Web Server Statistics for House Rabbit Society

Program started at Thu-30-Jun-2005 03:10.
Analysed requests from Wed-01-Jun-2005 00:05 to Thu-30-Jun-2005 00:06 (29.00 days).

General Summary

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report contains overall statistics.

Figures in parentheses refer to the 7-day period ending 30-Jun-2005 03:10.

Successful requests: 6,961,939 (1,598,528)
Average successful requests per day: 240,061 (228,361)
Successful requests for pages: 1,407,742 (334,734)
Average successful requests for pages per day: 48,541 (47,819)
Failed requests: 250,250 (83,360)
Redirected requests: 13,161 (3,171)
Distinct files requested: 16,455 (7,533)
Distinct hosts served: 226,429 (58,691)
Corrupt logfile lines: 127
Data transferred: 66.39 gigabytes (15.41 gigabytes)
Average data transferred per day: 2.29 gigabytes (2.20 gigabytes)

Monthly Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the activity in each month.

Each unit (+) represents 40,000 requests for pages or part thereof.

monthreqspages 
Jun 200569619391407742++++++++++++++++++++++++++++++++++++

Busiest month: Jun 2005 (1,407,742 requests for pages).

Daily Summary

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the total activity for each day of the week, summed over all the weeks in the report.

Each unit (+) represents 6,000 requests for pages or part thereof.

dayreqspages 
Sun859578172424+++++++++++++++++++++++++++++
Mon1035022210733++++++++++++++++++++++++++++++++++++
Tue1036775220520+++++++++++++++++++++++++++++++++++++
Wed1271627256466+++++++++++++++++++++++++++++++++++++++++++
Thu1034220206393+++++++++++++++++++++++++++++++++++
Fri938062186798++++++++++++++++++++++++++++++++
Sat786655154408++++++++++++++++++++++++++

Hourly Summary

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the total activity for each hour of the day, summed over all the days in the report.

Each unit (+) represents 2,000 requests for pages or part thereof.

hourreqspages 
013050730544++++++++++++++++
112083727708++++++++++++++
213611531303++++++++++++++++
313689526565++++++++++++++
415427435144++++++++++++++++++
520190544119+++++++++++++++++++++++
625487051625++++++++++++++++++++++++++
728846061313+++++++++++++++++++++++++++++++
832101068769+++++++++++++++++++++++++++++++++++
935586376640+++++++++++++++++++++++++++++++++++++++
1037548980234+++++++++++++++++++++++++++++++++++++++++
1139219683810++++++++++++++++++++++++++++++++++++++++++
1240120382934++++++++++++++++++++++++++++++++++++++++++
1340924283405++++++++++++++++++++++++++++++++++++++++++
1436528475093++++++++++++++++++++++++++++++++++++++
1533480970232++++++++++++++++++++++++++++++++++++
1635221271365++++++++++++++++++++++++++++++++++++
1733993867655++++++++++++++++++++++++++++++++++
1839463469746+++++++++++++++++++++++++++++++++++
1945024477069+++++++++++++++++++++++++++++++++++++++
2038454763137++++++++++++++++++++++++++++++++
2128757252980+++++++++++++++++++++++++++
2220539341835+++++++++++++++++++++
2316844034517++++++++++++++++++

Domain Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the countries of the computers which requested files.

Listing domains, sorted by the amount of traffic.

