08:40/journal/3-9/graphics/chase2.gif
285 29/Mar/05 09:50/journal/2-6/hasenpfeffer.html
284 29/Mar/05 08:01/journal/4-3/maggots.html
284 29/Mar/05 07:17/chapters/san-diego/health/vet-talk/cuniculi.html
284 29/Mar/05 07:20/journal/3-11/graphics/dutch-munch.gif
282 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Grey_bunny-in-arms.JPG
281 29/Mar/05 04:23/rabbit-center/hayward_rescue/hayward_rabbits_Janet-Lance.html
281 0.08%25/Mar/05 20:54/rabbit-center/events/images/pre_easter.JPG
280 29/Mar/05 04:49/chapters/oregon/images/rex.jpg
280 29/Mar/05 09:46/journal/3-5/beyond-petting.html
280 29/Mar/05 05:48/rabbit-center/retail/cages.html
280 29/Mar/05 08:23/faq/sections/hrs-info.html
279 29/Mar/05 07:31/rabbit-center/hq-volunteer.html
278 29/Mar/05 04:49/chapters/oregon/images/jordan.jpg
278 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/White_mini-lop_2.JPG
277 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Girl_pink-nose.JPG
276 29/Mar/05 08:34/hrs-info/adoption-education-center.html
275 29/Mar/05 09:40/chapters/san-diego/health/vet-talk/cuniculi-up.html
274 29/Mar/05 04:49/chapters/oregon/images/sally.jpg
274 29/Mar/05 07:42/chapters/oregon/images/georgefrancine.jpg
271 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Brown_lop.JPG
270 29/Mar/05 08:22/chapters/michigan/
270 29/Mar/05 09:16/journal/3-12/chiropractor.html
270 29/Mar/05 04:49/chapters/oregon/images/william.jpg
269 29/Mar/05 07:52/journal/3-1/repellent.html
269 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/black_baby_bun.JPG
269 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Big_white_bunny.JPG
268 29/Mar/05 04:49/chapters/oregon/images/bruce.jpg
268 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Bunnies_all.JPG
266 29/Mar/05 00:52/rabbit-center/employment/
266 29/Mar/05 04:49/chapters/oregon/images/maurice.jpg
266 29/Mar/05 08:38/chapters/san-diego/health/molting.html
265 0.23%29/Mar/05 08:52/rabbit-center/lucky/images/safe-2.png
265 0.02%29/Mar/05 08:51/rabbit-center/lucky/images/safe-1.gif
265 29/Mar/05 09:15/rabbit-center/lucky/spayed.htm
265 0.01%29/Mar/05 09:11/graphics/postcard/amos.jpg
265 0.02%29/Mar/05 08:51/rabbit-center/lucky/images/safe-3.gif
265 0.01%29/Mar/05 04:36/graphics/postcard/Tommy2.jpg
264 29/Mar/05 07:14/graphics/fun/netbunnies/blond-3.tif
264 29/Mar/05 08:31/journal/3-8/rabbits-in-the-plural.html
261 0.01%29/Mar/05 09:30/chapters/san-diego/aboutus/bunnyfest/auction_photos-2003.html
259 0.04%27/Mar/05 14:06/chapters/san-diego/adoption/Easter/Stuffed_Bunny.JPG
259 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Big_agouti_bun_2.JPG
259 0.01%29/Mar/05 04:34/graphics/postcard/izzy-portrait-crop.jpg
257 29/Mar/05 08:52/chapters/socal/banner.gif
257 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/blk-wht_dutch-bunny.JPG
257 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/brown_dutch-bunny.JPG
255 27/Mar/05 14:06/chapters/san-diego/adoption/Easter/pixel.gif
255 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Brown_white_dutch.jpg
254 0.01%29/Mar/05 09:34/journal/3-11/graphics/xray1.gif
254 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Grey_bunny_face.JPG
253 29/Mar/05 09:07/graphics/calendars/
12 27/Mar/05 21:57  /graphics/calendars/?M=D
11 27/Mar/05 21:57  /graphics/calendars/?N=A
10 27/Mar/05 04:10  /graphics/calendars/?D=A
253 29/Mar/05 09:34/journal/3-11/graphics/xray3.gif
252 0.01%29/Mar/05 04:26/rabbit-center/adoptables/graphics/big/R700 Hector 71 sml.jpg
251 27/Mar/05 22:05/rabbit-center/updates/svhs/for_svhs.htm
251 0.01%29/Mar/05 09:34/journal/3-11/graphics/xray2.gif
249 28/Mar/05 23:03/journal/2-2/perfection.html
249 0.01%29/Mar/05 09:27/graphics/fun/tinytim.jpg
248 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Grey_bunny_basket.JPG
247 29/Mar/05 09:03/fun/answer12.html
246 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Man-agouti_lop.JPG
246 0.02%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Baseball_front.JPG
245 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/brown_spot_bun.JPG
244 29/Mar/05 06:50/rabbit-center/graphics/icon_resources.gif
244 29/Mar/05 09:53/chapters/san-diego/behavior/losing.html
244 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Tri-color_lop_2.JPG
243 29/Mar/05 08:11/translations/spanish/debo-darle-de-comer.html
243 28/Mar/05 23:46/rabbit-center/hayward_rescue/hayward_rabbits_update_jun6_04.html
242 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/White_baby_bun.JPG
241 29/Mar/05 09:32/links/breed-descriptions.html
240 29/Mar/05 09:58/chapters/san-diego/health/spay_neuter_rebates.html
239 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/dk_brown_lop.JPG
239 29/Mar/05 05:47/rabbit-center/retail/no-pict.gif
239 29/Mar/05 08:11/translations/german/
239 0.01%28/Mar/05 23:27/rabbit-center/hayward_rescue/hayward_rabbits_volunteers.html
238 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/White_bunny_pink-leash.JPG
238 29/Mar/05 08:11/presspolicies.html
238 28/Mar/05 22:41/journal/2-12/thumper-and-me.html
238 28/Mar/05 22:23/chapters/san-diego/health/vet-talk/enteritis.html
236 29/Mar/05 09:45/links/sections/books-fiction.html
236 0.01%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Baseball_back.JPG
236 29/Mar/05 07:11/hrs-info/premiums.html
236 29/Mar/05 09:32/chapters/san-diego/aboutus/events.html
236 28/Mar/05 23:47/rabbit-center/hayward_rescue/hayward_rabbits_johanna.html
235 29/Mar/05 07:38/rabbit-center/lucky/letter-from.htm
235 0.03%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/blue-bunny-earrings.JPG
235 0.01%29/Mar/05 05:37/rabbit-center/adoptables/graphics/big/george-r1397-34sml.jpg
235 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/man_nd.jpg
235 29/Mar/05 03:17/chapters/san-diego/health/vet-talk/stress.html
234 29/Mar/05 09:18/rabbit-center/lucky/sf-crronicle.htm
233 0.01%28/Mar/05 18:39/graphics/fun/netbunnies/IttyBityBuns.JPG
233 29/Mar/05 08:49/chapters/san-diego/health/choosevet.html
233 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/White_bunny_harness.JPG
232 29/Mar/05 09:51/graphics/angora.jpg
232 29/Mar/05 07:17/chapters/san-diego/quizstart.html
232 29/Mar/05 09:27/graphics/fun/lapin.gif
232 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Tri-color_lop.jpg
231 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Seal-point_lop_red-leash.JPG
231 29/Mar/05 09:08/chapters/san-diego/behavior/toys.html
231 29/Mar/05 08:07/chapters/san-diego/health/health-cert.html
231 0.01%29/Mar/05 08:50/rabbit-center/lucky/images/spayed-1.gif
231 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/brn_wht_spot_bunny.JPG
230 0.01%29/Mar/05 08:50/rabbit-center/lucky/images/spayed-3.gif
230 29/Mar/05 08:03/journal/3-2/disabled.html
230 0.01%29/Mar/05 08:50/rabbit-center/lucky/images/spayed-2.gif
229 28/Mar/05 15:55/easter/grail.mid
229 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/White_bunny_small.JPG
229 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Bunny_and_basket.jpg
229 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/English_spot.JPG
228 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Dk_brn_bunny-on-leash.jpg
228 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/White_bunny_basket.JPG
228 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/brown_white_bunny-pair.JPG
227 29/Mar/05 09:03/fun/answer8.html
227 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Lop_bunny_harness.JPG
226 29/Mar/05 09:05/rabbit-center/hayward_rescue/hayward_rabbits_toby.html
226 29/Mar/05 09:05/chapters/san-diego/adoption/right.html
226 29/Mar/05 07:33/graphics/fun/netbunnies/Freckles-1.JPG
226 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Dutch_in_grass.JPG
225 29/Mar/05 08:11/index-small.html
224 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Red_lady_spot_bunny.jpg
223 0.01%29/Mar/05 05:40/care/living-with-a-houserabbit.pdf
223 28/Mar/05 12:51/graphics/breeds/
12 27/Mar/05 21:57  /graphics/breeds/?N=A
11 27/Mar/05 21:57  /graphics/breeds/?D=D
11 27/Mar/05 21:57  /graphics/breeds/?M=D
11 27/Mar/05 13:17  /graphics/breeds/?N=D
223 28/Mar/05 22:04/chapters/san-diego/health/vet-talk/beadtherapy.html
222 29/Mar/05 07:39/care/shavings.html
222 29/Mar/05 07:33/graphics/fun/netbunnies/DCP00205.JPG
222 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/lady_spot_bunny.JPG
222 29/Mar/05 06:38/journal/3-7/stray-roundup.html
222 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Guy_sealpoint_rex.JPG
221 0.01%29/Mar/05 09:04/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Irish_Pewter_Measure.JPG
221 29/Mar/05 09:20/chapters/michigan/x.gif
220 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Old_lop_bunny.JPG
220 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Sarah_S_bunny.JPG
220 0.01%29/Mar/05 04:23/rabbit-center/hayward_rescue/hayward_graphics/Janet_karen.JPG
220 0.02%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/large_bunny_plaque.jpg
220 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/sarah_s.jpg
220 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/lady_eng_spot.JPG
219 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Sarah_S_bunny_2.JPG
219 0.01%29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_rabbits_animal-place.html
219 29/Mar/05 09:56/chapters/san-diego/diet/sources.html
219 28/Mar/05 23:54/rabbit-center/adoptables/graphics/big/spike-sasparilla161tiny.jpg
218 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Mixed_bunny_pair.JPG
218 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Lop_bunny_redhead.JPG
218 29/Mar/05 06:53/graphics/postcard/tabatha.jpg
218 29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/olga103tiny.jpg
217 29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/prana088tiny.jpg
217 29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/zephyr081tiny.jpg
217 0.01%28/Mar/05 20:30/rabbit-center/hayward_rescue/hayward_graphics/Janet_fresh-air.JPG
217 29/Mar/05 09:52/journal/4-7/letters.html
217 29/Mar/05 06:46/hrs-info/policies.html
216 29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/samantha077tiny.jpg
216 29/Mar/05 09:57/chapters/san-diego/adoption/in-house.html
215 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Lisa_Ronco.JPG
215 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/mamas_shoulder.JPG
215 29/Mar/05 04:39/rabbit-center/graphics/smDSC_5138.jpg
214 29/Mar/05 08:57/journal/3-9/bale-of-hay.html
213 29/Mar/05 08:48/chapters/san-diego/health/cool.html
213 0.01%29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Big_agouti_bun.JPG
212 0.01%28/Mar/05 18:39/graphics/fun/netbunnies/IMG044.JPG
212 0.05%28/Mar/05 23:18/graphics/fun/netbunnies/HRS photos 4-12 to 5-3-03
212 0.02%29/Mar/05 08:11/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/perfume_bottle.JPG
212 29/Mar/05 09:27/journal/4-7/friend.html
212 29/Mar/05 08:47/journal/3-2/litter-diggers.html
211 29/Mar/05 07:58/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Sleepy_Casey.JPG
210 29/Mar/05 06:53/fun/answer6.html
209 0.01%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/beatrix_potter_books.JPG
209 29/Mar/05 07:59/journal/3-9/graphics/palmer.gif
208 29/Mar/05 07:59/journal/3-9/graphics/snuggle-bunnies.gif
208 28/Mar/05 23:25/journal/3-7/snake-bite.html
207 0.01%28/Mar/05 23:17/graphics/fun/netbunnies/ElvisandMaddy.JPG
207 29/Mar/05 09:35/journal/3-12/fosterer-allergies.html
207 29/Mar/05 07:32/chapters/san-diego/behavior/bunnies_teaching_bunnies.html
207 0.01%29/Mar/05 08:33/rabbit-center/buddy/images/buddy1.gif
207 0.01%29/Mar/05 08:33/rabbit-center/buddy/images/garbera3.gif
206 29/Mar/05 09:52/journal/3-1/graphics/fifi.gif
206 29/Mar/05 09:52/journal/3-1/graphics/wascel.gif
206 29/Mar/05 09:52/journal/3-1/graphics/george.gif
205 29/Mar/05 09:04/journal/3-7/places-to-be.html
205 29/Mar/05 01:32/rabbit-center/graphics/icon_links.gif
205 29/Mar/05 04:24/journal/4-5/frith.html
204 29/Mar/05 09:05/journal/3-1/trouble-with-ears.html
203 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/calendar.jpg
203 28/Mar/05 19:18/graphics/fun/netbunnies/Lovers2.JPG
203 0.02%29/Mar/05 08:05/rabbit-center/hayward_rescue/hayward_graphics/eileen_page_bottom.jpg
203 0.01%29/Mar/05 08:33/rabbit-center/buddy/images/buddy2.gif
202 29/Mar/05 09:54/journal/4-7/study.html
202 29/Mar/05 05:53/journal/3-7/graphics/ungetaway.gif
202 29/Mar/05 08:33/rabbit-center/buddy/images/buddy-traced.gif
201 0.01%28/Mar/05 20:30/rabbit-center/hayward_rescue/hayward_graphics/Lance_Phyllis.jpg
201 29/Mar/05 08:05/rabbit-center/hayward_rescue/hayward_rabbits_district_attny.html
201 29/Mar/05 06:07/adopt-a-rabbit-month/press-release-04.html
201 0.01%29/Mar/05 09:05/graphics/mine/foo33.jpg
201 29/Mar/05 07:57/journal/4-4/pandora.html
201 29/Mar/05 07:59/chapters/san-diego/adoption/new_zealands.html
200 17/Mar/05 02:23/rabbit-center/css/mm_travel2.css
198 29/Mar/05 08:42/chapters/oakland/woolblok.html
198 29/Mar/05 09:58/chapters/san-diego/adoption/supplies.html
198 0.01%29/Mar/05 09:50/journal/2-6/graphics/hasie-2.gif
197 0.02%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/blue_porcelain_bunny.JPG
197 28/Mar/05 15:55/easter/hidden-egg.html
196 0.01%29/Mar/05 09:53/rabbit-center/retail/cubesetL.jpg
196 29/Mar/05 06:35/journal/3-4/kids-program.html
196 0.02%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/chargers_basket.jpg
195 29/Mar/05 08:00/rabbit-center/hayward_rescue/hayward_rabbits_eileen.html
194 29/Mar/05 08:19/chapters/san-diego/health/vet-talk/frontline.html
193 29/Mar/05 08:14/hrs-info/history.html
193 28/Mar/05 18:27/rabbit-center/hayward_rescue/hayward_graphics/hayward4.jpg
192 0.01%29/Mar/05 09:10/graphics/mine/zippy1.jpg
192 0.01%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/coffee_cookie_bsket.JPG
192 29/Mar/05 09:15/chapters/san-diego/health/death.html
191 29/Mar/05 05:47/rabbit-center/retail/cubesetS.jpg
191 17/Mar/05 02:21/rabbit-center/updates/svhs/images/mm_spacer.gif
191 28/Mar/05 21:33/rabbit-center/adoptpolicies.html
191 29/Mar/05 00:03/journal/2-5/wabbit.html