reqs%bytesdomain
309122942.65%.net (Networks)
170712923.62%.com (Commercial)
96186113.65%[unresolved numerical addresses]
171422 2.89%.ca (Canada)
174700 2.44%.edu (USA Higher Education)
170455 2.42%.uk (United Kingdom)
111550 1.44%.au (Australia)
32727 1.41%.fr (France)
68773 0.91%.org (Non Profit Making Organisations)
58444 0.65%.us (United States)
25988 0.52%.nl (Netherlands)
20907 0.51%.it (Italy)
24966 0.47%.de (Germany)
16487 0.43%.be (Belgium)
17064 0.42%.fi (Finland)
27608 0.41%.sg (Singapore)
24028 0.40%.jp (Japan)
26526 0.37%.mil (USA Military)
22489 0.33%.gov (USA Government)
11142 0.31%.mx (Mexico)
19487 0.27%.nz (New Zealand)
14390 0.24%.pl (Poland)
8595 0.21%.se (Sweden)
6622 0.20%.ch (Switzerland)
7596 0.19%.br (Brazil)
5209 0.14%.dk (Denmark)
5990 0.14%.hu (Hungary)
4882 0.14%.ro (Romania)
4842 0.14%.pe (Peru)
9079 0.13%.th (Thailand)
8045 0.12%.my (Malaysia)
6916 0.12%.il (Israel)
6800 0.12%.no (Norway)
4123 0.10%.at (Austria)
2715 0.09%.cl (Chile)
5453 0.08%.hk (Hong Kong)
3850 0.08%.ar (Argentina)
3398 0.07%.ee (Estonia)
2848 0.07%.es (Spain)
3320 0.07%.pt (Portugal)
3985 0.07%.tr (Turkey)
3026 0.07%.cz (Czech Republic)
1443 0.06%.ma (Morocco)
1707 0.06%.sk (Slovakia)
3784 0.05%.gr (Greece)
2096 0.05%.mt (Malta)
5944 0.05%.tw (Taiwan)
1650 0.04%.cy (Cyprus)
2558 0.04%.id (Indonesia)
2442 0.04%.za (South Africa)
2069 0.04%.co (Colombia)
1475 0.03%.is (Iceland)
3062 0.03%.in (India)
1855 0.03%.arpa (Arpanet)
1211 0.03%.lt (Lithuania)
1790 0.03%.ru (Russia)
1383 0.02%.sa (Saudi Arabia)
1192 0.02%.ie (Ireland)
1292 0.02%[unknown domain]
1573 0.02%.hr (Croatia)
603 0.02%.cr (Costa Rica)
1381 0.01%.ph (Philippines)
1170 0.01%[domain not given]
500 0.01%.lu (Luxembourg)
609 0.01%.bg (Bulgaria)
567 0.01%.gt (Guatemala)
524 0.01%.qa (Qatar)
498 0.01%.si (Slovenia)
671 0.01%.tv (Tuvalu)
900 0.01%.tt (Trinidad and Tobago)
619 0.01%.pk (Pakistan)
420 0.01%.bs (Bahamas)
270 0.01%.nu (Niue)
194 0.01%.lv (Latvia)
403 0.01%.yu (Former Yugoslavia)
361 0.01%.lk (Sri Lanka)
1316 0.01%.md (Moldova)
275 .uy (Uruguay)
527 .cc (Cocos (Keeling) Islands)
318 .vn (Vietnam)
120 .ua (Ukraine)
74 .py (Paraguay)
147 .to (Tonga)
156 .kw (Kuwait)
246 .do (Dominican Republic)
181 .ws (Samoa)
203 .bm (Bermuda)
117 .int (International Treaty Organisations)
133 .bn (Brunei Darussalam)
170 .info (Informational)
61 .ve (Venezuela)
156 .jo (Jordan)
92 .ad (Andorra)
56 .pf (French Polynesia)
70 .ba (Bosnia-Herzegovina)
186 .mu (Mauritius)
151 .zw (Zimbabwe)
49 .cx (Christmas Island)
110 .np (Nepal)
157 .bw (Botswana)
99 .lb (Lebanon)
15 .jm (Jamaica)
173 .cn (China)
48 .eg (Egypt)
114 .zm (Zambia)
43 .nc (New Caledonia)
27 .pg (Papua New Guinea)
61 .ni (Nicaragua)
17 .li (Liechtenstein)
107 .aero (Air Transport Industry)
37 .ge (Georgia)
93 .kr (South Korea)
21 .hn (Honduras)
75 .na (Namibia)
60 .ci (Ivory Coast)
70 .ae (United Arab Emirates)
48 .ec (Ecuador)
31 .ky (Cayman Islands)
6 .kg (Kyrgyzstan)
50 .om (Oman)
65 .ke (Kenya)
38 .aw (Aruba)
5 .gl (Greenland)
59 .biz (Businesses)
15 .mk (Macedonia (Former Yugoslav Republic))
30 .gi (Gibraltar)
40 .vi (Virgin Islands (USA))
16 .mz (Mozambique)
69 .coop (Co-operatives)
37 .bo (Bolivia)
46 .by (Belarus)
37 .cu (Cuba)
33 .mv (Maldives)
52 .ir (Iran)
29 .sy (Syria)
12 .tz (Tanzania)
8 .kh (Cambodia)
15 .al (Albania)
8 .ms (Montserrat)
17 .fj (Fiji)
20 .gy (Guyana)
2 .pr (Puerto Rico)
12 .kn (Saint Kitts and Nevis)
12 .tp (East Timor)
19 .sv (El Salvador)
19 .gh (Ghana)
11 .bt (Bhutan)
11 .je (Jersey)
10 .gg (Guernsey)
10 .ug (Uganda)
11 .bb (Barbados)
11 .ag (Antigua and Barbuda)
3 .fo (Faroe Islands)
2 .bz (Belize)
1 .kz (Kazakhstan)
1 .ao (Angola)
1 .sm (San Marino)
4 .sc (Seychelles)

Organisation Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the organisations of the computers which requested files.

Listing the top 20 organisations by the number of requests, sorted by the number of requests.

reqs%bytesorganisation
631905 8.99%comcast.net
369163 5.06%rr.com
246222 3.88%aol.com
242184 3.51%cox.net
234895 3.04%verizon.net
205249 3.22%pacbell.net
122970 1.54%charter.com
117917 1.39%ameritech.net
116158 1.57%adelphia.net
107537 1.26%bellsouth.net
100378 1.47%optonline.net
85110 0.80%level3.net
83543 1.14%rogers.com
82756 1.13%swbell.net
78992 0.91%qwest.net
77205 1.01%btcentralplus.com
71407 1.13%shawcable.net
71186 1.14%sympatico.ca
64241 0.91%telus.net
60016 1.17%ntli.net
379290555.74%[not listed: 20,700 organisations]

Search Word Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists which words people used in search engines to find the site.

Listing the top 30 query words by the number of requests, sorted by the number of requests.

reqssearch term
46607rabbit
32486rabbits
11454baby
9746bunny
9298care
6928language
6884body
6260bunnies
5973house
5387of
5136a
4748to
4583wild
4449pictures
4206how
4009for
3519society
2200pet
1980in
1955what
1583and
1540do
1430litter
1315feed
1289caring
1198the
1186training
1068feeding
1030cute
983newborn
105815[not listed: 7,514 search terms]

Operating System Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the operating systems used by visitors.

Listing operating systems, sorted by the number of requests for pages.

no.reqspagesOS
164755441252899Windows
 5027423971546  Windows XP
 737473150790  Windows 2000
 47436183432  Windows 98
 15405428056  Windows ME
 295446436  Windows NT
 226216000  Windows Server 2003
 154613681  Windows 95
 130922789  Unknown Windows
 1492166  Windows CE
 233  Windows 3.1
229965667111Macintosh
35392241734Known robots
46708835196OS unknown
5478328639Unix
 431356493  Linux
 19831093  BSD
 26981050  SunOS
 132  Other Unix
 31  HP-UX
61619490WebTV
78312OS/2
83511Symbian OS
93310RISC OS
1092BeOS
1110Palm OS
1230Amiga

Status Code Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the HTTP status codes of all requests.

Listing status codes, sorted numerically.

reqsstatus code
5958113200 OK
17160206 Partial content
11239301 Document moved permanently
1922302 Document found elsewhere
986666304 Not modified since last retrieval
555400 Bad request
22401 Authentication required
14403 Access forbidden
248318404 Document not found
218405 Method not allowed
1078408 Request timeout
44414 Requested filename too long
1501 Request type not supported

File Size Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the sizes of files.

sizereqs%bytes
01021004 
1B- 10B51 
11B- 100B248065 0.02%
101B- 1kB1301164 0.62%
1kB- 10kB248113617.61%
10kB-100kB185206866.51%
100kB- 1MB5843015.19%
1MB- 10MB20 0.04%
10MB-100MB1 0.02%

File Type Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the extensions of files.