190 17/Mar/05 02:23/rabbit-center/updates/svhs/images/Sweet_Little_Lonard.JPG
190 29/Mar/05 05:14/links/sections/stories-rabbits-tell.html
190 0.03%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/ice_tea_basket.JPG
190 29/Mar/05 05:47/rabbit-center/retail/lrgcageS.jpg
189 0.02%28/Mar/05 20:31/rabbit-center/hayward_rescue/hayward_graphics/Janet_Lance_karens-lap.JPG
188 17/Mar/05 02:21/rabbit-center/updates/svhs/images/Frightened_lop_boy.JPG
188 17/Mar/05 02:21/rabbit-center/updates/svhs/images/Little_Daphne.JPG
188 0.01%29/Mar/05 08:23/graphics/mine/foo/4-under-bed.jpg
188 17/Mar/05 02:21/rabbit-center/updates/svhs/images/Very_scare_lop_boy.JPG
188 17/Mar/05 02:21/rabbit-center/updates/svhs/images/Exquisitely_soft_Edie_female.JPG
188 17/Mar/05 02:21/rabbit-center/updates/svhs/images/Loving_bonded_pair_Telah_Gemmy.JPG
188 29/Mar/05 06:27/translations/japanese/red-urine-j.txt
188 17/Mar/05 02:21/rabbit-center/updates/svhs/images/10_5_pound_FuFU_LOTS_OFBUNNY_tolove.JPG
188 17/Mar/05 02:21/rabbit-center/updates/svhs/images/Pretty_little_Daphne.JPG
188 29/Mar/05 07:19/chapters/san-diego/behavior/quiz/q2.html
188 17/Mar/05 02:21/rabbit-center/updates/svhs/images/Unnamed_black_bun_servers_a_home.JPG
188 17/Mar/05 02:21/rabbit-center/updates/svhs/images/Cute_LIttle_Benny.JPG
188 17/Mar/05 02:21/rabbit-center/updates/svhs/images/Gorgeous_and_sweet_Crackers.JPG
188 17/Mar/05 02:21/rabbit-center/updates/svhs/images/Happy_Norman_the_bun.JPG
187 29/Mar/05 08:18/graphics/postcard/
11 28/Mar/05 09:05  /graphics/postcard/?D=A
11 27/Mar/05 21:56  /graphics/postcard/?M=A
11 28/Mar/05 06:58  /graphics/postcard/?N=D
187 17/Mar/05 02:21/rabbit-center/updates/svhs/images/Miss_B_Misses_her_mate_Piko.JPG
187 17/Mar/05 02:21/rabbit-center/updates/svhs/images/playful_Dante_000.JPG
187 29/Mar/05 06:53/fun/answer5.html
187 0.01%28/Mar/05 20:30/rabbit-center/hayward_rescue/hayward_graphics/Lance_med-facility.JPG
187 17/Mar/05 02:21/rabbit-center/updates/svhs/images/Sweet_Piko_missed_his_Miss_B.JPG
187 29/Mar/05 09:03/fun/answer11.html
187 17/Mar/05 02:21/rabbit-center/updates/svhs/images/Joyful_Pancho.JPG
187 17/Mar/05 02:21/rabbit-center/updates/svhs/images/Cute_Heffy_male.JPG
187 0.01%28/Mar/05 20:31/rabbit-center/hayward_rescue/hayward_graphics/Lance_relaxing.JPG
187 17/Mar/05 02:21/rabbit-center/updates/svhs/images/Little_golden_boy.JPG
186 27/Mar/05 22:35/rabbit-center/adoptables/graphics/thumb/baloo-tiny.jpg
184 28/Mar/05 18:27/rabbit-center/hayward_rescue/hayward_graphics/hayward3.jpg
183 0.01%28/Mar/05 21:40/help/toc.html
183 29/Mar/05 07:47/rabbit-center/lucky/release_adopted.htm
182 28/Mar/05 18:27/rabbit-center/hayward_rescue/hayward_graphics/hayward2.jpg
182 29/Mar/05 04:19/chapters/san-diego/adoption/Adoption_Photos/HA_Alex_Mar05.jpg
182 29/Mar/05 04:19/hrs-info/volunteer.html
182 28/Mar/05 18:27/rabbit-center/hayward_rescue/hayward_graphics/hayward1.jpg
181 28/Mar/05 18:38/rabbit-center/hayward_rescue/hayward_graphics/johanna_medical_exam.JPG
181 28/Mar/05 21:53/journal/3-2/marshmallow.html
180 29/Mar/05 05:03/chapters/san-diego/behavior/digger.html
180 0.01%29/Mar/05 07:42/rabbit-center/adoptables/graphics/big/baloo-sml.jpg
180 29/Mar/05 03:57/journal/3-8/numbers.html
179 29/Mar/05 07:19/chapters/san-diego/behavior/quiz/q3.html
179 29/Mar/05 08:47/graphics/mine/fripouille.html
179 28/Mar/05 23:23/rabbit-center/hayward_rescue/hayward_rabbits_play-areas.html
178 29/Mar/05 07:33/rabbit-center/graphics/icon_involvedpage.gif
178 29/Mar/05 07:19/chapters/san-diego/behavior/quiz/q4.html
177 0.01%28/Mar/05 18:38/rabbit-center/hayward_rescue/hayward_graphics/johanna_growth.JPG
177 29/Mar/05 07:21/chapters/san-diego/behavior/quiz/q8.html
177 29/Mar/05 09:02/journal/3-2/drawing-blood.html
177 29/Mar/05 07:21/chapters/san-diego/behavior/quiz/q7.html
176 29/Mar/05 07:20/chapters/san-diego/behavior/quiz/q6.html
176 29/Mar/05 07:23/chapters/san-diego/behavior/quiz/q10.html
176 29/Mar/05 07:20/chapters/san-diego/behavior/quiz/q5.html
176 0.01%28/Mar/05 18:38/rabbit-center/hayward_rescue/hayward_graphics/johanna_shelter.JPG
176 0.01%28/Mar/05 18:38/rabbit-center/hayward_rescue/hayward_graphics/johanna_better_now.JPG
176 0.01%28/Mar/05 18:39/rabbit-center/hayward_rescue/hayward_graphics/happy_johanna.JPG
174 29/Mar/05 07:22/chapters/san-diego/behavior/quiz/q9.html
174 0.01%28/Mar/05 18:39/rabbit-center/hayward_rescue/hayward_graphics/Zorro_mask.JPG
174 0.01%28/Mar/05 18:39/rabbit-center/hayward_rescue/hayward_graphics/Zorro_testicle-growth.JPG
174 0.01%28/Mar/05 18:39/rabbit-center/hayward_rescue/hayward_graphics/Zorro_w-Karen.JPG
174 0.01%28/Mar/05 18:39/rabbit-center/hayward_rescue/hayward_graphics/Michael_abscess.JPG
174 29/Mar/05 04:08/care/tips99.html
173 29/Mar/05 09:54/hrs-info/membership-form.html
173 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Bigbunnyball.jpg
173 29/Mar/05 01:52/chapters/san-diego/behavior/new_home.html
173 29/Mar/05 06:53/fun/answer4.html
172 0.02%29/Mar/05 09:05/rabbit-center/hayward_rescue/hayward_graphics/Toby_playing.JPG
172 29/Mar/05 09:07/chapters/san-diego/behavior/besttoy.html
172 28/Mar/05 23:19/journal/3-9/companions-not-dinner.html
172 0.01%29/Mar/05 07:42/rabbit-center/adoptables/graphics/big/sara1-sml.jpg
172 29/Mar/05 07:19/chapters/san-diego/behavior/quiz/q4answer_true.html
172 29/Mar/05 06:35/journal/3-4/daycare.html
172 29/Mar/05 07:32/chapters/san-diego/behavior/graphics/looking-in-crate.gif
171 0.01%28/Mar/05 18:39/rabbit-center/hayward_rescue/hayward_graphics/Michael_Karen.JPG
171 28/Mar/05 22:47/rabbit-center/hayward_rescue/hayward_graphics/zorro_dr-harvey.jpg
171 28/Mar/05 22:44/journal/2-6/rick-fred-pj.html
171 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/smbunnyball.jpg
171 0.01%29/Mar/05 08:31/journal/3-8/graphics/plural.gif
170 29/Mar/05 09:19/rabbit-center/lucky/PETA.htm
170 28/Mar/05 19:18/graphics/fun/netbunnies/IMG02.JPG
170 0.01%28/Mar/05 18:40/rabbit-center/hayward_rescue/hayward_graphics/Micheal_w-boys.JPG
169 29/Mar/05 07:32/chapters/san-diego/behavior/graphics/peering-above-crate.gif
169 29/Mar/05 08:21/chapters/san-diego/health/vet-talk/
169 29/Mar/05 07:49/graphics/mine/toby-izzy/
11 27/Mar/05 21:57  /graphics/mine/toby-izzy/?N=D
10 27/Mar/05 21:57  /graphics/mine/toby-izzy/?D=A
10 27/Mar/05 21:57  /graphics/mine/toby-izzy/?M=A
10 27/Mar/05 21:59  /graphics/mine/toby-izzy/?D=D
169 0.01%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunnykins_album_rabbit.JPG
169 29/Mar/05 08:53/rabbit-center/lucky/letter-to.htm
169 29/Mar/05 08:05/journal/2-11/dont-call-me-kind.html
168 29/Mar/05 07:32/chapters/san-diego/behavior/graphics/2by-crate-gate.gif
168 29/Mar/05 07:19/chapters/san-diego/behavior/quiz/q3answer_true.html
167 29/Mar/05 09:30/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Business_card_holder.JPG
167 29/Mar/05 04:36/journal/4-5/ode.html
167 29/Mar/05 07:19/chapters/san-diego/behavior/quiz/q2answer_false.html
167 29/Mar/05 09:30/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Cybis_Bunny_Snowball_front.JPG
166 28/Mar/05 22:47/rabbit-center/hayward_rescue/hayward_graphics/Dr-Harvey_pregnant_girls.jpg
165 28/Mar/05 22:47/rabbit-center/hayward_rescue/hayward_graphics/Francine_dr-harvey.jpg
165 0.02%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/avon_basket.JPG
165 29/Mar/05 04:41/rabbit-center/retail/treats.html
165 28/Mar/05 22:47/rabbit-center/hayward_rescue/hayward_graphics/Karen_Richard.jpg
165 0.01%28/Mar/05 18:39/graphics/fun/netbunnies/Inseperable0002.JPG
164 29/Mar/05 03:53/journal/warren-wise/new-chapter.html
164 28/Mar/05 23:27/rabbit-center/hayward_rescue/hayward_rabbits_one-group.html
164 29/Mar/05 09:33/journal/3-1/sheltering-spirit.html
164 0.01%28/Mar/05 22:48/chapters/san-diego/adoption/Easter/Rabbits_and_Children.html
164 0.02%29/Mar/05 09:30/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Royal_Doulton_Bunnykins_HighRes.jpg
163 29/Mar/05 08:33/graphics/fun/netbunnies/IMG04.JPG
163 29/Mar/05 07:43/rabbit-center/adopt-procedures.html
163 0.01%29/Mar/05 09:30/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Cybis_Bunny_Bottom.JPG
163 29/Mar/05 09:45/graphics/books/mitten.gif
162 28/Mar/05 14:07/rabbit-center/updates/cupertino_buns.htm
162 29/Mar/05 07:21/chapters/san-diego/behavior/quiz/q7answer_true.html
162 0.01%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/F&F_teapot.JPG
161 29/Mar/05 07:43/rabbit-center/graphics/adopt-t.gif
161 28/Mar/05 18:40/graphics/fun/netbunnies/LEO-2-small.JPG
161 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/flying_bunny_flower_pitcher.JPG
161 29/Mar/05 02:07/journal/3-8/multi-maintenance.html
161 29/Mar/05 07:25/opinion/petco.html
161 0.01%29/Mar/05 08:13/translations/spanish/brochure-spanish.html
160 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/thermometer.JPG
160 28/Mar/05 13:59/easter/solong-edit.mid
159 29/Mar/05 07:22/chapters/san-diego/behavior/quiz/q9answer_false.html
159 29/Mar/05 02:35/journal/3-8/words.html
159 29/Mar/05 08:15/chapters/san-francisco/docs.html
158 29/Mar/05 09:16/journal/3-12/graphics/chiro.gif
158 0.01%29/Mar/05 04:36/graphics/postcard/Rab1.jpg
157 29/Mar/05 07:20/chapters/san-diego/behavior/quiz/q5answer_false.html
157 0.01%29/Mar/05 06:52/graphics/postcard/strawberry-white-baby.jpg
156 29/Mar/05 04:40/rabbit-center/retail/toys.html
156 29/Mar/05 05:38/chapters/san-diego/health/eye_scanning.html
156 28/Mar/05 22:47/rabbit-center/hayward_rescue/hayward_graphics/Frankie_dr-harvey.jpg
156 29/Mar/05 09:56/care/north-carolina-vets.txt
155 29/Mar/05 09:07/journal/3-10/conference.html
155 28/Mar/05 07:32/chapters/michigan/fosters.html
155 0.01%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/pellet_jar.JPG
155 0.01%29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/animal_place_girls_emerge.jpg
155 29/Mar/05 07:36/rabbit-center/retail/bags.html
155 29/Mar/05 09:45/graphics/books/watershipdown.gif
154 29/Mar/05 09:03/fun/answer10.html
154 29/Mar/05 04:42/chapters/oakland/oldbun.html
154 29/Mar/05 09:41/chapters/oakland/fight.html
153 0.01%28/Mar/05 22:47/rabbit-center/hayward_rescue/hayward_graphics/pen_redesign.jpg
153 29/Mar/05 04:19/chapters/san-diego/adoption/Adoption_Photos/Donnie_Leilani_adoption_3_Mar05.jpg
153 29/Mar/05 05:42/journal/4-3/house-fly.html
152 0.01%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/fairy_bird-feeder.JPG
152 28/Mar/05 15:00/graphics/fun/netbunnies/photos-to-upload/
13 28/Mar/05 13:30  /graphics/fun/netbunnies/photos-to-upload/?M=D
12 27/Mar/05 21:54  /graphics/fun/netbunnies/photos-to-upload/?S=A
12 27/Mar/05 21:55  /graphics/fun/netbunnies/photos-to-upload/?S=D
12 27/Mar/05 21:55  /graphics/fun/netbunnies/photos-to-upload/?N=A
11 27/Mar/05 21:55  /graphics/fun/netbunnies/photos-to-upload/?D=A
11 27/Mar/05 21:54  /graphics/fun/netbunnies/photos-to-upload/?M=A
152 28/Mar/05 18:39/graphics/fun/netbunnies/IMG13.JPG
152 0.02%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Country_Art_Rabbit.JPG
152 0.02%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/baby_bib_bunny.JPG
152 28/Mar/05 22:47/rabbit-center/hayward_rescue/hayward_graphics/Samantha_dr-harvey.jpg
151 28/Mar/05 22:44/journal/3-9/diners-beware.html
151 28/Mar/05 23:04/rabbit-center/hayward_rescue/hayward_rabbits_letter_writing.html
151 29/Mar/05 06:09/hrs-info/supporting.html
151 0.05%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_purse_XL_t-shirt.JPG
151 0.01%29/Mar/05 09:30/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Royal_Doulton_Bunnykins_bottom.JPG
151 29/Mar/05 09:46/graphics/books/rabbit-hill.gif
150 29/Mar/05 09:57/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/lenox_rabbit_cky-jar.jpg
149 28/Mar/05 12:04/links/calendar.html
149 29/Mar/05 09:45/graphics/books/amazon.gif
149 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/charming_tails_carrot-bunny.JPG
149 28/Mar/05 23:30/rabbit-center/hayward_rescue/hayward_rabbits_media_coverage.html
149 29/Mar/05 09:49/hrs-info/whats-new-archive97.html
148 0.02%28/Mar/05 16:27/adopt-a-rabbit-month/ShelterPosterfinal.pdf
148 29/Mar/05 03:11/journal/3-10/pbs.html
148 29/Mar/05 03:17/chapters/san-diego/health/vet-talk/myths.html
148 29/Mar/05 04:31/hrs-info/benefits.html
148 29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/clip_image012.jpg
148 28/Mar/05 22:47/rabbit-center/hayward_rescue/hayward_graphics/Play_structures_installed.jpg
148 0.01%29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/animal_place_chk-out_new_buns.jpg
148 29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/clip_image010.jpg
148 0.01%29/Mar/05 08:03/rabbit-center/hayward_rescue/hayward_graphics/eileen_exam_3.jpg
147 29/Mar/05 08:03/journal/3-2/graphics/disabled-2.gif
147 29/Mar/05 04:41/rabbit-center/retail/deco.html
147 29/Mar/05 03:31/journal/3-6/giving-is-recieving.html
147 29/Mar/05 07:23/chapters/san-diego/behavior/quiz/q10answer_false.html
147 29/Mar/05 09:45/graphics/books/marshmallow.gif
146 28/Mar/05 22:47/rabbit-center/hayward_rescue/hayward_graphics/finishing_pens.jpg
146 29/Mar/05 04:27/rabbit-center/adoptables/graphics/big/R684 Emma 38r1sml.jpg
146 29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/animal_place_prana-move.jpg
146 28/Mar/05 23:24/rabbit-center/hayward_rescue/hayward_rabbits_adoption.html
146 29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/animal_place_sam_boy.jpg
146 29/Mar/05 01:39/journal/3-9/chester.html
145 29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/animal_place_lemonade_rita.jpg
145 29/Mar/05 09:45/graphics/books/tales.gif
145 28/Mar/05 22:47/rabbit-center/hayward_rescue/hayward_graphics/Kelly_s_Zorro.jpg
145 29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/animal_place_toe_cleaning.jpg
144 28/Mar/05 22:47/rabbit-center/hayward_rescue/hayward_graphics/Nancy-J_rabbit-back.jpg
144 29/Mar/05 08:03/journal/3-2/graphics/disabled-1.gif
144 29/Mar/05 06:53/fun/answer7.html
144 29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/animal_place_varina_goat.jpg
144 0.01%29/Mar/05 09:10/graphics/mine/emmybunny.jpg
143 0.01%29/Mar/05 08:02/rabbit-center/hayward_rescue/hayward_graphics/eileen_exam5.jpg
143 28/Mar/05 22:05/journal/2-7/whos-the-pet.html
143 29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/animal_place_sam_rita.jpg
143 29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/animal_place_new_girl.jpg
143 0.01%29/Mar/05 08:01/rabbit-center/hayward_rescue/hayward_graphics/eileen_babies.jpg
143 0.01%29/Mar/05 09:07/graphics/calendars/0763149349_b.jpg
143 29/Mar/05 01:52/chapters/san-diego/products/clothing.html
143 29/Mar/05 09:45/graphics/books/potter.gif
143 29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/animal_place_bunny_temple2.jpg
143 28/Mar/05 14:53/hrs-info/vet-conference/
142 0.01%29/Mar/05 08:01/rabbit-center/hayward_rescue/hayward_graphics/eileen_exam_1.jpg
142 29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/animal_place_sam1.jpg
142 28/Mar/05 22:47/rabbit-center/hayward_rescue/hayward_graphics/Karen_J_Danny.jpg
142 28/Mar/05 22:47/rabbit-center/hayward_rescue/hayward_graphics/Pam-m_Frankie.jpg
142 0.01%29/Mar/05 08:02/rabbit-center/hayward_rescue/hayward_graphics/eileen_exam_2.jpg
142 29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/animal_place_lemonade_girl.jpg
142 29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/animal_place_kibblefest_1.jpg
142 0.01%29/Mar/05 08:00/rabbit-center/hayward_rescue/hayward_graphics/eileen_top_page.jpg
142 29/Mar/05 07:30/chapters/san-francisco/blue.jpeg
141 28/Mar/05 22:04/hrs-info/other-support.html
141 29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/animal_place_lemonade3.jpg
141 29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/animal_place_varina.jpg
141 28/Mar/05 20:28/rabbit-center/hayward_rescue/hayward_graphics/Kerry_S_Janet.jpg
141 29/Mar/05 09:06/rabbit-center/adoptables/graphics/big/R696 Loki 25 sml.jpg
141 28/Mar/05 22:47/rabbit-center/hayward_rescue/hayward_graphics/Kerry_s_frankie.jpg
141 29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/animal_place_new_arrivals2.jpg
140 29/Mar/05 07:34/rabbit-center/retail/care.html
140 29/Mar/05 09:18/help/atomz-hints.html
140 28/Mar/05 22:47/rabbit-center/hayward_rescue/hayward_graphics/Robin_Julie_best-friends.jpg
140 0.01%29/Mar/05 08:04/rabbit-center/hayward_rescue/hayward_graphics/eileen_feeling_better.jpg
140 29/Mar/05 06:39/rescue/resources.html
140 0.02%29/Mar/05 09:09/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Danko_Bunny_Collectibles.JPG
140 29/Mar/05 09:45/graphics/books/velveteen.gif
140 29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/animal_place_regulars1.jpg
140 0.01%29/Mar/05 08:02/rabbit-center/hayward_rescue/hayward_graphics/eileen_exam4.jpg
140 29/Mar/05 09:46/graphics/books/jackrabbit.gif
140 29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/clip_image002.jpg
140 29/Mar/05 08:05/rabbit-center/hayward_rescue/hayward_graphics/Hayward_buns_shelter_3.JPG
140 29/Mar/05 09:17/rabbit-center/hayward_rescue/hayward_graphics/animal_place_kibblefest_2.jpg
140 29/Mar/05 09:56/journal/4-7/visdelight.html
139 29/Mar/05 09:46/graphics/books/runaway-bunny.gif
139 29/Mar/05 08:48/rabbit-center/lucky/media_release.htm
139 29/Mar/05 08:22/chapters/michigan/jeremy2a.jpg
139 29/Mar/05 07:19/chapters/san-diego/behavior/quiz/q1answer_false.html
138 0.02%29/Mar/05 08:04/rabbit-center/hayward_rescue/hayward_graphics/eileen_sprouts.jpg
138 0.01%29/Mar/05 08:05/rabbit-center/hayward_rescue/hayward_graphics/eileen_resting_driveway.jpg
138 28/Mar/05 22:47/rabbit-center/hayward_rescue/hayward_graphics/Liane-ko_Frankie.jpg
138 29/Mar/05 09:18/rabbit-center/adoptables/graphics/big/R705 Java 47 sml.jpg
137 28/Mar/05 22:47/rabbit-center/hayward_rescue/hayward_graphics/Terry-L-Sombra.jpg
137 29/Mar/05 09:07/faqgerman/
136 29/Mar/05 00:57/chapters/san-francisco/overlooked.html
136 29/Mar/05 08:46/rabbit-center/retail/guinea.html
136 29/Mar/05 00:25/care/tips98.html
136 29/Mar/05 07:59/journal/3-8/pound.html
136 28/Mar/05 22:45/chapters/san-diego/health/ears.html
136 28/Mar/05 02:01/graphics/mine/foo/
15 28/Mar/05 00:43  /graphics/mine/foo/?M=D
14 27/Mar/05 21:57  /graphics/mine/foo/?N=D
13 28/Mar/05 00:41  /graphics/mine/foo/?N=A
12 27/Mar/05 21:57  /graphics/mine/foo/?M=A
12 28/Mar/05 00:39  /graphics/mine/foo/?D=D
11 27/Mar/05 21:57  /graphics/mine/foo/?D=A
135 0.01%29/Mar/05 08:05/rabbit-center/hayward_rescue/hayward_graphics/hayward_bunnies_3.jpg
135 28/Mar/05 20:28/rabbit-center/hayward_rescue/hayward_graphics/Kelle_k_Benton.jpg
135 29/Mar/05 07:33/chapters/san-diego/aboutus/member.html
135 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Blue_flwr_trnkt_box.JPG
134 29/Mar/05 09:20/chapters/michigan/boo1.jpg
134 29/Mar/05 09:20/chapters/michigan/sarah2.jpg
134 0.06%28/Mar/05 22:57/hrs-info/stats/all.html
134 29/Mar/05 09:50/journal/warren-wise/fleas.html
134 28/Mar/05 23:30/rabbit-center/lucky/cruelty.htm
133 0.07%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny-stamp_pin.JPG
133 29/Mar/05 08:02/journal/3-10/overgrooming.html
133 29/Mar/05 08:13/chapters/san-diego/behavior/litterbox.html
133 29/Mar/05 09:20/chapters/michigan/mtz1.jpg
133 29/Mar/05 09:50/faqgerman/sections/kastration.html
133 29/Mar/05 09:20/chapters/michigan/ellie2.jpg
132 29/Mar/05 07:30/chapters/san-francisco/bunny-butt.gif
132 28/Mar/05 20:28/rabbit-center/hayward_rescue/hayward_graphics/Yuri_Ito_Benton.jpg
132 29/Mar/05 09:07/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Baby_Lamp.JPG
132 28/Mar/05 22:47/rabbit-center/hayward_rescue/hayward_graphics/Christine_M_Lance.jpg
132 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/charmingtails_photo_frame.JPG
131 29/Mar/05 04:08/translations/japanese/amoxicillin-warning-j.txt
131 28/Mar/05 14:07/rabbit-center/css/mm_computer.css
131 28/Mar/05 22:47/rabbit-center/hayward_rescue/hayward_graphics/Justus_p_baxter.jpg
131 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/flowerpot_white_tshirt.JPG
131 0.01%28/Mar/05 22:47/rabbit-center/hayward_rescue/hayward_graphics/bunny_every_lap.jpg
130 29/Mar/05 09:11/graphics/mine/foo/8-zowie-holiday-inn.jpg
130 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/zen_bunny.JPG
130 28/Mar/05 23:35/journal/2-10/rabbits-on-the-road.html
130 28/Mar/05 23:35/rabbit-center/hayward_rescue/hayward_rabbits_spay-neuter.html
130 28/Mar/05 16:33/graphics/fun/netbunnies/MVC-011S.JPG
129 28/Mar/05 20:28/rabbit-center/hayward_rescue/hayward_graphics/Terry-L_Sombra_nail-trim.jpg
129 29/Mar/05 07:28/rabbit-center/grooming.html
129 28/Mar/05 22:47/rabbit-center/hayward_rescue/hayward_graphics/Pam-M-michael_stroll.jpg
129 29/Mar/05 06:34/graphics/fun/netbunnies/Perla.JPG
129 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_bank_2.JPG
129 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_placemat_bowl.JPG
128 28/Mar/05 21:03/graphics/homepage/hrs-banner.gif
128 29/Mar/05 08:40/hrs-info/whats-new-archive03.html
128 29/Mar/05 09:03/fun/answer9.html
127 29/Mar/05 04:40/rabbit-center/retail/hay.html
127 28/Mar/05 22:47/rabbit-center/hayward_rescue/hayward_graphics/bunnQA.jpg
127 0.02%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/metal_platter.JPG
127 25/Mar/05 19:01/cgi-bin/chat/stream.cgi
28 20/Mar/05 19:35  /cgi-bin/chat/stream.cgi?action=stream&id=aidslanbxnucfjurgczulyurjakccq&pause=
11 21/Mar/05 19:55  /cgi-bin/chat/stream.cgi?action=stream&id=gdbawcqooqwdvjcllngfadezaomtsk&pause=
127 28/Mar/05 15:21/graphics/fun/netbunnies/Nibbel3.JPG
127 28/Mar/05 20:28/rabbit-center/hayward_rescue/hayward_graphics/Kelle_K_Bernie.jpg
127 28/Mar/05 23:56/journal/2-7/hop.html
126 28/Mar/05 16:32/graphics/fun/netbunnies/Lupsu_nolo.bmp
126 28/Mar/05 22:49/rabbit-center/retail/litter.html
126 29/Mar/05 08:22/chapters/michigan/banner.gif
126 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/blanket_purse.JPG
126 29/Mar/05 03:16/hrs-info/whats-new-archive00.html
125 29/Mar/05 03:41/journal/4-3/finders-keepers.html
125 0.01%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/japanese_bowls.JPG
125 28/Mar/05 20:28/rabbit-center/hayward_rescue/hayward_graphics/Carol_S_Jeanne_S_ttouch.jpg
125 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/pet_photo_book.JPG
125 28/Mar/05 20:28/rabbit-center/hayward_rescue/hayward_graphics/Justus_Sam.jpg
125 28/Mar/05 20:28/rabbit-center/hayward_rescue/hayward_graphics/Aimee_R_Zorro.jpg
125 28/Mar/05 20:28/rabbit-center/hayward_rescue/hayward_graphics/Carol_S_bunny_lap.jpg
125 29/Mar/05 09:04/easter/thanks.html
125 28/Mar/05 16:35/graphics/fun/netbunnies/MVC-029S.JPG
124 28/Mar/05 22:45/journal/3-9/you-never-know.html
124 29/Mar/05 09:50/caregerman/leben-mit-kaninchen.html
124 28/Mar/05 20:28/rabbit-center/hayward_rescue/hayward_graphics/Jeanne_S_bunny_lap.jpg
124 28/Mar/05 23:26/rabbit-center/retail/food.html
124 28/Mar/05 20:57/graphics/fun/netbunnies/cookie.gif
124 29/Mar/05 09:03/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Natures_children_plate.JPG
124 29/Mar/05 09:11/graphics/mine/foo/6-licking.jpg
124 28/Mar/05 19:01/hrs-info/vet-conference/vetcon.gif
124 29/Mar/05 08:57/chapters/san-diego/behavior/grief.html
123 0.01%28/Mar/05 20:29/rabbit-center/hayward_rescue/hayward_graphics/boys_love_too.JPG
123 28/Mar/05 06:58/graphics/easter/
123 28/Mar/05 19:55/chapters/oregon/images/sanctuaryheader.jpg
123 28/Mar/05 20:28/rabbit-center/hayward_rescue/hayward_graphics/Kelle_K_boys_driveway_2.jpg
123 28/Mar/05 23:49/journal/3-8/yard-sale-bunny.html
123 28/Mar/05 16:33/graphics/fun/netbunnies/MRBIG01.JPG
123 28/Mar/05 18:40/graphics/fun/netbunnies/Lau2.jpjg
122 28/Mar/05 19:55/chapters/oregon/images/bunnymascot2.jpg
122 28/Mar/05 20:28/rabbit-center/hayward_rescue/hayward_graphics/Karen_J_Janet.jpg
122 28/Mar/05 20:28/rabbit-center/hayward_rescue/hayward_graphics/Phyllis_Lance.jpg
122 28/Mar/05 19:34/journal/3-7/graphics/snake-bite-bunny.gif
122 0.01%28/Mar/05 20:29/rabbit-center/hayward_rescue/hayward_graphics/beginning_structure.JPG
122 29/Mar/05 06:06/rabbit-center/adoptables/graphics/big/R681 Ginger 13r1sml.jpg
122 28/Mar/05 20:28/rabbit-center/hayward_rescue/hayward_graphics/Michael_dr-harvey_1.jpg
122 0.01%28/Mar/05 20:29/rabbit-center/hayward_rescue/hayward_graphics/its-a-hit.JPG
122 28/Mar/05 19:55/chapters/oregon/images/bunnymascot6.jpg
122 28/Mar/05 23:57/journal/4-4/paul-bloom.html
122 29/Mar/05 07:42/graphics/babies/
12 27/Mar/05 21:56  /graphics/babies/?N=D
122 0.03%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/cutting_board.JPG
121 28/Mar/05 20:28/rabbit-center/hayward_rescue/hayward_graphics/Kerry_S_Lewis.jpg
121 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/F&F_salt-pepper.JPG
121 28/Mar/05 20:28/rabbit-center/hayward_rescue/hayward_graphics/Olga_dr-harvey.jpg
121 0.01%28/Mar/05 20:29/rabbit-center/hayward_rescue/hayward_graphics/structure_toys.jpg
121 28/Mar/05 20:28/rabbit-center/hayward_rescue/hayward_graphics/Sombra_dr-harvey_hypno.jpg
121 28/Mar/05 23:26/faq/sections/shy.html
121 28/Mar/05 22:41/hrs-info/web.html
120 29/Mar/05 06:40/translations/portugese/baby-myths.html
120 0.01%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/rain_gauge.JPG
120 0.01%28/Mar/05 20:29/rabbit-center/hayward_rescue/hayward_graphics/more_bunnies.JPG
120 29/Mar/05 02:31/journal/3-5/toxoplasmosis.html
120 0.01%28/Mar/05 20:29/rabbit-center/hayward_rescue/hayward_graphics/exploring.jpg
120 28/Mar/05 23:45/chapters/san-diego/aboutus/bunnyfest/bunnyfest_2004.html
119 28/Mar/05 16:33/graphics/fun/netbunnies/MVC-015S.JPG
118 29/Mar/05 00:49/journal/1/books.html
118 29/Mar/05 09:35/journal/3-12/graphics/fosterer-allergies.gif
118 0.01%29/Mar/05 09:18/help/toc-url.html
118 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/bunnyfest_2001_photos.html
118 28/Mar/05 23:03/hrs-info/survey.html
118 29/Mar/05 06:03/journal/4-7/pimpernell.html
118 28/Mar/05 16:34/graphics/fun/netbunnies/MVC-016S.JPG
117 29/Mar/05 07:42/spam_vaccine/mailto.gif
117 28/Mar/05 22:40/rabbit-center/retail/carry.html
117 28/Mar/05 18:42/graphics/fun/netbunnies/MVC-018F.JPG
117 28/Mar/05 22:16/journal/2-5/community-ed.html
117 28/Mar/05 18:32/rabbit-center/hayward_rescue/hayward_graphics/angel_thanks.JPG
117 29/Mar/05 06:14/journal/submissions.html
117 0.01%29/Mar/05 06:38/journal/3-7/graphics/rescue-group.gif
117 28/Mar/05 19:34/journal/3-7/graphics/necrotic-tissue.gif
117 29/Mar/05 08:03/journal/3-3/life-worthy.html
116 28/Mar/05 14:25/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Silver_bracelet.jpg
116 29/Mar/05 06:38/journal/3-7/graphics/rescue-pen.gif
116 29/Mar/05 06:38/journal/3-7/graphics/woman-w-bunny.gif
116 29/Mar/05 05:05/translations/japanese/spay-neuter-j.txt
116 29/Mar/05 09:04/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Rice_bowls.JPG
115 29/Mar/05 09:08/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Salad_quiche_set.JPG
115 0.02%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/big_grey_bunny.JPG
115 0.01%29/Mar/05 09:11/graphics/mine/zippy2.jpg
115 29/Mar/05 01:01/rabbit-center/retail/vids.html
115 0.02%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bedtime_story_bunny.JPG
114 28/Mar/05 23:58/journal/3-11/letters.html
114 29/Mar/05 07:25/hrs-info/how-donations-are-used.html
113 28/Mar/05 14:23/easter/next.html
113 0.01%28/Mar/05 18:32/rabbit-center/hayward_rescue/hayward_graphics/one_big_pen_1.JPG
113 28/Mar/05 19:34/journal/3-7/graphics/bunny-w-bandage.gif
113 0.01%29/Mar/05 03:18/rabbit-center/adoptables/graphics/thumb/
113 0.01%28/Mar/05 18:32/rabbit-center/hayward_rescue/hayward_graphics/one_big_pen_2.JPG
113 28/Mar/05 18:52/chapters/san-diego/behavior/quiz/q6answer_false.html
112 29/Mar/05 01:52/chapters/san-diego/products/graphics/Abbys_Rose_peach.JPG
112 29/Mar/05 01:52/chapters/san-diego/products/graphics/Caffeine_ladies-t_aqua.JPG
112 28/Mar/05 23:03/chapters/oregon/adoption.html
112 28/Mar/05 08:22/adopt-a-rabbit-month/poster.html
112 28/Mar/05 19:34/journal/3-7/graphics/recovered.gif
112 29/Mar/05 09:04/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Barfoot_Drawing.JPG
111 28/Mar/05 23:33/journal/3-2/geriatric.html
111 0.01%29/Mar/05 08:21/graphics/mine/zippy3.jpg