Listing extensions with at least 0.1% of the traffic, sorted by the amount of traffic.

reqs%bytesextension
124038645.24%.jpg [JPEG graphics]
32429616.70%[directories]
108091015.40%.html [Hypertext Markup Language]
362183613.45%.gif [GIF graphics]
82878 4.24%.JPG
412413 2.58%.cgi [CGI scripts]
4421 1.21%.pdf [Adobe Portable Document Format]
12102 0.33%.png [PNG graphics]
1866 0.30%.bmp
7529 0.14%.txt [Plain text]
173302 0.41%[not listed: 38 extensions]

Directory Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the directories from which files were requested. (The figures for each directory include all of its subdirectories.)

Listing directories with at least 0.01% of the traffic, sorted by the amount of traffic.

reqs%bytesdirectory
364476956.85%/graphics/
78646510.64%/chapters/
310240 8.00%/rabbit-center/
715873 7.73%/fun/
208668 3.47%/journal/
131787 3.36%/faq/
412438 2.57%/cgi-bin/
184563 2.34%[root directory]
94366 2.00%/care/
22999 0.53%/hrs-info/
29633 0.44%/behavior/
31047 0.42%/links/
17174 0.33%/adoption/
58171 0.32%/easter/
15893 0.30%/health/
110398 0.09%/spam_vaccine/
404 0.08%/adopt-a-rabbit-month/
6085 0.07%/translations/
2920 0.07%/help/
4917 0.06%/kids/
3300 0.05%/vets/
22717 0.05%/styles/
131822 0.04%/icons/
1625 0.04%/faqgerman/
1901 0.03%/opinion/
2245 0.03%/stories/
4129 0.02%/webmail/
1502 0.02%/postcard/
1794 0.01%/chat/
818 0.01%/rescue/
1276 0.02%[not listed: 14 directories]

Request Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the files on the site.

Listing files with at least 20 requests, sorted by the number of requests.