111 0.01%29/Mar/05 01:52/chapters/san-diego/products/graphics/Rabbit_house_babydoll_tshirt.jpg
111 28/Mar/05 22:34/journal/3-4/togetherness.html
111 29/Mar/05 03:18/chapters/san-diego/products/accessories.html
111 29/Mar/05 03:16/hrs-info/whats-new-archive98.html
111 29/Mar/05 07:57/hrs-info/whats-new-archive01.html
111 29/Mar/05 07:20/chapters/san-diego/behavior/quiz/q8answer_true.html
111 28/Mar/05 15:26/graphics/fun/netbunnies/The Secret
111 29/Mar/05 01:52/chapters/san-diego/products/graphics/Caffeine_beefy-t_purple.JPG
110 29/Mar/05 06:26/faqgerman/sections/medizinischefragen.html
110 29/Mar/05 03:16/chapters/oregon/sanctuary.html
110 29/Mar/05 01:52/chapters/san-diego/products/graphics/grey_clock_tshirt_small.gif
110 29/Mar/05 09:48/journal/4-7/subaru.html
110 0.01%28/Mar/05 18:32/rabbit-center/hayward_rescue/hayward_graphics/cleaning_pen.JPG
110 29/Mar/05 01:52/chapters/san-diego/products/graphics/Established_t_wht_ss.JPG
110 29/Mar/05 01:52/chapters/san-diego/products/graphics/Established_t_ls_green.JPG
109 29/Mar/05 01:52/chapters/san-diego/products/graphics/ladies-t_clock_ylw-blu_2.JPG
109 28/Mar/05 14:25/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Ricker_wine_goblet.jpg
108 29/Mar/05 08:32/rabbit-center/news_release/letter_writing.html
108 29/Mar/05 01:52/chapters/san-diego/products/graphics/mens-t_clock_ylw_blu.JPG
108 29/Mar/05 09:05/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Japanese_teapot.JPG
108 0.01%29/Mar/05 08:47/graphics/mine/fripouille.gif
107 28/Mar/05 22:53/hrs-info/awards.html
107 28/Mar/05 18:42/graphics/fun/netbunnies/Sugaree-Bigwig.JPG
107 28/Mar/05 17:47/fun/izzy-zowie/lisa-t.jpg
107 29/Mar/05 01:52/chapters/san-diego/products/graphics/Herman_jr-raglan_tee.jpg
107 29/Mar/05 04:41/rabbit-center/retail/tunnelS.gif
107 29/Mar/05 04:41/rabbit-center/retail/matS.jpg
107 29/Mar/05 09:07/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bochy_photo.JPG
107 29/Mar/05 01:10/fun/reader-photos2.html
107 29/Mar/05 01:52/chapters/san-diego/products/graphics/Herman_baseball_jersey.jpg
107 29/Mar/05 01:52/chapters/san-diego/products/graphics/Herman_ash_grey.jpg
106 27/Mar/05 21:58/graphics/mine/
10 27/Mar/05 21:56  /graphics/mine/?D=A
106 28/Mar/05 07:32/chapters/michigan/acb10.jpg
106 29/Mar/05 04:41/rabbit-center/retail/basketS.jpg
106 29/Mar/05 09:08/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Baby_outfit.JPG
105 28/Mar/05 22:16/hrs-info/whats-new-archive02.html
105 28/Mar/05 22:16/hrs-info/whats-new-archive96.html
105 28/Mar/05 22:43/chapters/oregon/vets.html
105 28/Mar/05 14:07/rabbit-center/updates/images/mm_spacer.gif
105 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/diane_wat_t-shirt.JPG
105 29/Mar/05 04:41/rabbit-center/retail/ringS.jpg
104 29/Mar/05 04:41/rabbit-center/retail/ballS.gif
104 28/Mar/05 19:36/graphics/fun/netbunnies/c1.JPG
104 29/Mar/05 09:04/journal/3-7/graphics/sleeping-in-desk.gif
104 29/Mar/05 01:45/chapters/san-diego/aboutus/bunny_cottage.html
104 29/Mar/05 09:05/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Chargers_Jersey.JPG
104 28/Mar/05 07:32/chapters/michigan/lilly6.jpg
104 28/Mar/05 07:32/chapters/michigan/corey8.jpg
103 29/Mar/05 06:36/journal/3-4/graphics/kids.gif
103 29/Mar/05 09:07/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Alabaster_bunny.JPG
103 29/Mar/05 04:41/rabbit-center/retail/store3L.jpg
103 0.01%29/Mar/05 09:04/journal/3-7/graphics/bunnys-w-toys.gif
103 28/Mar/05 07:32/chapters/michigan/milo6.jpg
103 28/Mar/05 07:32/chapters/michigan/cdez11.jpg
103 28/Mar/05 23:25/rabbit-center/hayward_rescue/hayward_rabbits_cruelty_report.html
102 29/Mar/05 09:06/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Two_flower_Pots.JPG
102 28/Mar/05 07:32/chapters/michigan/jason4.jpg
102 28/Mar/05 07:32/chapters/michigan/spot3.jpg
102 28/Mar/05 14:02/rabbit-center/adoption-contract.rtf
102 29/Mar/05 02:45/journal/3-11/radiologist.html
102 0.01%28/Mar/05 14:25/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Primitive Bunny & Box.JPG
102 28/Mar/05 07:32/chapters/michigan/luke10.jpg
102 29/Mar/05 05:16/links/zowie.html
102 0.01%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/hilltop_house_souvenirs.JPG
102 29/Mar/05 07:42/journal/3-3/soft-stool.html
102 29/Mar/05 04:19/chapters/san-diego/adoption/Adoption_Photos/Watson_adoption.jpg
101 29/Mar/05 07:38/journal/about.html
101 29/Mar/05 04:41/rabbit-center/retail/tentS.jpg
101 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/basket_candles.JPG
101 29/Mar/05 04:24/rabbit-center/adoptables/graphics/big/3bunnies041sml.jpg
101 29/Mar/05 09:04/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Easter_Bell.JPG
101 0.01%27/Mar/05 21:57/rabbit-center/adoptables/graphics/big/bounce27sml.jpg
100 28/Mar/05 21:30/chapters/san-diego/products/books.html
100 28/Mar/05 22:16/chapters/san-diego/aboutus/donations.html
100 28/Mar/05 13:16/chapters/oakland/
100 29/Mar/05 04:27/rabbit-center/adoptables/graphics/big/R683 Peter 41r1sml.jpg
100 29/Mar/05 04:20/journal/3-2/foot-problems.html
100 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/hay-rack.jpg
99 29/Mar/05 03:17/graphics/books/
11 27/Mar/05 21:57  /graphics/books/?N=A
10 27/Mar/05 13:17  /graphics/books/?N=D
99 28/Mar/05 22:56/chapters/oregon/newsletter.html
99 28/Mar/05 18:41/graphics/fun/netbunnies/Spencer-Bianca.JPG
99 29/Mar/05 09:51/chapters/san-diego/adoption/Easter/Easter_Downloads.html
98 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/tapestry_pillow.JPG
98 0.01%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/rustic_candle_holders.JPG
98 0.01%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/resin_plaque.JPG
98 0.01%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/two_pins.jpg
98 0.01%29/Mar/05 01:10/graphics/fun/netbunnies/sherlock.gif
98 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/rustic_ceramic_bunny.JPG
98 29/Mar/05 04:40/rabbit-center/retail/hngtoysL.jpg
98 29/Mar/05 09:03/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Rabbit_custard_cup.JPG
98 29/Mar/05 09:30/press-kit/easter-press-release.html
98 29/Mar/05 09:03/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Calico_bunny.JPG
97 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/grey_stuffed_bunny.JPG
97 29/Mar/05 07:42/chapters/san-diego/health/laser_surgery.html
97 29/Mar/05 09:09/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/White_rabbit_casserole.JPG
97 29/Mar/05 09:05/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Rosie_rabbit_Franklin-mint.JPG
97 28/Mar/05 23:58/journal/3-1/a-hare-about-the-house.html
97 28/Mar/05 12:44/rabbit-center/adoptables/graphics/big/yuna-r1395-16sml.jpg
96 29/Mar/05 02:07/journal/3-8/graphics/dexter.gif
96 29/Mar/05 09:07/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Blue_Lattice_flwrd_vase.JPG
96 29/Mar/05 02:07/journal/3-8/graphics/multi.gif
96 29/Mar/05 09:07/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bunny_Watercolor_DD.JPG
96 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/kids_writing_basket.JPG
96 28/Mar/05 22:43/hrs-info/whats-new-archive99.html
96 29/Mar/05 09:04/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Garden_Bunnies_Wall_Hanging.JPG
96 28/Mar/05 22:50/chapters/oregon/supplies.html
96 0.01%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/baby_jumper.JPG
96 29/Mar/05 07:34/opinion/cruelty-case.html
96 28/Mar/05 12:22/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Boyds_Bunny_Raffle-item.JPG
96 0.01%29/Mar/05 09:06/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bunny_Pitcher.JPG
96 29/Mar/05 05:19/rabbit-center/adoptables/graphics/big/poppy49sml.jpg
96 29/Mar/05 00:00/journal/3-1/cold-tempeatures.html
96 17/Mar/05 20:38/rabbit-center/adoptables/graphics/big/dana21sml.jpg
95 29/Mar/05 07:36/rabbit-center/retail/haybagsL.jpg
95 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/wood_door_hanger.JPG
95 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_bird_house.JPG
95 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/angel_bunny.JPG
95 29/Mar/05 08:13/chapters/san-diego/behavior/graphics/litterbox_after.jpg
95 29/Mar/05 09:42/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/ski_hat.jpg
95 29/Mar/05 09:08/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Rabbit_Pitcher_2.JPG
94 28/Mar/05 14:07/rabbit-center/updates/images/mama.jpg
94 0.01%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/space_rabbit_poster.JPG
94 28/Mar/05 15:28/graphics/fun/netbunnies/Twilight.gif
94 0.01%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_pin.JPG
94 28/Mar/05 14:07/rabbit-center/updates/images/princess.jpg
94 28/Mar/05 19:53/graphics/thumbnails/
11 28/Mar/05 19:53  /graphics/thumbnails/?S=A
11 27/Mar/05 21:55  /graphics/thumbnails/?M=A
10 27/Mar/05 21:56  /graphics/thumbnails/?D=A
10 27/Mar/05 13:17  /graphics/thumbnails/?N=D
94 0.05%28/Mar/05 14:07/rabbit-center/updates/images/big_daddy.png
93 0.01%29/Mar/05 02:15/hrs-info/volunteer-application.doc
93 29/Mar/05 07:30/chapters/san-francisco/adopted.html
93 28/Mar/05 12:37/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/HK_Fergie_2.jpg
93 0.01%27/Mar/05 21:41/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Abbys_rose_framed.JPG
93 0.01%28/Mar/05 17:03/graphics/mine/toby-izzy/toby-best.jpg
93 29/Mar/05 06:17/faqgerman/sections/stubenrein.html
93 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/alpaca_bunny.JPG
93 29/Mar/05 08:13/chapters/san-diego/behavior/graphics/litterbox_before.jpg
93 28/Mar/05 23:40/journal/3-7/program.html
93 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/white_bunny_cookie-jar.JPG
93 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/key_rack.jpg
93 28/Mar/05 14:07/rabbit-center/updates/images/jr.jpg
92 29/Mar/05 09:08/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bunny_cabbage_pitcher.JPG
92 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/2-bunny_creamers.JPG
92 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/year_of_rabbit.JPG
92 28/Mar/05 14:07/rabbit-center/updates/images/snowflake.jpg
92 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/votive_cndl_watering-can.JPG
92 0.01%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/garden_stakes.JPG
92 29/Mar/05 09:07/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Welcome_sign.JPG
92 29/Mar/05 09:08/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Napkin_rings.JPG
92 29/Mar/05 01:17/chapters/san-diego/aboutus/volunteer_ops.html
92 28/Mar/05 14:53/hrs-info/vet-conference/original-brochure.html
92 28/Mar/05 14:07/rabbit-center/updates/images/brownie.jpg
91 29/Mar/05 00:02/journal/3-8/disaster-preparedness.html
91 29/Mar/05 02:01/chapters/san-diego/terms_use.html
91 28/Mar/05 08:27/faq/sections/
10 27/Mar/05 14:20  /faq/sections/?D=A
91 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/carrot_trivet.JPG
91 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/photo_bracelet.JPG
91 28/Mar/05 14:07/rabbit-center/updates/images/becky.jpg
91 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/stuffed_bunny_carrier.JPG
90 29/Mar/05 04:31/hrs-info/spam_vaccine/spam_vaccine.js
90 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_pillow_sz-chart.JPG
90 28/Mar/05 12:37/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/HK_Harry_2.jpg
90 29/Mar/05 01:47/chapters/san-diego/aboutus/find_out_more.html
90 0.02%27/Mar/05 21:41/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/placemats_napking-rings.JPG
90 28/Mar/05 16:48/chapters/san-diego/products/graphics/Caps_navy_black.JPG
90 0.01%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Southwest_bunny_pins.jpg
90 29/Mar/05 04:59/translations/japanese/bibliography-j.txt
90 0.01%29/Mar/05 09:07/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Tall_Grape_Vase.JPG
90 28/Mar/05 16:48/chapters/san-diego/products/graphics/Caps_black_stone_navy.JPG
90 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/white_collectible_bunny.JPG
89 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/styupark_book.JPG
89 0.01%26/Mar/05 18:40/chapters/san-diego/adoption/Easter/Easter_Bunny_Cost_Comparison.pdf
89 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_blanket_peter.JPG
89 28/Mar/05 16:48/chapters/san-diego/products/graphics/Caps_khaki_stone_carrot.JPG
89 0.01%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/shiny_bunny_box.JPG
88 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/white_trinket_box.JPG
88 28/Mar/05 23:48/journal/3-11/burn-out.html
88 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/blanket_rattle-bunny.JPG
88 0.01%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/jodi_jensen_print.JPG
88 29/Mar/05 09:07/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Fitz_Floyd_rabbit.JPG
88 28/Mar/05 16:48/chapters/san-diego/products/graphics/tote_back.jpg
88 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_soap_dish.JPG
88 29/Mar/05 03:17/graphics/banners/
10 27/Mar/05 13:17  /graphics/banners/?M=A
10 29/Mar/05 03:17  /graphics/banners/?M=D
10 28/Mar/05 17:53  /graphics/banners/?N=D
88 29/Mar/05 09:06/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bedtime_Buddies_2.JPG
88 27/Mar/05 21:41/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/F&F_canape_platter.JPG
88 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/powder_room_bunny.JPG
88 29/Mar/05 09:04/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Two_Bisque_Bunnies_pair1.JPG
88 28/Mar/05 21:21/chapters/san-diego/aboutus/whoweare.html
88 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/furniture_feet.JPG
88 29/Mar/05 09:50/journal/4-5/doors-open.html
88 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/pink_nesting_rabbit.JPG
88 29/Mar/05 08:28/rabbit-center/header.gif
87 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/white_casserole.JPG
87 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/welcome_sign.JPG
87 29/Mar/05 09:45/chapters/san-francisco/stores.html
87 28/Mar/05 16:48/chapters/san-diego/products/graphics/Herman_grooming_apron.jpg
87 0.01%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/welcome_sign_2.JPG
87 28/Mar/05 15:48/chapters/oakland/nobadrab.html
87 27/Mar/05 22:34/rabbit-center/hayward_rescue/hayward_graphics/Albert_adopt.jpg
87 27/Mar/05 23:52/rabbit-center/hayward_rescue/hayward_graphics/baxter140tiny.jpg
87 0.01%29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/olympic_bobblehead.JPG
87 29/Mar/05 02:24/health/database.html
87 29/Mar/05 03:22/journal/3-11/
87 28/Mar/05 16:48/chapters/san-diego/products/graphics/tote-front.jpg
87 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/easter_tea_set.JPG
87 28/Mar/05 23:54/rabbit-center/adoptables/graphics/big/buzz25sml.jpg
87 29/Mar/05 09:08/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Flowered_Bunny_Trinket_Box.JPG
87 28/Mar/05 17:49/rabbit-center/hurt-rabbit.html
87 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/brn_bunny_puzzle.jpg
87 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/brn_bunny_photo_album.JPG
86 28/Mar/05 22:23/graphics/resources/
11 28/Mar/05 17:53  /graphics/resources/?M=A
10 28/Mar/05 17:53  /graphics/resources/?S=A
10 27/Mar/05 17:21  /graphics/resources/?D=A
86 0.01%29/Mar/05 09:09/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Football_2.JPG
86 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_plaque.JPG
86 28/Mar/05 23:35/journal/3-6/soft-stool-no-veggies.html
86 28/Mar/05 23:55/journal/2-11/willingly-useful.html
85 29/Mar/05 06:39/journal/2-7/permanence.html
85 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Rug_lotion.jpg
85 28/Mar/05 00:02/rabbit-center/hayward_rescue/hayward_graphics/seymore141tiny.jpg
85 27/Mar/05 22:40/rabbit-center/hayward_rescue/hayward_graphics/sambra072tiny.jpg
85 29/Mar/05 09:07/journal/1/bunnymoon.html
85 28/Mar/05 23:57/journal/2-7/power-plays.html
85 27/Mar/05 21:24/rabbit-center/hayward_rescue/hayward_graphics/angel062tiny.jpg
85 29/Mar/05 08:50/graphics/misc/
13 29/Mar/05 08:50  /graphics/misc/?N=A
12 27/Mar/05 21:56  /graphics/misc/?M=A
10 27/Mar/05 21:56  /graphics/misc/?S=A
10 28/Mar/05 01:09  /graphics/misc/?D=A
85 27/Mar/05 23:14/rabbit-center/hayward_rescue/hayward_graphics/nancy067tiny.jpg
85 27/Mar/05 21:28/rabbit-center/hayward_rescue/hayward_graphics/toby025tiny.jpg
85 29/Mar/05 09:06/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Picnic_Basket_carrier.JPG
85 27/Mar/05 22:16/rabbit-center/hayward_rescue/hayward_graphics/janet018tiny.jpg
85 28/Mar/05 00:49/rabbit-center/hayward_rescue/hayward_graphics/diana106tiny.jpg
85 29/Mar/05 03:17/care/vets-bay-area.html
85 27/Mar/05 21:46/rabbit-center/hayward_rescue/hayward_graphics/zorro011tiny.jpg
85 29/Mar/05 07:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/rustic_rabbit_w-heart.JPG
85 29/Mar/05 06:26/rabbit-center/lucky_rescue.html/robots.txt
85 27/Mar/05 23:02/rabbit-center/hayward_rescue/hayward_graphics/lance005tiny.jpg
84 27/Mar/05 22:04/rabbit-center/hayward_rescue/hayward_graphics/gigi084tiny.jpg
84 28/Mar/05 13:54/graphics/hrs-rabbits/
11 27/Mar/05 21:56  /graphics/hrs-rabbits/?S=A
10 27/Mar/05 21:56  /graphics/hrs-rabbits/?D=A
10 28/Mar/05 03:57  /graphics/hrs-rabbits/?M=A
84 27/Mar/05 21:59/graphics/mine/phil/
12 27/Mar/05 21:58  /graphics/mine/phil/?M=A
11 27/Mar/05 21:58  /graphics/mine/phil/?D=A
10 27/Mar/05 21:59  /graphics/mine/phil/?N=A
10 27/Mar/05 21:59  /graphics/mine/phil/?D=D
10 27/Mar/05 21:59  /graphics/mine/phil/?M=D
84 27/Mar/05 22:04/rabbit-center/hayward_rescue/hayward_graphics/francine057tiny.jpg
84 27/Mar/05 21:24/rabbit-center/hayward_rescue/hayward_graphics/bernie147tiny.jpg
84 29/Mar/05 01:23/translations/
10 26/Mar/05 16:26  /translations/?D=A
84 27/Mar/05 21:24/rabbit-center/hayward_rescue/hayward_graphics/johanna095tiny.jpg
84 28/Mar/05 21:03/graphics/homepage/backbar.gif
84 27/Mar/05 21:24/rabbit-center/hayward_rescue/hayward_graphics/benton111tiny.jpg
84 29/Mar/05 07:46/easter/oldindex.html
84 27/Mar/05 22:04/rabbit-center/hayward_rescue/hayward_graphics/sam108tiny.jpg
84 27/Mar/05 21:41/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/white_resin_bunnies.JPG
84 29/Mar/05 07:34/rabbit-center/retail/groominL.jpg
84 27/Mar/05 21:24/rabbit-center/hayward_rescue/hayward_graphics/frankie041tiny.jpg
84 27/Mar/05 21:24/rabbit-center/hayward_rescue/hayward_graphics/danny116tiny.jpg
84 27/Mar/05 22:11/rabbit-center/hayward_rescue/hayward_graphics/ubu031tiny.jpg
83 27/Mar/05 21:24/rabbit-center/hayward_rescue/hayward_graphics/michael046tiny.jpg
83 29/Mar/05 09:04/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Two_Bisque_Bunnies_pair2.JPG
83 27/Mar/05 21:24/rabbit-center/hayward_rescue/hayward_graphics/lewis122tiny.jpg
83 29/Mar/05 09:05/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Easter_candy_dishes-2.JPG
83 29/Mar/05 02:15/translations/japanese/haydiet-j.txt
83 28/Mar/05 08:36/chapters/san-diego/adoption/Easter/Easter_Poem_MBrandolino.html
83 27/Mar/05 21:24/rabbit-center/hayward_rescue/hayward_graphics/richard131tiny.jpg
83 0.01%29/Mar/05 09:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Stewart_1_Feb05.jpg
82 27/Mar/05 21:41/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Harmony_Kingomd_TJ.jpg
82 29/Mar/05 00:57/chapters/san-francisco/graphics/adoptables/overlo1.jpg
82 29/Mar/05 03:17/graphics/shelter/
12 27/Mar/05 21:57  /graphics/shelter/?N=A
11 27/Mar/05 21:55  /graphics/shelter/?D=A
10 27/Mar/05 04:09  /graphics/shelter/?N=D
82 29/Mar/05 08:52/chapters/socal/
82 29/Mar/05 09:08/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Books_puzzle.JPG
82 29/Mar/05 09:06/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Fairy_Bunny.JPG
82 29/Mar/05 09:06/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Green-flwrd_rabbit_vase_2.JPG
81 29/Mar/05 03:18/chapters/san-diego/products/jewelry.html
81 0.01%29/Mar/05 09:08/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/White_Bunny_CookieJar.JPG
81 29/Mar/05 02:15/hrs-info/chapter-contract.doc
81 0.01%28/Mar/05 10:09/rabbit-center/adoptables/graphics/big/fred r1412-09sml.jpg
81 29/Mar/05 09:05/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Peter_Rabbit_Frame-Book.JPG
81 29/Mar/05 07:25/translations/spanish/rescue-spanish.html
81 29/Mar/05 02:15/translations/japanese/bladder-stones-j.txt
81 28/Mar/05 16:18/journal/3-2/graphics/marsh.gif
81 29/Mar/05 07:18/chapters/san-diego/behavior/quiz/q1answer_true.html
80 28/Mar/05 21:55/graphics/adoption-ed-small-oval.jpg
80 26/Mar/05 20:07/care/vets-uncovered-regions.html
80 29/Mar/05 09:08/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Lenox_Cottontail_Plate.JPG
80 28/Mar/05 22:22/journal/2-6/graphics/pj.gif
80 29/Mar/05 05:13/journal/warren-wise/grooming-table.html
80 29/Mar/05 05:31/rabbit-center/hayward_rescue/hayward_graphics/girl_talk.jpg
80 29/Mar/05 06:33/faqgerman/sections/kinder.html
79 29/Mar/05 09:04/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Olympic_pins.JPG
79 28/Mar/05 12:37/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/suzie-sample.jpg
79 29/Mar/05 03:18/translations/japanese/digestibility-j.txt
79 29/Mar/05 02:08/chapters/san-diego/aboutus/bunnyfest/bfest_raffle.html
79 28/Mar/05 16:32/rabbit-center/hayward_rescue/hayward_graphics/Boys_relax.jpg
79 29/Mar/05 07:21/chapters/san-diego/behavior/quiz/q8answer_false.html
79 29/Mar/05 05:52/graphics/index/baby-zowie-profile-l.gif
78 29/Mar/05 00:03/translations/portugese/easter.html
78 28/Mar/05 23:51/journal/2-9/special-rabbit.html
77 29/Mar/05 09:04/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Baby_shoes_bib_frame.JPG
77 28/Mar/05 16:32/rabbit-center/hayward_rescue/hayward_graphics/girls_dine.jpg
77 28/Mar/05 21:55/journal/donations.html
77 29/Mar/05 04:13/graphics/links/
12 27/Mar/05 21:58  /graphics/links/?M=D
11 27/Mar/05 21:58  /graphics/links/?N=A
76 29/Mar/05 07:42/graphics/homepage/
11 27/Mar/05 21:58  /graphics/homepage/?M=D
10 27/Mar/05 17:58  /graphics/homepage/?D=A
10 27/Mar/05 21:56  /graphics/homepage/?M=A
76 29/Mar/05 07:07/faqgerman/sections/gefahren.html
76 28/Mar/05 21:30/chapters/san-diego/products/graphics/classic.gif
76 28/Mar/05 17:53/graphics/thanks/
11 27/Mar/05 21:56  /graphics/thanks/?M=A
10 27/Mar/05 21:58  /graphics/thanks/?N=A
76 27/Mar/05 20:39/hrs-info/vet-conference/hrs-logo.gif
76 29/Mar/05 07:20/chapters/san-diego/behavior/quiz/q6answer_true.html
76 28/Mar/05 21:30/chapters/san-diego/products/graphics/groc_list.jpg
76 29/Mar/05 09:06/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/2-Bunny_Trinket_box.JPG
76 28/Mar/05 21:30/chapters/san-diego/products/graphics/mousepad_pic.jpg
76 28/Mar/05 23:55/journal/3-6/making-a-difference.html
76 29/Mar/05 09:06/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Spanish_Plate.JPG
76 28/Mar/05 23:09/chapters/san-diego/adoption/right_rabbit.html
76 29/Mar/05 05:53/journal/warren-wise/eulogies.html
76 29/Mar/05 09:42/journal/3-5/habitat-brochure.html
75 28/Mar/05 21:30/chapters/san-diego/products/graphics/rabbit_in_the_house_booklet_small.gif
75 28/Mar/05 16:12/graphics/fun/netbunnies/barley1.gif
75 28/Mar/05 21:30/chapters/san-diego/products/graphics/Decal-orange.JPG
75 29/Mar/05 04:27/rabbit-center/adoptables/graphics/big/R686 Tom Servo 16r1sml.jpg
75 29/Mar/05 09:04/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Silver_Pearl_Necklace.JPG
75 17/Mar/05 20:12/rabbit-center/adoptables/graphics/thumb/beavis r1401 05 tiny.jpg
75 28/Mar/05 21:30/chapters/san-diego/products/graphics/Stories_Rabbits_Tell.jpg
75 29/Mar/05 09:08/journal/3-11/ww.html
75 28/Mar/05 23:57/journal/3-10/writers-guidelines.html
74 28/Mar/05 15:13/rabbit-center/lucky/images/chronicle_logo.gif
74 29/Mar/05 09:06/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Lacquer_tray.JPG
74 28/Mar/05 21:30/chapters/san-diego/products/graphics/script.gif
74 29/Mar/05 09:07/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Ruffled_bowl.JPG
74 29/Mar/05 09:05/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/BunnyLove_Painting.JPG
74 29/Mar/05 09:08/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Dancing_choco_bunny.JPG
74 28/Mar/05 15:13/rabbit-center/lucky/images/chronicle_sections.gif
74 29/Mar/05 08:52/links/sections/Rabbits911.html
74 28/Mar/05 17:39/hrs-info/adopt-a-highway.html
74 27/Mar/05 02:35/chapters/michigan/specialneeds.html
74 28/Mar/05 13:59/easter/squiggle.gif
74 28/Mar/05 21:30/chapters/san-diego/products/graphics/Decal_blue.JPG
73 29/Mar/05 04:24/rabbit-center/adoptables/graphics/big/3bunnies41sml.jpg
73 29/Mar/05 09:04/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Diane_Wat_blouse.JPG
73 29/Mar/05 04:56/translations/japanese/incisors-j.txt
73 29/Mar/05 09:06/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Verdegris_Candle_Bunny.JPG
73 28/Mar/05 23:56/journal/3-3/rescuers-worst-nightmare.html
73 29/Mar/05 09:07/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Powder_Bobblehead.JPG
73 29/Mar/05 07:53/translations/japanese/aggression-j.txt
73 29/Mar/05 01:39/journal/3-9/graphics/lop-eating-hay.gif
73 29/Mar/05 09:09/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Large_White_Ceramic_Bunnies.JPG
72 29/Mar/05 07:42/chapters/oakland/bladder.html
72 27/Mar/05 21:53/chapters/san-diego/products/poster.html
72 0.01%29/Mar/05 09:08/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Thinking_Rabbit.JPG
72 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/abby.jpg
72 29/Mar/05 09:06/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Sock_Bunny.JPG
72 29/Mar/05 02:06/chapters/san-francisco/promo.html
72 29/Mar/05 09:05/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bunny_Candy_dish.JPG
72 29/Mar/05 09:03/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/HK_RolyPoly_Salt-Pepper.JPG
72 28/Mar/05 19:56/chapters/oakland/title.jpg
72 29/Mar/05 09:05/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Christmas_Bunny.JPG
72 28/Mar/05 21:00/rabbit-center/adoptables/graphics/big/r1130midnight46sml.jpg
72 29/Mar/05 09:03/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bronze_trinket_box.JPG
71 0.01%29/Mar/05 07:42/rabbit-center/adoptables/images/eileen_big.jpg
71 29/Mar/05 09:07/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Gund_Flower_Bunny_2.JPG
71 29/Mar/05 09:04/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Small_floral_basket.JPG
71 29/Mar/05 09:07/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/HK_Marquis_de_Blanc.JPG
71 28/Mar/05 12:37/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bunny_Blanket_Set.jpg
70 29/Mar/05 03:17/graphics/awards/
70 29/Mar/05 09:08/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Silver_Frames.JPG
70 29/Mar/05 00:05/translations/portugese/right-person.html
70 29/Mar/05 09:08/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/HK_PotBelly_Candles.JPG
70 29/Mar/05 09:05/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Giant_Bunny.JPG
70 29/Mar/05 02:15/translations/japanese/medical-j.txt
70 28/Mar/05 21:30/chapters/san-diego/products/graphics/house_rabbit_handbook_small.jpg
70 29/Mar/05 00:11/journal/warren-wise/saftey.html
70 27/Mar/05 06:06/chapters/san-diego/adoption/pixel.gif
70 29/Mar/05 09:07/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Stuffed_buddies.JPG
70 29/Mar/05 03:16/journal/2-5/volunteer-overview.html
70 29/Mar/05 09:06/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Blue_Fenton_Bunny.JPG
70 29/Mar/05 09:04/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Framed_Crosstitch_Bunny.JPG
69 28/Mar/05 23:53/journal/3-5/warehouse.html
69 28/Mar/05 23:33/journal/warren-wise/help-a-fosterer.html
69 28/Mar/05 23:59/journal/2-7/educators.html
69 29/Mar/05 02:15/translations/japanese/fiber-j.txt
69 28/Mar/05 23:59/journal/3-10/home-office.html
68 29/Mar/05 07:42/chapters/san-diego/health/graphics/Frankenbunny-1.JPG
68 29/Mar/05 09:11/graphics/mine/foo/5-under-table.jpg
68 29/Mar/05 06:34/caregerman/
68 27/Mar/05 21:57/graphics/index/
68 28/Mar/05 20:10/rabbit-center/retail/litter.jpg
67 29/Mar/05 01:01/care/holidays.html
67 28/Mar/05 19:12/graphics/fun/netbunnies/bunny.bmp
67 29/Mar/05 08:53/chapters/oakland/ana.jpg
55 29/Mar/05 08:53  /chapters/oakland/ana.jpg?