reqs%byteslast timefile
660020 6.87%30/Jun/05 00:06/fun/net-bunnies.html
272292 2.27%29/Jun/05 23:25/cgi-bin/chat/chat.cgi
4827 0.04%15/Jun/05 04:19  /cgi-bin/chat/chat.cgi?action=chat&id=ptzknobohpmleariotieralzkejgdc
4410 0.04%12/Jun/05 00:09  /cgi-bin/chat/chat.cgi?action=chat&id=lrwkofpxeqsmktkutohbskruqwkjeb&pause=
3676 0.02%26/Jun/05 18:57  /cgi-bin/chat/chat.cgi?action=chat&id=vlwmuetmdvulofkzctupcauxeaghar&pause=
3452 0.03%26/Jun/05 23:12  /cgi-bin/chat/chat.cgi?action=chat&id=prvmfkdsjhdnkycraingueqczztiri&pause=
2686 0.02%27/Jun/05 02:54  /cgi-bin/chat/chat.cgi?action=chat&id=cxpvetqaoidycrndolmlplhcsogdhy&pause=
2415 0.02%26/Jun/05 21:39  /cgi-bin/chat/chat.cgi?action=chat&id=bmwmagefsmykjhjzjrgntkvdexxhrs
2391 0.02%26/Jun/05 00:09  /cgi-bin/chat/chat.cgi?action=chat&id=rmvebsxjqjrcjoxctzlfcceionands
2377 10/Jun/05 12:48  /cgi-bin/chat/chat.cgi?action=chat&id=ujpxkegiaajmhwefccvzxamstksves&pause=
2229 0.02%26/Jun/05 20:57  /cgi-bin/chat/chat.cgi?action=chat&id=nualctikkkzpswuwlsiaatxpwdowcv&pause=
2174 0.02%18/Jun/05 21:33  /cgi-bin/chat/chat.cgi?action=chat&id=mpnoodzfljoqitopzvtjywpubemkyd&pause=
2147 0.02%17/Jun/05 22:27  /cgi-bin/chat/chat.cgi?action=chat&id=bjnikujzjjwynqmybdpsuxvcicfqrj
2071 0.02% 3/Jun/05 21:29  /cgi-bin/chat/chat.cgi?action=chat&id=kqufmdywuirwdnbpgewkkdvrlfhnzh&pause=
2000 0.02% 1/Jun/05 20:41  /cgi-bin/chat/chat.cgi?action=chat&id=bnuxvofwsybnxbjzsuhpnxydwjscpy&pause=
1934 0.02% 1/Jun/05 23:55  /cgi-bin/chat/chat.cgi?action=chat&id=gkuznphjcplokqvtuhjiqjvyvzemnu&pause=
1934 0.02% 1/Jun/05 23:36  /cgi-bin/chat/chat.cgi?action=chat&id=bnuxvofwsybnxbjzsuhpnxydwjscpy
1836 0.02% 9/Jun/05 23:13  /cgi-bin/chat/chat.cgi?action=chat&id=kyyhproucvmddfzbzqepxrkjhmbwns
1813 0.02%22/Jun/05 23:52  /cgi-bin/chat/chat.cgi?action=chat&id=hmviamzponyhqcrcmekkezssubphdi&pause=
1696 0.02%28/Jun/05 21:19  /cgi-bin/chat/chat.cgi?action=chat&id=gqdegkfoickidtmtvipxgqvdnndvay
1663 0.02%22/Jun/05 23:52  /cgi-bin/chat/chat.cgi?action=chat&id=dodobusstaelibndhghltvinmstdhq&pause=
1568 0.02%10/Jun/05 21:35  /cgi-bin/chat/chat.cgi?action=chat&id=ecaaxglmwrsltcyrgfdyxbqkgrlqqh
1550 0.01%27/Jun/05 21:15  /cgi-bin/chat/chat.cgi?action=chat&id=ddnbcjybudxlhmsgowtgjayplqiybs
1419 0.01%27/Jun/05 22:12  /cgi-bin/chat/chat.cgi?action=chat&id=lultlukgttfwmijlevqhlmedwvpemx&pause=
1398 0.01%27/Jun/05 20:39  /cgi-bin/chat/chat.cgi?action=chat&id=fiamoqmgqrntcxexuvrymggwvmytxm
1391 0.01%15/Jun/05 21:57  /cgi-bin/chat/chat.cgi?action=chat&id=bihsgpqicmzfyjselnbpqtbguaxhmw&pause=
1388 0.01%12/Jun/05 00:15  /cgi-bin/chat/chat.cgi?action=chat&id=trtccdzlsyuwvdmotsjtofgyzvkknf
1376 0.01% 9/Jun/05 23:13  /cgi-bin/chat/chat.cgi?action=chat&id=zvknzphwdizqoaqlwkrijajryvcvrp
1332 0.01%11/Jun/05 23:53  /cgi-bin/chat/chat.cgi?action=chat&id=ezbpfqfebimalysycnwqmsbpvygivy
1260 0.01%10/Jun/05 22:03  /cgi-bin/chat/chat.cgi?action=chat&id=jflswzyfatqfmsszmhgnzaihkhglyu
1214 0.01% 2/Jun/05 22:13  /cgi-bin/chat/chat.cgi?action=chat&id=vglhiwrqwhzfmxxdpuzwakdvmhqfod
1213 0.01%11/Jun/05 19:45  /cgi-bin/chat/chat.cgi?action=chat&id=bkilfojwzzvyamxdhlujwqwccthron
1205 0.01%22/Jun/05 20:56  /cgi-bin/chat/chat.cgi?action=chat&id=azcwskmqrgqvjptcwhxdqilmntjzck
1188 0.01% 1/Jun/05 23:36  /cgi-bin/chat/chat.cgi?action=chat&id=mkgikavmgjglrctnpiekizdhnjximv&pause=
1183 0.01%14/Jun/05 21:27  /cgi-bin/chat/chat.cgi?action=chat&id=csufynxqcwzskpaibqrqvmsawmfsxo
1161 0.01%12/Jun/05 22:54  /cgi-bin/chat/chat.cgi?action=chat&id=gziajvjwjcplgjklelhcauytcejcbu
1136 0.01%17/Jun/05 21:51  /cgi-bin/chat/chat.cgi?action=chat&id=mqvkxnxombuwommeyafufkwzylguok
1129 0.01% 5/Jun/05 21:11  /cgi-bin/chat/chat.cgi?action=chat&id=macgqrrryyqgcnexyedrysaikgkonp
1113 0.01% 5/Jun/05 20:57  /cgi-bin/chat/chat.cgi?action=chat&id=wcmvwhvphqaqszbeomvphtsxidmfap
1103 0.01%10/Jun/05 22:02  /cgi-bin/chat/chat.cgi?action=chat&id=vcajjypkltrivvyybgyixzebmdrkzi
1101 0.01%25/Jun/05 22:08  /cgi-bin/chat/chat.cgi?action=chat&id=pibpprolbbbijqsjfhvdokbizopxpj
1087 0.01%20/Jun/05 21:40  /cgi-bin/chat/chat.cgi?action=chat&id=kspxjenofrlqcpukafxehkavevoxqx&pause=
1081 0.01%12/Jun/05 18:13  /cgi-bin/chat/chat.cgi?action=chat&id=lddwailwiayfntomaarpteowczeayn&pause=
1057 0.01%16/Jun/05 18:52  /cgi-bin/chat/chat.cgi?action=chat&id=twazlignzjsohoudvlbxksfdhivmnh
1045 0.01%15/Jun/05 21:57  /cgi-bin/chat/chat.cgi?action=chat&id=oasgkdbjlwqqyrsnzidrhfsdyxbhfm&pause=
1041 0.01% 3/Jun/05 21:15  /cgi-bin/chat/chat.cgi?action=chat&id=asxxoicaorntbrkxpfzofrzsxfcmyh&pause=
1034 0.01%24/Jun/05 19:05  /cgi-bin/chat/chat.cgi?action=chat&id=pkayywqgqphhqmfevukrwvmfyeqgfq
1026 0.01%25/Jun/05 23:37  /cgi-bin/chat/chat.cgi?action=chat&id=bzydsrfrzvvkkbwyewrrspzpsbkkah&pause=
1020 0.01%17/Jun/05 21:10  /cgi-bin/chat/chat.cgi?action=chat&id=iuhmbyejprnapfgiujxthgvupartbf&pause=
1008 0.01%25/Jun/05 18:03  /cgi-bin/chat/chat.cgi?action=chat&id=oxsizuqrkqghyeoekpygfaqgoheqyu&pause=
997 0.01%12/Jun/05 19:25  /cgi-bin/chat/chat.cgi?action=chat&id=uuudjojfuvdbuczuekmdewlkgwulcs
990 0.01%25/Jun/05 17:33  /cgi-bin/chat/chat.cgi?action=chat&id=yvjgaibvxyidkfscvvbmzcmghlzwwh
985 0.01% 7/Jun/05 19:49  /cgi-bin/chat/chat.cgi?action=chat&id=tzopgjlplazuvgitxkepelqvopqvsu&pause=
977 26/Jun/05 14:44  /cgi-bin/chat/chat.cgi?action=chat&id=ruvzlgdkrnlxiaiccbuhwkttaztabp
967 25/Jun/05 13:35  /cgi-bin/chat/chat.cgi?action=chat&id=pexeferzkesqauruouajjosquepnhk
950 0.01%12/Jun/05 20:53  /cgi-bin/chat/chat.cgi?action=chat&id=ujruvgibniilzxurltxjkwapzrthoh
923 0.01%25/Jun/05 18:03  /cgi-bin/chat/chat.cgi?action=chat&id=mjgesedveyqernyrwvfhrbnayrohby&pause=
899 0.01%20/Jun/05 21:39  /cgi-bin/chat/chat.cgi?action=chat&id=smuizeaykgrfsbscoycweklvhekypa&pause=
894 0.01%11/Jun/05 22:07  /cgi-bin/chat/chat.cgi?action=chat&id=htvfiywbqtkblpqvtdppldffxgptns
894 0.01% 6/Jun/05 17:57  /cgi-bin/chat/chat.cgi?action=chat&id=hgeyphsujzqjtamkqwxvcmghvfrxmq
858 0.01%24/Jun/05 21:19  /cgi-bin/chat/chat.cgi?action=chat&id=nzslpqeqdhntvupuxdjksypudfkive&pause=
852 0.01%23/Jun/05 21:15  /cgi-bin/chat/chat.cgi?action=chat&id=emyjawhvxbsprkrqcvjvpxbviztfao
847 0.01%25/Jun/05 21:18  /cgi-bin/chat/chat.cgi?action=chat&id=swxnaqixybwzljsigsixgldbxgjuaq&pause=
837 0.01%20/Jun/05 20:04  /cgi-bin/chat/chat.cgi?action=chat&id=xplglqmqtqxixrwlwpzjqhtaygyseh
811 0.01%21/Jun/05 18:58  /cgi-bin/chat/chat.cgi?action=chat&id=xtczqpfsfkxwkxrpbgbtxybhthieso&pause=
805 0.01%24/Jun/05 19:15  /cgi-bin/chat/chat.cgi?action=chat&id=ldtwrqpbkxegiemcanwtquyyhvwgwj
797 0.01% 3/Jun/05 20:58  /cgi-bin/chat/chat.cgi?action=chat&id=leppsrznxpzftykxwvgeuevtzzhhrj
797 0.01%17/Jun/05 20:53  /cgi-bin/chat/chat.cgi?action=chat&id=jnslicgfdqrubrphdorcdkkeumxbfl&pause=
790 0.01%21/Jun/05 20:45  /cgi-bin/chat/chat.cgi?action=chat&id=exairsjvdhlnmzbqhdxgxtwfogvcgf
790 0.01% 2/Jun/05 09:44  /cgi-bin/chat/chat.cgi?action=chat&id=mabeewltovazxmnfeshmucyyzyxzxj
786 0.01%15/Jun/05 21:25  /cgi-bin/chat/chat.cgi?action=chat&id=oasgkdbjlwqqyrsnzidrhfsdyxbhfm
784 0.01%16/Jun/05 21:35  /cgi-bin/chat/chat.cgi?action=chat&id=nnbfvsrsfwdwoucucivptizcfxkqcd
771 0.01%27/Jun/05 19:56  /cgi-bin/chat/chat.cgi?action=chat&id=zyyyeecyhnjvkibqrtwresuapkgebe&pause=
771 0.01% 5/Jun/05 19:29  /cgi-bin/chat/chat.cgi?action=chat&id=macgqrrryyqgcnexyedrysaikgkonp&pause=
769 0.01% 4/Jun/05 20:23  /cgi-bin/chat/chat.cgi?action=chat&id=slvwrfnzesikswjjdddwlrehbijupn
769 0.01%19/Jun/05 20:53  /cgi-bin/chat/chat.cgi?action=chat&id=hjkluqqwtgmyjmyrakhocbnihlunmz
750 0.01%24/Jun/05 19:55  /cgi-bin/chat/chat.cgi?action=chat&id=fkdtaqfycuyzjkbluodwkaiivacxhm&pause=
749 0.01%15/Jun/05 21:24  /cgi-bin/chat/chat.cgi?action=chat&id=mpflbucnwrrnzlltifeivakyvezpxw
745 0.01% 3/Jun/05 20:55  /cgi-bin/chat/chat.cgi?action=chat&id=ofroawaleavkoouexwqiwcnkhpvwtn&pause=
742 0.01%21/Jun/05 21:12  /cgi-bin/chat/chat.cgi?action=chat&id=zoeeqimwygahxvenqoanncfoimuvrf
734 0.01%24/Jun/05 21:06  /cgi-bin/chat/chat.cgi?action=chat&id=oapqxijpfpjhkgqmjodnqxhfhpezxu