67 28/Mar/05 06:11/easter/hrs2004prnewswire.html
66 28/Mar/05 06:46/chapters/san-diego/aboutus/graphics/Rabbit_space_old_outside.jpg
66 29/Mar/05 08:59/links/sections/
10 29/Mar/05 02:02  /links/sections/?M=D
66 0.02%28/Mar/05 20:44/rabbit-center/adoptables/graphics/big/libby1.jpg
66 29/Mar/05 06:22/faqgerman/sections/ernaehrung.html
66 28/Mar/05 06:46/chapters/san-diego/aboutus/graphics/Rabbit_space_old_inside-1.jpg
66 28/Mar/05 06:46/chapters/san-diego/aboutus/graphics/Bunny_Cottage_1.jpg
66 28/Mar/05 23:47/journal/2-7/right-decision.html
66 28/Mar/05 06:46/chapters/san-diego/aboutus/graphics/Rabbit_space_old_inside-2.jpg
66 28/Mar/05 06:46/chapters/san-diego/aboutus/graphics/Rabbit_space_old_outside-2.jpg
66 28/Mar/05 23:56/journal/3-10/
66 28/Mar/05 06:46/chapters/san-diego/aboutus/graphics/Cottage_3.jpg
66 29/Mar/05 09:12/graphics/mine/foo/9-cds.jpg
66 28/Mar/05 06:46/chapters/san-diego/aboutus/graphics/Bunny_Cottage_2.jpg
66 28/Mar/05 06:46/chapters/san-diego/aboutus/graphics/Cottage_1.jpg
66 29/Mar/05 02:15/translations/japanese/cuniculi-up-j.txt
65 29/Mar/05 03:17/graphics/gallery/
65 28/Mar/05 23:07/journal/3-8/graphics/rabbit-for-sale.gif
65 29/Mar/05 07:27/journal/2-6/database.html
65 29/Mar/05 02:33/chapters/san-francisco/poetry.html
65 28/Mar/05 14:39/graphics/fun/netbunnies/cashew.gif
65 28/Mar/05 05:34/rabbit-center/adoptables/graphics/big/debbie r1411 09sml.jpg
65 29/Mar/05 00:11/journal/2-6/hands-on-therapy.html
64 28/Mar/05 20:10/rabbit-center/retail/food.jpg
64 29/Mar/05 02:15/translations/japanese/eye-problems-j.txt
64 28/Mar/05 23:57/journal/3-1/first-rescue.html
64 29/Mar/05 03:18/chapters/san-diego/products/collectibles.html
64 29/Mar/05 07:42/chapters/san-diego/health/graphics/Skye_sofa.jpg
64 29/Mar/05 05:30/journal/warren-wise/cage-door.html
64 29/Mar/05 01:22/chapters/san-diego/aboutus/volunteer_handout.html
64 28/Mar/05 23:52/translations/portugese/philosophy.html
63 26/Mar/05 12:35/chapters/san-diego/adoption/Easter/ShelterPoster_SD-info_lowres.jpg
63 29/Mar/05 09:07/journal/3-10/graphics/deeb.gif
63 29/Mar/05 04:40/rabbit-center/retail/haychowS.jpg
63 27/Mar/05 23:04/rabbit-center/adoptables/graphics/big/peaches26sml.jpg
63 29/Mar/05 09:07/journal/3-10/graphics/williford.gif
63 29/Mar/05 09:07/journal/3-10/graphics/conference2.gif
63 29/Mar/05 08:46/rabbit-center/retail/playboxL.jpg
63 29/Mar/05 04:17/translations/japanese/age-related-behavior-j.txt
63 29/Mar/05 09:07/journal/3-10/graphics/jenkins.gif
63 29/Mar/05 09:07/journal/3-10/graphics/harkness.gif
63 28/Mar/05 23:55/journal/warren-wise/photos.html
63 29/Mar/05 09:07/journal/3-10/graphics/conference1.gif
63 29/Mar/05 05:06/translations/japanese/emergencies-j.txt
63 29/Mar/05 02:56/chapters/san-diego/health/hotline.html
62 28/Mar/05 23:57/journal/warren-wise/priorities.html
62 26/Mar/05 12:35/chapters/san-diego/adoption/graphics/Message.gif
62 28/Mar/05 16:33/chapters/san-diego/aboutus/bunnyfest/bfest_toydonation.html
62 28/Mar/05 13:42/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Anne_Geddes_doll.jpg
62 26/Mar/05 12:35/chapters/san-diego/adoption/graphics/Poem.gif
62 29/Mar/05 06:29/faqgerman/sections/spielzeug.html
62 29/Mar/05 09:56/chapters/san-diego/adoption/available.html
62 28/Mar/05 23:52/journal/warren-wise/hot-weather.html
62 26/Mar/05 12:35/chapters/san-diego/adoption/Easter/2005_Easter_Flyer_lowres.gif
61 28/Mar/05 22:32/graphics/fun/netbunnies/winzip81.exe
61 29/Mar/05 02:15/translations/japanese/chew-stick-j.txt
61 29/Mar/05 09:07/journal/3-10/graphics/rosenthal.gif
61 28/Mar/05 23:57/journal/3-3/lead.html
61 28/Mar/05 14:53/hrs-info/publicity/wp-apr-97.html
61 29/Mar/05 08:40/hrs-info/whats-new-archive04.html
61 29/Mar/05 03:17/journal/vol2-by-subject-index.html
61 29/Mar/05 04:24/rabbit-center/adoptables/graphics/big/Brendon05sml.jpg
61 29/Mar/05 02:35/journal/3-8/graphics/litterbox-trained.gif
61 29/Mar/05 05:44/care/reproduction.html
60 29/Mar/05 02:15/translations/japanese/disabled-j.txt
60 29/Mar/05 03:11/journal/3-10/graphics/ears.gif
60 27/Mar/05 21:30/rabbit-center/adoptables/graphics/big/r1208dakota17sml.jpg
60 28/Mar/05 14:48/graphics/fun/netbunnies/h1.JPG
60 29/Mar/05 06:48/care/recipies.html
60 28/Mar/05 18:39/care/emergency-planning.html
59 29/Mar/05 04:24/rabbit-center/adoptables/graphics/big/Brown38sml.jpg
59 28/Mar/05 13:30/graphics/store/
59 29/Mar/05 08:10/chapters/oakland/hurtshop.html
59 28/Mar/05 20:13/chapters/san-diego/diet/guide.html
59 28/Mar/05 15:32/chapters/san-diego/behavior/microchip.html
59 29/Mar/05 02:15/hrs-info/cm-application.doc
59 27/Mar/05 23:12/opinion/july-adopt-a-rabbit.html
59 27/Mar/05 21:21/rabbit-center/adoptables/graphics/big/annie05sml.jpg
59 28/Mar/05 13:42/chapters/san-diego/aboutus/bunnyfest/auction_photos.html
59 29/Mar/05 02:15/translations/japanese/cuniculi-j.txt
59 28/Mar/05 16:48/chapters/san-diego/products/graphics/Prayer_box_closeup.jpg
58 29/Mar/05 07:06/faqgerman/sections/tierarzt.html
58 29/Mar/05 09:07/faqgerman/sections/unterbringung.html
58 28/Mar/05 23:06/chapters/san-diego/adoption/Adoption_Photos/Ava_adoption_2Nov03.JPG
58 28/Mar/05 15:26/rabbit-center/adoptables/graphics/big/gretchen15sml.jpg
58 29/Mar/05 01:16/behaviourgerman/koerpersprache.html
58 28/Mar/05 21:53/chapters/oakland/bunwalk.html
58 29/Mar/05 09:02/opinion/subaru.html
57 28/Mar/05 20:10/rabbit-center/retail/carrierS.jpg
57 28/Mar/05 23:33/journal/3-3/privacy.html
57 29/Mar/05 02:15/translations/japanese/diet-j.txt
57 29/Mar/05 04:25/rabbit-center/adoptables/graphics/big/Copper 58sml.jpg
57 28/Mar/05 16:16/graphics/fun/netbunnies/bj.tif
57 0.01%29/Mar/05 00:18/hrs-info/educator-application.doc
57 28/Mar/05 20:10/rabbit-center/retail/blkbagS.jpg
57 29/Mar/05 04:24/rabbit-center/adoptables/graphics/big/Cocoa13sml.jpg
57 27/Mar/05 21:04/rabbit-center/adoptables/graphics/big/satin-r1308-01sml.jpg
57 27/Mar/05 10:37/resources/
57 29/Mar/05 08:52/chapters/socal/care.gif
57 28/Mar/05 06:58/graphics/hrs-rabbits/living-with/
56 28/Mar/05 00:51/graphics/mine/foo/gifs/
56 28/Mar/05 10:46/opinion/newsday-reprint.html
56 29/Mar/05 08:52/chapters/socal/leap2.gif
56 29/Mar/05 01:01/rabbit-center/retail/1st-bunV.jpg
56 29/Mar/05 07:04/rabbit-center/adoptables/images/zela31sml_000.jpg
56 29/Mar/05 08:52/chapters/socal/bun.gif
56 28/Mar/05 23:52/translations/portugese/interpreting-behavoir.html
56 29/Mar/05 09:14/faqgerman/sections/draussen.html
56 29/Mar/05 08:52/chapters/socal/run2.gif
56 29/Mar/05 07:42/chapters/san-diego/diet/5325.pdf
56 28/Mar/05 12:49/graphics/breeds/pappy-mini-rex-oc.jpg
56 0.01%27/Mar/05 19:58/graphics/adopt-a-highway.jpg
56 28/Mar/05 09:22/rabbit-center/local_rescue/
56 29/Mar/05 09:46/journal/warren-wise/health-data.html
56 28/Mar/05 18:31/rabbit-center/adoptables/graphics/big/colby r1423 03sml.jpg
55 29/Mar/05 02:15/translations/japanese/pellet-info-j.txt
55 29/Mar/05 01:01/rabbit-center/retail/hr-book.jpg
55 29/Mar/05 07:42/translations/japanese/calcium-j.txt
55 29/Mar/05 09:11/graphics/mine/foo/7-by-couch.jpg
55 29/Mar/05 01:01/rabbit-center/retail/introV.jpg
55 29/Mar/05 00:13/help/hints.html
55 29/Mar/05 08:52/chapters/socal/carrot.gif
55 29/Mar/05 07:07/health/frontline.html
55 29/Mar/05 02:15/translations/japanese/orphan-j.txt
55 27/Mar/05 23:08/chapters/oregon/newsletter99_1.html
54 29/Mar/05 06:32/faqgerman/sections/aggression-de.html
54 28/Mar/05 00:34/store/
54 28/Mar/05 11:47/rabbit-center/adoptables/graphics/big/holly-sml.jpg
54 29/Mar/05 01:01/rabbit-center/retail/bokvidS.jpg
54 29/Mar/05 01:01/rabbit-center/retail/examV.jpg
54 27/Mar/05 19:57/chapters/michigan/alex01.gif
54 29/Mar/05 01:01/rabbit-center/retail/spaceCD.jpg
54 29/Mar/05 08:52/chapters/socal/hrs-square-easter.gif
54 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/blondi.jpeg
54 29/Mar/05 05:31/care/vhd-guidelines.html
54 29/Mar/05 08:26/translations/portugese/about.html
53 29/Mar/05 01:01/rabbit-center/retail/spayV.jpg
53 28/Mar/05 19:05/journal/3-2/graphics/mcvee.gif
53 26/Mar/05 19:18/icons/text.gif
53 27/Mar/05 20:05/chapters/michigan/daisy01.jpg
53 27/Mar/05 20:11/chapters/michigan/jeremy13.jpg
53 28/Mar/05 23:48/journal/3-2/writing-for-journal.html
53 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/bunnyfest_2002_photos.html
53 28/Mar/05 20:11/graphics/fun/netbunnies/lazy.gif
53 29/Mar/05 07:42/translations/japanese/pellets-j.txt
52 27/Mar/05 05:46/chapters/oakland/aboutus.html
52 28/Mar/05 12:35/hrs-info/vet-conference/CAROLYNN.gif
52 28/Mar/05 15:41/graphics/thanks/ben.gif
52 29/Mar/05 02:15/translations/japanese/drollery-j.txt
52 28/Mar/05 10:00/care/vets-monterey.txt
52 0.01%29/Mar/05 09:33/rabbit-center/adoptables/images/maxie_big.gif
52 29/Mar/05 07:30/chapters/san-francisco/graphics/adoptables/feb02/emma.jpg
52 29/Mar/05 01:01/rabbit-center/retail/exerVCD.jpg
52 28/Mar/05 12:35/hrs-info/vet-conference/hornblower2.gif
51 28/Mar/05 12:35/hrs-info/vet-conference/hornblower3.gif
51 29/Mar/05 01:01/rabbit-center/retail/routeCD.jpg
51 29/Mar/05 07:42/translations/japanese/tusks-j.txt
51 28/Mar/05 11:53/journal/2-7/graphics/hollyk.gif
50 28/Mar/05 21:52/graphics/fun/netbunnies/harley.jpeg
50 28/Mar/05 18:31/rabbit-center/adoptables/graphics/big/bungee08sml.jpg
50 28/Mar/05 12:22/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/White_Bunny_Bowl_Raffle-Item.JPG
50 28/Mar/05 23:32/journal/2-7/submissions.html
50 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/nim.jpg
50 28/Mar/05 15:41/graphics/thanks/vic.gif
50 28/Mar/05 15:53/rabbit-center/adoptables/images/lily_big.jpg
50 29/Mar/05 05:27/chapters/oregon/images/endquote.gif
50 29/Mar/05 05:27/chapters/oregon/images/startquote.gif
50 29/Mar/05 09:04/care/gi-stasis.html
50 28/Mar/05 15:41/graphics/thanks/gab.gif
50 28/Mar/05 15:13/graphics/fun/netbunnies/ukkurt.JPG
50 24/Mar/05 11:36/links/admin/add.php
49 28/Mar/05 17:46/rabbit-center/graphics/hurt-rabbit/1.jpg
49 27/Mar/05 19:57/cgi-bin/search
27 27/Mar/05 19:57  /cgi-bin/search?keywords=easter
49 27/Mar/05 22:59/chapters/oakland/bctheydi.html
49 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/quentin.jpg
49 27/Mar/05 22:29/rabbit-center/rabbit_ofthe_month/feb_05.html
49 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/toby.jpg
49 29/Mar/05 07:30/chapters/san-francisco/adopt.jpeg
49 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/stuart.jpg
49 29/Mar/05 03:52/chapters/oakland/articles.html
49 27/Mar/05 21:52/journalgerman/2-12/fliegenmaden.html
49 27/Mar/05 19:36/easter/press-release.html
48 28/Mar/05 09:08/chapters/oregon/images/sanctuary_b.jpg
48 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/molly.jpg
48 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/gillian.jpg
48 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Info_Premium_Booths_small.JPG
48 27/Mar/05 22:29/rabbit-center/rabbit_ofthe_month/images/bunnyL.gif
48 28/Mar/05 09:08/chapters/oregon/images/sanctuary_c.jpg
48 28/Mar/05 14:01/chapters/san-diego/adoption/statistic.html
48 28/Mar/05 09:08/chapters/oregon/images/sanctuary_a.jpg
48 27/Mar/05 22:29/rabbit-center/rabbit_ofthe_month/images/bunnyR.gif
48 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/domirudy.jpg
48 29/Mar/05 08:36/rabbit-center/adoptables/graphics/big/Pixie 35sml.jpg
48 28/Mar/05 17:46/rabbit-center/graphics/hurt-rabbit/3.jpg
47 0.01%29/Mar/05 00:28/hrs-info/fosterer-application.doc
47 28/Mar/05 16:05/chapters/san-diego/aboutus/hay_elf.html
47 28/Mar/05 19:28/journal/3-1/graphics/hare.gif
47 27/Mar/05 19:23/graphics/breeds/summer-dutch-dc.jpg
47 29/Mar/05 05:33/rabbit-center/retail/lrgcageL.jpg
47 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/CRM_Booth_small.JPG
47 29/Mar/05 02:15/translations/japanese/trouble-with-ears-j.txt
47 28/Mar/05 14:38/graphics/fun/netbunnies/bunnyday.JPG
47 27/Mar/05 20:30/chapters/san-diego/products/graphics/rabbit-poster.JPG
47 29/Mar/05 06:32/faqgerman/sections/zusammenfuehrung.html
47 27/Mar/05 08:49/graphics/easter/rabbit.gif
46 28/Mar/05 11:15/rabbit-center/hayward_rescue/hayward_graphics/da-2.jpg
46 29/Mar/05 03:17/adoptiongerman/hrszucht.html
46 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/tabit.jpeg
46 28/Mar/05 07:22/health/vhd-ny-dec2001.html
46 28/Mar/05 17:46/rabbit-center/graphics/hurt-rabbit/2.jpg
46 28/Mar/05 15:27/journal/3-8/graphics/couple-circle.gif
46 29/Mar/05 06:34/behaviourgerman/
46 28/Mar/05 14:38/graphics/fun/netbunnies/bunnyinbowl.JPG
46 27/Mar/05 22:29/rabbit-center/rabbit_ofthe_month/images/gabriel.gif
46 28/Mar/05 07:21/health/vhd-utah-aug2001.html
46 28/Mar/05 11:15/rabbit-center/hayward_rescue/hayward_graphics/da-1.jpg
46 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/heidi.jpg
45 29/Mar/05 09:57/.