729 0.01%18/Jun/05 20:37  /cgi-bin/chat/chat.cgi?action=chat&id=mndztvznyexgtzhnqqnvhkojbtvakn
727 0.01%27/Jun/05 21:15  /cgi-bin/chat/chat.cgi?action=chat&id=bdkowkmpjzwcvubvkvjasakludrmqu&pause=
723 0.01% 9/Jun/05 21:12  /cgi-bin/chat/chat.cgi?action=chat&id=sqnkmknhwyyhrcygbujdsdrwnneplc&pause=
712 0.01%17/Jun/05 19:38  /cgi-bin/chat/chat.cgi?action=chat&id=kbvgpvwfbmryprsvihawwkaseinzof
709 0.01%21/Jun/05 20:48  /cgi-bin/chat/chat.cgi?action=chat&id=jfxxmgmcdrqknfqcfjdkbjigzlffag
709 0.01% 2/Jun/05 09:43  /cgi-bin/chat/chat.cgi?action=chat&id=zzgkyshjdknanxgyjfjbuvyzfjxqme&pause=
707 0.01%13/Jun/05 21:04  /cgi-bin/chat/chat.cgi?action=chat&id=dqlxpnwmpluimffbhjdobgjtmsidzv&pause=
701 0.01%11/Jun/05 22:59  /cgi-bin/chat/chat.cgi?action=chat&id=ozglqcgojpeuqcchnxifrbwtvdlxdf&pause=
698 0.01%16/Jun/05 21:31  /cgi-bin/chat/chat.cgi?action=chat&id=ipogaiwwmcblczyowptxzvyffudahb&pause=
697 0.01%12/Jun/05 20:49  /cgi-bin/chat/chat.cgi?action=chat&id=paaapnfznjbpnnetwyenkbeipkuqtf&pause=
667 0.01%15/Jun/05 20:16  /cgi-bin/chat/chat.cgi?action=chat&id=ujeixstwaywzxhvggsidvkdvhbukoa
664 0.01%29/Jun/05 19:30  /cgi-bin/chat/chat.cgi?action=chat&id=vzciwyzougfaegzdwrijbkfxrhujxw&pause=
664 0.01%21/Jun/05 21:11  /cgi-bin/chat/chat.cgi?action=chat&id=wjblpieevbawyohlpsudtwdpsdlacd
663 0.01% 7/Jun/05 22:09  /cgi-bin/chat/chat.cgi?action=chat&id=pzbqvjcygifqeifplowubaardulnly
662 0.01% 1/Jun/05 20:57  /cgi-bin/chat/chat.cgi?action=chat&id=vdulfhyhuguvopflfclsznykntkukd&pause=
661 0.01% 8/Jun/05 19:21  /cgi-bin/chat/chat.cgi?action=chat&id=tklzpuqmbzhafzheatvamwqiqqpevv&pause=
660 0.01%29/Jun/05 21:23  /cgi-bin/chat/chat.cgi?action=chat&id=ewezrjrsnshxfhtpeiufjyfohxhqxi&pause=
656 0.01% 4/Jun/05 20:56  /cgi-bin/chat/chat.cgi?action=chat&id=tziccutxlzvllajwkbswrmzifyopzj
654 0.01%19/Jun/05 20:05  /cgi-bin/chat/chat.cgi?action=chat&id=enfuwrrooazshlldiurdljtqjtjlsm
650 0.01%24/Jun/05 19:44  /cgi-bin/chat/chat.cgi?action=chat&id=tcarbreoalltummtlqmhsrrzwnujpw&pause=
647 0.01%28/Jun/05 21:15  /cgi-bin/chat/chat.cgi?action=chat&id=dlqsnmhtgcsinjopiasflecclopfel
646 0.01% 1/Jun/05 23:04  /cgi-bin/chat/chat.cgi?action=chat&id=edyzhomcypumytvezmyqihsnobgdes
646 0.01%10/Jun/05 20:55  /cgi-bin/chat/chat.cgi?action=chat&id=gpeeggwcxrtaovosrzkoefxdksqlxw&pause=
641 0.01%22/Jun/05 20:59  /cgi-bin/chat/chat.cgi?action=chat&id=anobxfconkhvyuqofeuqldkqbctzrh&pause=
638 0.01%28/Jun/05 21:33  /cgi-bin/chat/chat.cgi?action=chat&id=dwlnuiqdijhlsmbbmztgdgskfkxphh&pause=
635 0.01%15/Jun/05 21:02  /cgi-bin/chat/chat.cgi?action=chat&id=adlmcuzdeohwvzabtuwzwyrylzxzhm
633 0.01%21/Jun/05 20:05  /cgi-bin/chat/chat.cgi?action=chat&id=zoeeqimwygahxvenqoanncfoimuvrf&pause=
633 0.01%26/Jun/05 21:39  /cgi-bin/chat/chat.cgi?action=chat&id=kxvqxgfsxlziwzdmbuhmotdomljzwa
632 0.01% 7/Jun/05 21:29  /cgi-bin/chat/chat.cgi?action=chat&id=opksjkbqzlzqdxqkcwlhqjsyujkfaa&pause=
631 0.01%18/Jun/05 21:14  /cgi-bin/chat/chat.cgi?action=chat&id=bxueeqjjfyzcydhfnbzwhiltntnhrl&pause=
629 0.01%29/Jun/05 20:28  /cgi-bin/chat/chat.cgi?action=chat&id=qcpvcgauftpmaqlaaxietmaocybdyj
623 0.01%14/Jun/05 21:34  /cgi-bin/chat/chat.cgi?action=chat&id=symkkpjimrczwbzqtospsunxocvmen
620 0.01%11/Jun/05 20:03  /cgi-bin/chat/chat.cgi?action=chat&id=vjhezagvhrzfuvescjmddwxlxavngu&pause=
614 0.01%12/Jun/05 19:32  /cgi-bin/chat/chat.cgi?action=chat&id=eehoidilntovndawsdabkwvyqdmqbt&pause=
613 15/Jun/05 18:06  /cgi-bin/chat/chat.cgi?action=chat&id=ownimfrstohbgapamqsdjnsailiien
613 0.01% 4/Jun/05 20:55  /cgi-bin/chat/chat.cgi?action=chat&id=lndgytxacbwgaxauoahkvkjvnncrai
611 0.01%20/Jun/05 20:38  /cgi-bin/chat/chat.cgi?action=chat&id=nyehnyjtllnepfcdowmpvdscwiskjw&pause=
610 0.01% 5/Jun/05 19:41  /cgi-bin/chat/chat.cgi?action=chat&id=hsckmkohvunpqjgwabiqeuxlggknyn&pause=
610 29/Jun/05 08:03  /cgi-bin/chat/chat.cgi?action=chat&id=ptkeggstdaswyykeswafnqzdxofbnr&pause=
608 0.01%25/Jun/05 17:42  /cgi-bin/chat/chat.cgi?action=chat&id=alshugjfbsfetqualdmpbpmdxeoeif&pause=
603 0.01%26/Jun/05 18:00  /cgi-bin/chat/chat.cgi?action=chat&id=bmwmagefsmykjhjzjrgntkvdexxhrs&pause=
597 0.01% 1/Jun/05 22:14  /cgi-bin/chat/chat.cgi?action=chat&id=eijnwaipvvkigjriqrwdxmfmkvcelx
595 0.01%15/Jun/05 20:37  /cgi-bin/chat/chat.cgi?action=chat&id=gtauhqpjlvgpnxfltjuyxmsjdbtmsw&pause=
583 0.01% 6/Jun/05 20:43  /cgi-bin/chat/chat.cgi?action=chat&id=xhgeqckrznuroedylljeakaxjjjzme
582 0.01%11/Jun/05 20:58  /cgi-bin/chat/chat.cgi?action=chat&id=axlkmcqsisdyrglryrpjvjhqjaikmk&pause=
582  6/Jun/05 17:46  /cgi-bin/chat/chat.cgi?action=chat&id=hyjmwoxybdonqgjlxgoqmvuxrzjdbr&pause=
582 0.01%19/Jun/05 21:12  /cgi-bin/chat/chat.cgi?action=chat&id=nxhsipcprikwufraflzzgfknawwmmq&pause=
581 0.01%12/Jun/05 20:53  /cgi-bin/chat/chat.cgi?action=chat&id=gxdbchxkaelftrptuvcofczrhpaugo
578 13/Jun/05 21:04  /cgi-bin/chat/chat.cgi?action=chat&id=hjzaprjxeyihrzhsnijvgnrykocegf&pause=
577 0.01%16/Jun/05 18:19  /cgi-bin/chat/chat.cgi?action=chat&id=ycyoqxryxcbqjnwrbwvocopufnbzey
575 0.01% 3/Jun/05 20:44  /cgi-bin/chat/chat.cgi?action=chat&id=zfgfnqvbdzfrdexwletlojnaabjoxg
574 0.01%23/Jun/05 20:45  /cgi-bin/chat/chat.cgi?action=chat&id=jbqwavbamsifwcksxxjddraxgxefsj&pause=
571 0.01% 1/Jun/05 21:56  /cgi-bin/chat/chat.cgi?action=chat&id=edyzhomcypumytvezmyqihsnobgdes&pause=
566 0.01%24/Jun/05 19:49  /cgi-bin/chat/chat.cgi?action=chat&id=qwdrgdnuolffwwrfhzfwxgkbqjogxy&pause=
566 22/Jun/05 18:07  /cgi-bin/chat/chat.cgi?action=chat&id=pnsbnmhbwooqynxkhriqylvdzshygf&pause=
564 0.01%12/Jun/05 20:09  /cgi-bin/chat/chat.cgi?action=chat&id=wqzcsfsmjiudrzoofsmfyldsbbwkaj&pause=
559 18/Jun/05 20:36  /cgi-bin/chat/chat.cgi?action=chat&id=fbtydlcdlxndbfgoqxiqebckewgocm&pause=
552 28/Jun/05 14:25  /cgi-bin/chat/chat.cgi?action=chat&id=bxeojlhefjoduxcrrebjmozcebitkm
552 0.01%25/Jun/05 18:42  /cgi-bin/chat/chat.cgi?action=chat&id=rrihmmkzoappwjysnoacypjuomvcue
551 25/Jun/05 20:15  /cgi-bin/chat/chat.cgi?action=chat&id=bubnmhvnnremghomjzjgdvtbvtgkbs
550 0.01%22/Jun/05 20:40  /cgi-bin/chat/chat.cgi?action=chat&id=lkwvokdxsnoeawbshhxgdhhunppakh&pause=
549 29/Jun/05 07:56  /cgi-bin/chat/chat.cgi?action=chat&id=xpqtbknlafqdbgmovhvuxrgnledmzc&pause=
548 0.01%12/Jun/05 19:04  /cgi-bin/chat/chat.cgi?action=chat&id=tpgslfdwcpzwccvygduadwwcnvgydl
546 17/Jun/05 20:51  /cgi-bin/chat/chat.cgi?action=chat&id=befhrqgcwfbpjhjgedjylqyklggkqo&pause=
546 19/Jun/05 21:02  /cgi-bin/chat/chat.cgi?action=chat&id=nekzfwssqkfgyrbztoslyiqlaqpesz&pause=
543 16/Jun/05 18:16  /cgi-bin/chat/chat.cgi?action=chat&id=vlfjpwrmzbzdnefzfdnwsgdyhbyksy
539  6/Jun/05 20:48  /cgi-bin/chat/chat.cgi?action=chat&id=svcgqodketpommrmcbciqeprwbgtga&pause=
537 28/Jun/05 21:12  /cgi-bin/chat/chat.cgi?action=chat&id=wphgmluexcftwkpjsipsdcmohjbrme&pause=
529 0.01% 2/Jun/05 20:35  /cgi-bin/chat/chat.cgi?action=chat&id=ooecfqbbqzsosssxganhxvxorgpuvh&pause=
529 0.01% 7/Jun/05 19:50  /cgi-bin/chat/chat.cgi?action=chat&id=rgllftqljifyofmyaempmtdiivccew
528 0.01%21/Jun/05 20:09  /cgi-bin/chat/chat.cgi?action=chat&id=jjdqjvvojxymzoflryftdssiiigffo
518 19/Jun/05 20:37  /cgi-bin/chat/chat.cgi?action=chat&id=ainncfaxdpcrnmtpohuyvsehmoditv&pause=
514 0.01% 7/Jun/05 22:15  /cgi-bin/chat/chat.cgi?action=chat&id=qvhbpgumnqzgtyhvghdpnnfsqavprg&pause=
513 17/Jun/05 20:49  /cgi-bin/chat/chat.cgi?action=chat&id=zxsvpvcqvwojbniwqvaubnfdqprioz&pause=
508  1/Jun/05 21:27  /cgi-bin/chat/chat.cgi?action=chat&id=swlfqrrmzelfrantqrxmabirjqojkl
494 15/Jun/05 20:57  /cgi-bin/chat/chat.cgi?action=chat&id=ydflrzucgscowanitbobggywnbupjr&pause=
494 28/Jun/05 18:26  /cgi-bin/chat/chat.cgi?action=chat&id=bnacambyucvrxftwxlcixgcdjibgpf&pause=
493 28/Jun/05 19:39  /cgi-bin/chat/chat.cgi?action=chat&id=blkhvkqxcgvnqgbbufguagzwuywevl&pause=
483  6/Jun/05 20:49  /cgi-bin/chat/chat.cgi?action=chat&id=ygngsauxsmtrpcyzojqpxmstlcxrbu
477 16/Jun/05 21:08  /cgi-bin/chat/chat.cgi?action=chat&id=emfwhiuglmruigwbmicfwekebsyafn&pause=
475  3/Jun/05 21:04  /cgi-bin/chat/chat.cgi?action=chat&id=jhruuuloxfscmqqpkjphnndrychliz&pause=
475 23/Jun/05 20:11  /cgi-bin/chat/chat.cgi?action=chat&id=qiupkoikolgmhubtpbreefktkvlovw