45 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/alaska1.gif
45 28/Mar/05 06:13/events/nj-conf-10-00.html
45 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/coleen-meleny-5.gif
45 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/cory.jpg
45 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/benjamin-1.gif
45 28/Mar/05 15:10/graphics/fun/netbunnies/stonebunny.JPG
45 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/maggie-1.gif
45 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/whitney-3.gif
45 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/thad.jpg
45 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/marcus-1.gif
45 29/Mar/05 02:15/translations/japanese/medical-leads-j.txt
45 0.01%29/Mar/05 05:59/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Exclusively_Yours_Basket.JPG
45 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/d-tort-2-i.gif
45 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/hugo-1.gif
45 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Chare_Massage_small.JPG
45 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/gilbert-3.gif
45 27/Mar/05 21:25/rabbit-center/hayward_rescue/hayward_rabbits_adopt-janet.html
45 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Bfest_Spirit_small.JPG
45 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/k-agouti-i.gif
45 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/pinky-perry-3.gif
45 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/dolly-1.gif
45 28/Mar/05 21:19/easter/yahooligansindex.html
44 29/Mar/05 03:17/caregerman/bibliografie.html
44 28/Mar/05 13:26/chapters/oregon/images/bunnymascot5.jpg
44 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/d-gray-2-i.gif
44 27/Mar/05 19:29/journal/4-4/
44 28/Mar/05 20:11/graphics/fun/netbunnies/jet.JPG
44 29/Mar/05 04:29/rabbit-center/adoptables/graphics/big/R706 Latte 28 sml.jpg
44 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/panda.jpeg
44 0.01%25/Mar/05 08:23/chapters/san-diego/adoption/Easter/2005_Easter Flyer.pdf
44 29/Mar/05 02:15/translations/japanese/fear-into-play-j.txt
44 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/mvc-002f_small.jpg
44 29/Mar/05 09:59/chapters/san-francisco/images/with_sheryl.jpg
44 29/Mar/05 00:07/translations/portugese/special-rabbit.html
44 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/nico.jpeg
44 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/k-white-i.gif
44 27/Mar/05 22:05/rabbit-center/adoptables/graphics/big/r967natalia19sml.jpg
44 29/Mar/05 06:31/care/tips00.html
44 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/darby.jpeg
44 28/Mar/05 12:05/rabbit-center/samosa-update.html
44 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/d-black-lop-i.gif
44 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/jeremiah.gif
44 29/Mar/05 07:30/chapters/san-francisco/graphics/adopted/cody-3.gif
43 0.01%29/Mar/05 06:01/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Raffle_basket.JPG
43 28/Mar/05 14:39/graphics/fun/netbunnies/cadbury1.tif
43 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Cottontail_Cafe_small.jpg
43 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Garden_Art_small.JPG
43 29/Mar/05 06:31/faqgerman/sections/nagen.html
43 28/Mar/05 14:47/graphics/fun/netbunnies/fuzzball1.gif
43 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Exoticare_small.JPG
42 28/Mar/05 12:11/journal/3-4/
42 29/Mar/05 04:25/rabbit-center/adoptables/graphics/big/Lucile36sml.jpg
42 27/Mar/05 22:42/rabbit-center/adoptables/images/tulip_big.jpg
42 29/Mar/05 09:33/volunteers/
42 28/Mar/05 14:37/graphics/fun/netbunnies/bunny1.tif
42 29/Mar/05 06:32/faqgerman/sections/training-de.html
42 29/Mar/05 03:17/links/letter.html
42 28/Mar/05 14:34/journal/3-8/ww.html
42 29/Mar/05 06:32/faqgerman/sections/mehrere.html
42 29/Mar/05 02:32/graphics/fun/netbunnies/rabbit2.tif
42 29/Mar/05 06:00/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/RC_Hare_Winter.JPG
42 28/Mar/05 14:30/chapters/oregon/images/bunnymascot4.jpg
42 29/Mar/05 07:05/adoptiongerman/
41 27/Mar/05 22:52/journal/3-3/
41 28/Mar/05 15:20/chapters/san-diego/aboutus/philosophy.html
41 28/Mar/05 14:13/rabbit-center/adoptables/graphics/big/cleo61sml.jpg
41 29/Mar/05 09:59/chapters/san-francisco/images/with_joel.jpg
41 28/Mar/05 12:28/graphics/thanks/emmajane75.gif
41 29/Mar/05 04:24/rabbit-center/adoptables/graphics/big/Cocoa16sml.jpg
40 28/Mar/05 11:03/chapters/san-diego/behavior/quiz/q7answer_false.html
40 28/Mar/05 14:43/graphics/fun/netbunnies/doe.gif
40 28/Mar/05 23:53/rabbit-center/adoptables/graphics/big/tia r1409 06sml.jpg
40 17/Mar/05 16:11/rabbit-center/adoptables/graphics/big/inga18sml.jpg
40 29/Mar/05 04:25/rabbit-center/adoptables/graphics/big/Eva31sml.jpg
40 29/Mar/05 03:17/journal/4-5/seeking-shelters.html
40 28/Mar/05 14:47/graphics/fun/netbunnies/gidget.bmp
40 27/Mar/05 08:42/rabbit-center/adoptables/graphics/
40 29/Mar/05 09:43/chapters/oakland/adoption.html
40 29/Mar/05 07:30/rabbit-center/graphics/icon_servicespage.gif
40 26/Mar/05 14:13/chapters/san-diego/adoption/Easter/rabbits_at_easter.html
40 29/Mar/05 09:47/chapters/oakland/hall.html
39 29/Mar/05 04:29/rabbit-center/adoptables/graphics/big/addy5sml.jpg
39 28/Mar/05 15:09/graphics/fun/netbunnies/spencer-profile.JPG
39 28/Mar/05 05:47/care/tips.html
39 27/Mar/05 19:13/faqgerman/sections/
39 28/Mar/05 22:19/graphics/mine/zowie6-crop.jpg
39 26/Mar/05 18:44/links/sections/rabbits.php
39 28/Mar/05 20:37/rabbit-center/adoptables/graphics/big/bubba61sml.jpg
39 29/Mar/05 04:25/rabbit-center/adoptables/graphics/big/EDGAR.GIF
39 28/Mar/05 20:59/rabbit-center/lucky_media.html
39 28/Mar/05 16:33/chapters/san-diego/aboutus/bunnyfest/bfest_photos/Rugby_Toy_2.JPG
39 29/Mar/05 06:29/faqgerman/sections/medizinverabreichen.html
39 27/Mar/05 21:53/chapters/san-diego/aboutus/volunteer_materials.html
39 29/Mar/05 02:42/chapters/san-diego/aboutus/wish_list.html
39 28/Mar/05 14:48/graphics/fun/netbunnies/harvey2.JPG
39 29/Mar/05 02:15/translations/japanese/tools-of-the-trade-j.txt
39 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/shoppers_small.jpg
39 28/Mar/05 16:49/graphics/calendars/0763149349.jpg
38 27/Mar/05 17:22/chapters/san-diego/behavior/quiz/q10answer_true.html
38 27/Mar/05 21:51/easter/flyer/flyers.html
38 28/Mar/05 07:21/caregerman/klokiste.html
38 27/Mar/05 22:19/chapters/oregon/newsletter99_6.html
38 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Kids_Corner_1_small.JPG
38 29/Mar/05 09:10/caregerman/leben-mit-einem.html
38 28/Mar/05 05:41/chapters/san-diego/aboutus/bunnyfest/bfest_auction_2004.html
38 28/Mar/05 15:41/easter/thanks99.html
38 28/Mar/05 22:23/adoptiongerman/hrsueberbev.html
38 29/Mar/05 04:27/rabbit-center/adoptables/graphics/big/R685 Petey 29r1sml.jpg
38 27/Mar/05 07:36/rabbit-center/hayward_rescue/hayward_rabbits_adopt-benton.html
38 28/Mar/05 14:52/hrs-info/yesterdays-news.html
38 29/Mar/05 07:33/chapters/san-diego/join_online_nowoff.gif
38 28/Mar/05 04:24/journal/3-3/graphics/
38 27/Mar/05 21:25/rabbit-center/hayward_rescue/hayward_rabbits_adopt-lance.html
38 28/Mar/05 19:57/chapters/oregon/newsletter99_4.html
38 28/Mar/05 14:53/hrs-info/link.html
37 27/Mar/05 21:25/rabbit-center/hayward_rescue/hayward_rabbits_adopt-nancy.html
37 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Jodi_Jensen_Booth_small.JPG
37 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Premium_Booth_small.JPG
37 28/Mar/05 14:48/graphics/fun/netbunnies/hc1.JPG
37 29/Mar/05 09:33/volunteers/graphics/header-internal.gif
37 28/Mar/05 08:47/chapters/san-diego/adoption/Easter/SanDiegoContact_ChildsToy_flyer.pdf
36 27/Mar/05 02:22/chapters/san-diego/aboutus/online.html
36 28/Mar/05 14:52/hrs-info/petco_update.html
36 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Info_Booth_small.JPG
36 27/Mar/05 23:44/easter/thanks98.html
36 29/Mar/05 04:52/hrs-info/aug00survey-results.html
36 29/Mar/05 04:26/rabbit-center/adoptables/graphics/big/R603Elizabeth35sml.jpg
36 28/Mar/05 13:30/rabbit-center/hayward_rescue/hayward_rabbits_adopt-baxter.html
35 27/Mar/05 08:19/chapters/oakland/baby.html
35 29/Mar/05 04:26/rabbit-center/adoptables/graphics/big/Icon_
35 28/Mar/05 20:54/help/hrs-sherlock-plugin.hqx
35 28/Mar/05 21:07/chapters/san-diego/aboutus/bunnyfest/bunnyfest_2003.html
35 27/Mar/05 21:21/journal/warren-wise/
35 28/Mar/05 20:52/rabbit-center/adoptables/graphics/big/r1017mini81sml.jpg
35 27/Mar/05 20:06/journal/2-7/graphics/greta-circle-2.gif
35 28/Mar/05 21:02/rabbit-center/adoptables/graphics/big/r1179josephine62sml.jpg
35 29/Mar/05 07:33/chapters/san-diego/join_online_nowon.gif
35 29/Mar/05 09:15/faqgerman/sections/warmwetter.html
34 27/Mar/05 17:22/chapters/san-diego/behavior/quiz/q9answer_true.html
34 28/Mar/05 16:33/chapters/san-diego/aboutus/bunnyfest/bfest_photos/p1010078.jpg
34 28/Mar/05 16:33/chapters/san-diego/aboutus/bunnyfest/bfest_photos/p1010015.jpg
34 27/Mar/05 21:12/journal/2-7/graphics/basset-circle.gif
34 27/Mar/05 21:51/faqgerman/sections/klassenzimmer.html
34 27/Mar/05 21:37/rabbit-center/adoptables/graphics/big/juliette32sml.jpg
34 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Many_Hands_Booth_small.JPG
34 28/Mar/05 18:37/rabbit-center/adoptables/images/bugsy17sml.jpg
34 28/Mar/05 09:53/rabbit-center/local_rescue/special_needs/4buns.htm
34 28/Mar/05 11:23/rabbit-center/lucky_letter-writing.html
34 27/Mar/05 19:49/journal/2-7/graphics/sach-circle.gif
33 26/Mar/05 14:15/chapters/san-diego/adoption/Easter/Easter_Bunny_Poem.html
33 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Lisa_Goldie_Booth_small.JPG
33 29/Mar/05 04:19/chapters/san-diego/adoption/Adoption_Photos/Molly_Rory_adoption_26Mar05.jpg
33 28/Mar/05 14:53/hrs-info/credit-card.html
33 29/Mar/05 08:51/rabbit-center/hayward_rescue/hayward_rabbits_adopt-francine.html
33 28/Mar/05 14:52/hrs-info/tenth-leap/auction-thanks.html
33 28/Mar/05 10:10/rabbit-center/adoptables/images/jenny_big.jpg
33 29/Mar/05 07:42/chapters/san-diego/products/Order_Form.pdf
33 28/Mar/05 09:08/chapters/oregon/images/bunnymascot3.jpg
33 28/Mar/05 14:52/hrs-info/bookmark-hrs.html
33 29/Mar/05 07:42/journal/current-issue.html
33 0.01%27/Mar/05 21:38/rabbit-center/adoptables/images/mr_missy_big.gif
32 28/Mar/05 13:42/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Wall_plaque.JPG
32 29/Mar/05 07:42/hrs-info/tenth-leap/rsvp.html
32 29/Mar/05 06:34/faqgerman/sections/leckereien.html
32 27/Mar/05 21:53/chapters/san-diego/aboutus/Membership_Form.rtf
32 28/Mar/05 12:13/chapters/san-diego/behavior/quiz/q2answer_true.html
32 28/Mar/05 06:58/chapters/oregon/newsletter99_5.html
32 29/Mar/05 07:28/translations/japanese/litter-j.html
32 28/Mar/05 22:35/rabbit-center/hayward_rescue/hayward_rabbits_adopt-angel.html
32 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Kids_Corner_2_small.JPG
32 27/Mar/05 19:36/links/pasteurella-study.html
32 28/Mar/05 13:42/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/CeramicStellar.jpg
31 27/Mar/05 16:22/store/thanks.html
31 28/Mar/05 02:40/chapters/oakland/resource.html
31 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/pewter_small.jpg
31 29/Mar/05 04:19/chapters/san-diego/adoption/Adoption_Photos/HA_Gracie-Star_Mar05.jpg
31 27/Mar/05 02:33/rabbit-center/hayward_rescue/hayward_rabbits_adopt-johanna.html
31 29/Mar/05 04:19/chapters/san-diego/adoption/Adoption_Photos/Cookie_adoption_1_Mar05.jpg
31 29/Mar/05 04:27/rabbit-center/adoptables/graphics/big/R682 Pugsley 05 r1sml.jpg
31 28/Mar/05 14:52/hrs-info/tenth-leap/invite.html
31 29/Mar/05 02:15/chapters/san-diego/aboutus/bunnyfest/bfest_volunteer.html
31 27/Mar/05 02:34/rabbit-center/lucky_letter.html
31 27/Mar/05 13:56/chapters/oregon/newsletter99_2.html
31 28/Mar/05 16:33/chapters/san-diego/aboutus/bunnyfest/bfest_photos/p1010035.jpg
31 28/Mar/05 11:12/journal/3-7/graphics/rabbit-sketch.gif
31 28/Mar/05 16:33/chapters/san-diego/aboutus/bunnyfest/bfest_photos/p1010030.jpg
31 27/Mar/05 19:42/graphics/easter/anti-gabriella.jpg
31 29/Mar/05 03:36/rabbit-center/hayward_rescue/hayward_rabbits_adopt-danny.html
31 27/Mar/05 19:57/chapters/oakland/nietzche.html
31 28/Mar/05 14:46/graphics/fun/netbunnies/foo-zippy-by-comp.gif
31 0.01%29/Mar/05 00:48/chapters/san-diego/aboutus/HRS_Adoption_Flyer_tabs_Jan05.pdf
31 28/Mar/05 23:51/chapters/san-francisco/cup.gif
30 29/Mar/05 09:50/chapters/san-diego/adoption/take_home.html
30 28/Mar/05 16:33/chapters/san-diego/aboutus/bunnyfest/bfest_photos/HRS_Misha_and_friend.JPG
30 28/Mar/05 02:40/chapters/oregon/newsletter99_3.html
30 28/Mar/05 16:33/chapters/san-diego/aboutus/bunnyfest/bfest_photos/Peanut_toy_1.JPG
30 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/And_it_was_good_small.JPG
30 28/Mar/05 16:33/chapters/san-diego/aboutus/bunnyfest/North_Kylie_2_11Nov02.JPG
30 28/Mar/05 12:46/chapters/oakland/rorschach.html
30 28/Mar/05 18:23/chapters/oakland/kiri.html
30 28/Mar/05 16:33/chapters/san-diego/aboutus/bunnyfest/bfest_photos/p1010046.jpg
30 28/Mar/05 14:53/hrs-info/tenth-leap/individual-thanks.html
30 28/Mar/05 15:04/graphics/fun/netbunnies/rexspike.gif
30 28/Mar/05 23:51/chapters/san-francisco/graphics/house_rabbit_handbook.jpg
30 28/Mar/05 16:33/chapters/san-diego/adoption/graphics/Misha_stuffed_bunny.JPG
29 27/Mar/05 02:33/rabbit-center/hayward_rescue/hayward_rabbits_adopt-bernie.html
29 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Info_Booth2_small.JPG
29 28/Mar/05 14:53/hrs-info/tenth-leap/text.html
29 28/Mar/05 14:53/hrs-info/rhn.html
29 29/Mar/05 04:25/rabbit-center/adoptables/graphics/big/Luisa19sml.jpg
29 28/Mar/05 17:53/easter/yahooligans.html
29 28/Mar/05 09:27/chapters/oakland/josie.html
29 27/Mar/05 21:48/rabbit-center/job_opening.html
29 28/Mar/05 16:33/chapters/san-diego/aboutus/bunnyfest/bfest_photos/mats.jpg
29 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Kids_corner1.JPG
29 27/Mar/05 07:18/chapters/san-diego/feedback.html
28 27/Mar/05 03:10/chapters/oakland/elmo.html
28 28/Mar/05 13:42/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/FruitStand.jpg
28 28/Mar/05 04:25/chapters/san-diego/bunnyfest/bunnyfest_2001_photos.html
28 28/Mar/05 18:09/rabbit-center/lucky_media_release.html
28 28/Mar/05 18:31/rabbit-center/adoptables/graphics/big/julie03sml.jpg
28 28/Mar/05 02:50/chapters/michigan/ac.html
28 29/Mar/05 08:28/rabbit-center/job-description.html
28 27/Mar/05 21:25/rabbit-center/hayward_rescue/hayward_rabbits_adopt-gigi.html
28 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Jodi_Jensen_Booth2_small.JPG
28 27/Mar/05 19:42/graphics/2003arrmsugar2.jpg
28 27/Mar/05 21:54/translations/japanese/digestibility-j.html
28 27/Mar/05 22:17/rabbit-center/hayward_rescue/hayward_graphics/bun.gif
28 29/Mar/05 04:33/rabbit-center/adoptables/graphics/big/honey32sml.jpg
28 28/Mar/05 00:48/translations/japanese/medical-j.html
28 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/HRS_Premiums_booth3.JPG
28 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Kids_corner3.JPG
28 19/Mar/05 07:40/graphics/banners/behavior.gif
28 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Cottontail_Cafe2_small.JPG
28 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/CRM_booth.JPG
28 29/Mar/05 07:42/chapters/oakland/events.html
27 28/Mar/05 13:28/hrs-info/stats/images/barc4.png
27 27/Mar/05 17:22/chapters/san-diego/behavior/quiz/q5answer_true.html
27 27/Mar/05 09:05/chapters/san-diego/products/how-order.html
27 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Auction_browsing2_small.JPG
27 28/Mar/05 13:28/hrs-info/stats/images/barc16.png
27 28/Mar/05 13:42/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Arthur_Court_album.JPG
27 29/Mar/05 04:26/rabbit-center/adoptables/graphics/big/R680Jeffrey47sml.jpg
27 28/Mar/05 08:06/translations/japanese/incisors-j.html
27 28/Mar/05 17:53/easter/yahoo.html
27 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Lagomorph_lounge.JPG
27 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/HRS_Info_Booth2.JPG
27 25/Mar/05 10:46/rabbit-center/hayward_rabbits.html/favicon.ico
27 28/Mar/05 13:52/chapters/oakland/ana.html
27 28/Mar/05 16:33/chapters/san-diego/aboutus/bunnyfest/bfest_photos/CC1_250_333.jpg
27 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Cottontail_Cafe3_small.JPG
27 28/Mar/05 17:53/chapters/oakland/vetlist.html
27 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Vet_talk2.JPG
27 28/Mar/05 13:28/hrs-info/stats/images/barc32.png
27 27/Mar/05 02:33/rabbit-center/hayward_rescue/hayward_rabbits_adopt-frankie.html
27 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Cottontail_Cafe.JPG
26 29/Mar/05 07:42/rabbit-center/adoptables/graphics/big/index.htm
26 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Info_Booth3_small.jpg
26 29/Mar/05 07:45/cgi-bin/unban/unban.cgi
26 29/Mar/05 09:31/graphics/banners/full-banner-short.jpg
26 28/Mar/05 19:47/journal/3-8/graphics/disaster.gif
26 27/Mar/05 22:24/translations/japanese/orphan-j.html
26 28/Mar/05 19:47/journal/3-8/graphics/disaster-three-in-pen.gif
26 28/Mar/05 11:33/rabbit-center/lucky_rescue.html/favicon.ico
26 29/Mar/05 04:29/rabbit-center/adoptables/graphics/big/R704 Moca 17 sml.jpg
26 28/Mar/05 06:03/chapters/oakland/maybel.html
26 29/Mar/05 09:36/chapters/cu/
26 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Bfest_Massage2.JPG
26 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Auction_browsing_small.JPG
26 29/Mar/05 02:52/links/missionfish.html
26 28/Mar/05 13:28/hrs-info/stats/images/barc1.png
26 24/Mar/05 19:39/chapters/san-diego/adoption/graphics/anti-gabriella-circle.jpg
25 29/Mar/05 01:08/chapters/san-diego/aboutus/Membership_Form.pdf
25 28/Mar/05 03:17/press-kit/background-info.html
25 27/Mar/05 04:52/chapters/san-diego/aboutus/poetry_contest.html
25 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Kids_corner2.JPG
25 26/Mar/05 11:05/chapters/san-diego/adoption/graphics/HRS_Charlotte_garden_Mar02.JPG
25 27/Mar/05 21:39/chapters/oakland/behr.html
25 28/Mar/05 14:58/rabbit-center/adoptables/graphics/big/santatype tiny.jpg
25 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Rabbit_rescue_booth.JPG
25 27/Mar/05 20:37/journal/3-7/3-7-toc.html
25 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/kw_cages_small.jpg
25 27/Mar/05 22:18/chapters/san-diego/adoption/Adoption_Photos/Butterscotch_adoption_Apr04.jpg
25 29/Mar/05 05:19/rabbit-center/adoptables/graphics/big/r1168marshmallow21sml.jpg
25 28/Mar/05 14:31/chapters/oakland/ceci.html
25 27/Mar/05 19:58/graphics/10.gif
25 27/Mar/05 21:53/translations/japanese/age-related-behavior-j.html
25 28/Mar/05 13:28/styles/stats.css
24 27/Mar/05 20:09/chapters/oakland/tshirt.gif
24 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Jensen_speaks_small.JPG
24 27/Mar/05 20:37/rabbit-center/adoptables/graphics/big/grabriel13sml.jpg
24 27/Mar/05 19:42/chapters/oakland/poster.jpg
24 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/group-lecture.jpg
24 27/Mar/05 19:49/chapters/oakland/aboutush.gif
24 28/Mar/05 13:28/hrs-info/stats/images/barc2.png
24 28/Mar/05 20:52/rabbit-center/adoptables/graphics/big/r1009greta08sml.jpg
24 27/Mar/05 23:52/rabbit-center/retail/store2L.jpg
24 28/Mar/05 10:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Washing_My_Face_small.JPG
24 28/Mar/05 13:28/hrs-info/stats/images/barc8.png
24 27/Mar/05 11:37/chapters/oakland/ben.html
24 29/Mar/05 04:28/rabbit-center/adoptables/graphics/big/R698 Tule 45 sml.jpg
24 28/Mar/05 17:03/graphics/mine/toby-izzy/izzy-best.jpg
24 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Bfest_Crowd_3_small.JPG
24 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Bfest_Massage.JPG
24 28/Mar/05 15:53/care/vhd-letter.html
24 27/Mar/05 21:59/chapters/san-diego/adoption/shelter_adoption_event.html
24 28/Mar/05 20:48/rabbit-center/adoptables/graphics/big/melinda+melissa26sml.jpg
24 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Bfest_Crowd_2_small.JPG
23 27/Mar/05 02:19/chapters/oakland/maya.html
23 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Bfest_Crowd_7_small.JPG
23 28/Mar/05 20:51/journal/3-6/graphics/rabbitat.gif
23 27/Mar/05 23:02/rabbit-center/hayward_rescue/hayward_graphics/HRR_Janet_1_Jul04.jpg
23 29/Mar/05 04:28/rabbit-center/adoptables/graphics/big/R692 Gumdrop 54sml.jpg
23 27/Mar/05 22:05/rabbit-center/adoptables/graphics/big/valentino02sml.jpg
23 27/Mar/05 21:13/rabbit-center/adoptables/graphics/big/r1180anabelle40sml.jpg
23 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Bfest_Crowd_5_small.JPG
23 0.01%28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/HRS_Info_Booth.JPG
23 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Bunny_Babies_small.JPG
23 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/HRS_Premiums_booth.JPG
23 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Bfest_Crowd_4_small.JPG
23 28/Mar/05 14:53/hrs-info/adopt-a-rabbit-month.html
23 29/Mar/05 04:31/rabbit-center/adoptables/graphics/big/calypso65sml.jpg
23 27/Mar/05 09:16/chapters/oakland/winky.html
23 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Basket_of_toys.JPG
22 27/Mar/05 08:42/chapters/oakland/buttersc.html
22 27/Mar/05 21:31/chapters/oakland/cuddles.html
22 28/Mar/05 16:49/graphics/calendars/0763149349_l.jpg
22 27/Mar/05 02:33/rabbit-center/castro_valley_media_alert.html
22 29/Mar/05 09:50/journal/4-5/graphics/habitat.jpg
22 25/Mar/05 08:23/chapters/san-diego/adoption/Easter/Easter_Bunnies_Dont_Mix_SDHRS.html
22 27/Mar/05 21:54/translations/japanese/eye-problems-j.html
22 29/Mar/05 02:41/graphics/mine/toby-izzy/izzy-toby.jpg
22 27/Mar/05 21:53/translations/japanese/bladder-stones-j.html
22 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Bfest_Crowd_6_small.JPG
22 29/Mar/05 04:30/rabbit-center/adoptables/graphics/big/antigua57sml.jpg
22 28/Mar/05 10:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Spotted_BrnRex_small.JPG
22 29/Mar/05 04:32/rabbit-center/adoptables/graphics/big/callie42sml.jpg
22 29/Mar/05 02:07/chapters/san-diego/aboutus/bunnyfest/bfest_auction.html
22 24/Mar/05 23:35/rabbit-center/graphics/adoption-center-banner.gif
22 0.03%25/Mar/05 07:19/chapters/san-diego/adoption/Easter/ShelterPoster_SD-info.pdf
22 27/Mar/05 07:46/chapters/san-diego/aboutus/open_house_photos.html
22 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/2_Spotted_Buns_small.JPG
22 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/vet_talk.jpg
22 27/Mar/05 06:25/chapters/oakland/scooter.html
22 28/Mar/05 05:27/chapters/oakland/george.html
22 27/Mar/05 22:51/rabbit-center/retail/store1L.jpg
22 29/Mar/05 04:27/rabbit-center/adoptables/graphics/big/R688Sissy & R687Cody 02 sml.jpg
22 29/Mar/05 04:29/rabbit-center/adoptables/graphics/big/Spike25tiny.jpg
22 28/Mar/05 13:42/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Desert_Hare_Print.JPG
22 28/Mar/05 13:25/chapters/san-diego/behavior/quiz/q3answer_false.html
22 27/Mar/05 21:48/rabbit-center/lucky_adopted.html
21 28/Mar/05 04:23/translations/japanese/bibliography-j.html
21 28/Mar/05 13:28/hrs-info/stats/2005/03-Mar/chart-dir.png
21 29/Mar/05 07:42/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Girl_himmi_lop.jpg
21 28/Mar/05 13:28/hrs-info/stats/2005/03-Mar/chart-code.png
21 29/Mar/05 09:50/journal/4-5/graphics/bunz.jpg
21 29/Mar/05 04:30/rabbit-center/adoptables/graphics/big/anya.gif
21 29/Mar/05 07:56/translations/japanese/cuniculi-up-j.html
21 27/Mar/05 08:27/chapters/oakland/scotia.html
21 28/Mar/05 15:14/rabbit-center/graphics/Julie-k_Toby.jpg
21 29/Mar/05 05:19/rabbit-center/adoptables/graphics/big/sylvia28sml.jpg
21 29/Mar/05 04:59/translations/japanese/spay-neuter-j.html
21 28/Mar/05 22:23/easter/after-easter.txt
21 27/Mar/05 06:23/chapters/oakland/wookie.html
21 28/Mar/05 13:28/hrs-info/stats/2005/03-Mar/chart-req.png
21 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/CRM_booth_2.JPG
21 27/Mar/05 06:24/chapters/oakland/skylark.html
21 28/Mar/05 11:48/rabbit-center/adoptables/images/venus06sml.jpg
21 27/Mar/05 11:22/chapters/oakland/daisy.html
21 29/Mar/05 04:17/journal/3-4/graphics/
21 29/Mar/05 04:31/rabbit-center/adoptables/graphics/big/brisbee24sml.jpg
21 28/Mar/05 20:39/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/red-wagon.jpg
21 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Bunnies_under_table.JPG
21 28/Mar/05 23:38/translations/japanese/chew-stick-j.html
21 28/Mar/05 09:38/graphics/breeds/abby-mini-lop-sf.jpg
21 29/Mar/05 04:18/translations/japanese/tools-of-the-trade-j.html
21 27/Mar/05 18:40/chapters/oakland/macey.html
21 27/Mar/05 10:09/chapters/oakland/queen.html
21 27/Mar/05 21:54/translations/japanese/pellets-j.html
21 29/Mar/05 09:50/journal/4-5/graphics/door.jpg
21 28/Mar/05 14:54/chapters/oakland/hershey.html
21 27/Mar/05 08:53/chapters/oakland/rusty.html
21 27/Mar/05 02:19/chapters/oakland/siouxsie.html
21 28/Mar/05 13:28/hrs-info/stats/2005/03-Mar/chart-type.png
21 29/Mar/05 04:30/rabbit-center/adoptables/graphics/big/angus27tny.jpg
21 29/Mar/05 04:29/rabbit-center/adoptables/graphics/big/Velveeta08sml.jpg
21 28/Mar/05 01:23/graphics/Icon%0d
21 27/Mar/05 21:09/rabbit-center/adoptables/graphics/big/berklee03sml.jpg
21 27/Mar/05 21:54/translations/japanese/tusks-j.html
21 27/Mar/05 14:41/chapters/oakland/brandy.html
21 28/Mar/05 13:28/hrs-info/stats/2005/03-Mar/chart-dom.png
21 28/Mar/05 04:34/chapters/oakland/buffy.html
21 29/Mar/05 04:28/rabbit-center/adoptables/graphics/big/R693 Brere 43sml.jpg
21 28/Mar/05 10:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Bunny_Basket_small.JPG
20 29/Mar/05 04:29/rabbit-center/adoptables/graphics/big/Shana12sml.jpg
20 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/two_siamese_lops.JPG
20 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Abby_and_Friend_small.JPG
20 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/big_grin_small.jpg
20 28/Mar/05 13:28/hrs-info/stats/2005/03-Mar/chart-os.png
20 29/Mar/05 09:50/journal/4-5/graphics/snuggle-habitat.jpg
20 27/Mar/05 21:54/translations/japanese/head-tilt-j.html
20 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/fl00220_.jpg
20 28/Mar/05 10:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/BJ_Buster_2_small.JPG
20 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Red_wagon_2.JPG
20 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/hotot-in-arms.jpg
20 29/Mar/05 04:34/rabbit-center/adoptables/graphics/big/jasmine47sml.jpg
20 27/Mar/05 08:44/chapters/oakland/wallace.html
20 28/Mar/05 20:37/rabbit-center/adoptables/graphics/big/bumpers.gif
20 27/Mar/05 06:26/chapters/oakland/gracie.html
20 29/Mar/05 04:30/rabbit-center/adoptables/graphics/big/aruba45sml.jpg
20 29/Mar/05 04:31/rabbit-center/adoptables/graphics/big/bradley44sml.jpg
20 27/Mar/05 23:24/rabbit-center/adoptables/images/mazi_big.gif
20 28/Mar/05 19:51/rabbit-center/hayward_rabbits.html/robots.txt
20 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/2_Siamese_Lops_1_small.JPG
20 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/jenkins_small.jpg
20 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/himalyan.jpg
20 29/Mar/05 04:32/rabbit-center/adoptables/graphics/big/zoe62tiny.jpg
20 28/Mar/05 13:28/hrs-info/stats/2005/03-Mar/chart-size.png
20 29/Mar/05 03:52/chapters/oakland/articleh.gif
20 29/Mar/05 09:50/journal/4-5/graphics/map.jpg
20 28/Mar/05 10:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/YoungCouple_DutchBun_small.jpg
20 28/Mar/05 16:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/eng-spot-climbing-out.jpg
20 27/Mar/05 20:09/graphics/breeds/bea-french-lop-wash.jpg
20 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/auction_small.jpg
20 29/Mar/05 04:28/rabbit-center/adoptables/graphics/big/R699Sabrina47tiny.jpg
20 28/Mar/05 15:14/rabbit-center/hayward_rabbits_toby_tribute.html
20 28/Mar/05 13:28/hrs-info/stats/2005/03-Mar/chart-searchw.png
20 28/Mar/05 10:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Bfest_Crowd_8_small.JPG
10920 0.26%29/Mar/05 09:56[not listed: 1,874 files]