474 22/Jun/05 20:56  /cgi-bin/chat/chat.cgi?action=chat&id=cdlytnohhrdjmesmbcfqqxowpfrvwe&pause=
474 12/Jun/05 16:47  /cgi-bin/chat/chat.cgi?action=chat&id=pkzchxscnfvbwtcrpcvzjqgfgqcnin&pause=
473 15/Jun/05 20:25  /cgi-bin/chat/chat.cgi?action=chat&id=ckufpcmwhegbegcnejbfdzpchakazh&pause=
469 17/Jun/05 19:14  /cgi-bin/chat/chat.cgi?action=chat&id=bjnikujzjjwynqmybdpsuxvcicfqrj&pause=
466 24/Jun/05 18:45  /cgi-bin/chat/chat.cgi?action=chat&id=mvemmnhiewmzzdfzbgtjeticrceirx&pause=
465 27/Jun/05 19:09  /cgi-bin/chat/chat.cgi?action=chat&id=kqysdgjxygeambxqnkywvhqfwfmylp&pause=
464 21/Jun/05 19:34  /cgi-bin/chat/chat.cgi?action=chat&id=czljjyjxnqgouoxnfmzoxetfaxbzxl&pause=
458 28/Jun/05 19:42  /cgi-bin/chat/chat.cgi?action=chat&id=weustdfhoeivbjyuysfgvbnvdwhtmn
458 16/Jun/05 17:14  /cgi-bin/chat/chat.cgi?action=chat&id=mzjzdtefbxicpppthezrwpuapwgcpv
450 10/Jun/05 21:18  /cgi-bin/chat/chat.cgi?action=chat&id=yluipzlioihsldcvdnxnqxlsmvbjxy
448 20/Jun/05 20:38  /cgi-bin/chat/chat.cgi?action=chat&id=lppkmuwsvskbhqnntdmxzdwmrredrp&pause=
448 29/Jun/05 19:26  /cgi-bin/chat/chat.cgi?action=chat&id=yclmckgitoeeqxfvtszihpxfogbssf
446 27/Jun/05 18:46  /cgi-bin/chat/chat.cgi?action=chat&id=bgqfuihuzatwalytbrdoxosabsufgm&pause=
445 19/Jun/05 20:27  /cgi-bin/chat/chat.cgi?action=chat&id=kjuvovbmcnslgnbqbsgigylxwejggd&pause=
445 22/Jun/05 19:32  /cgi-bin/chat/chat.cgi?action=chat&id=qiuqpckkikylpkwhvjifejqrwatvqo
445  4/Jun/05 20:29  /cgi-bin/chat/chat.cgi?action=chat&id=iqzxuqtmizxrjumcmobpdvguphqdhf&pause=
444 26/Jun/05 18:54  /cgi-bin/chat/chat.cgi?action=chat&id=jzsyottzdxjlpzpaxutxbskqgvwqqo&pause=
441  1/Jun/05 22:00  /cgi-bin/chat/chat.cgi?action=chat&id=bqpjkjugqrcqfoeylgsnjxvhfevpqo&pause=
440 21/Jun/05 20:45  /cgi-bin/chat/chat.cgi?action=chat&id=jvtyzjkmndhrztcacxcegkjriqkmuw&pause=
437 17/Jun/05 17:27  /cgi-bin/chat/chat.cgi?action=chat&id=qeckxhhnsdzaonvqkyylbmmetvmpvg
437 18/Jun/05 20:13  /cgi-bin/chat/chat.cgi?action=chat&id=rhtjemfmujxbvfmsbbtvrdultwhkhp
436  7/Jun/05 21:25  /cgi-bin/chat/chat.cgi?action=chat&id=xiujfidygvgjupaqrbogecqjkhrggl
434 13/Jun/05 18:43  /cgi-bin/chat/chat.cgi?action=chat&id=zkkounbmemauftmqnkexpiccqrkfvq
433 29/Jun/05 20:32  /cgi-bin/chat/chat.cgi?action=chat&id=qtamdcvhstucvjibycjkeygemszcni&pause=
432  7/Jun/05 19:48  /cgi-bin/chat/chat.cgi?action=chat&id=addeebleudayjopcfpmwxvguxiyxkd&pause=
432 23/Jun/05 20:23  /cgi-bin/chat/chat.cgi?action=chat&id=djpxhwocflgwoucglsthrbrfgzammc&pause=
430  2/Jun/05 07:27  /cgi-bin/chat/chat.cgi?action=chat&id=xomsdbozijqhvridciasagqbxyegck&pause=
430 22/Jun/05 17:59  /cgi-bin/chat/chat.cgi?action=chat&id=zequhiemkgzdmbdssugbobxiqzxznv&pause=
428 19/Jun/05 21:08  /cgi-bin/chat/chat.cgi?action=chat&id=uadypazbfzqvcqxikvedmpgyonyhad&pause=
427 22/Jun/05 20:55  /cgi-bin/chat/chat.cgi?action=chat&id=pbbprjpxphmztkknuvsfrxyqgokeoa&pause=
425  2/Jun/05 20:18  /cgi-bin/chat/chat.cgi?action=chat&id=iinjdhmtmrypaglpnoudnjwuxtdcdo&pause=
425 10/Jun/05 18:51  /cgi-bin/chat/chat.cgi?action=chat&id=hrmhnvprdylvkfwjmebcnfrumphvrz
424  9/Jun/05 19:08  /cgi-bin/chat/chat.cgi?action=chat&id=jjaebejxocbjglhlwgopaiuledauuv&pause=
421  4/Jun/05 20:32  /cgi-bin/chat/chat.cgi?action=chat&id=riuvpsmbmkxjnsddnkozutigaiajxx&pause=
417  2/Jun/05 20:20  /cgi-bin/chat/chat.cgi?action=chat&id=ecpaonckpfeomwyspfdspcajnomtko
417  5/Jun/05 20:45  /cgi-bin/chat/chat.cgi?action=chat&id=ilohodvydrqkowkhoqxvpkoltsyewr&pause=
413 12/Jun/05 14:06  /cgi-bin/chat/chat.cgi?action=chat&id=xmmuorzkeioeyeodkfpqbsuwfxpnkj
413 19/Jun/05 16:53  /cgi-bin/chat/chat.cgi?action=chat&id=oaagcwnmajpapjpwvhuyarfmdnsmjv&pause=
413 25/Jun/05 20:30  /cgi-bin/chat/chat.cgi?action=chat&id=sffqjxtmmxgknrxspiblmjcdwgkgvh&pause=
413 20/Jun/05 18:36  /cgi-bin/chat/chat.cgi?action=chat&id=msixskhphabksbafyvphbzmbdwlwpc&pause=
410 20/Jun/05 20:55  /cgi-bin/chat/chat.cgi?action=chat&id=dasywnhlyduhpkqecemnyfrajrzrso
408 22/Jun/05 20:56  /cgi-bin/chat/chat.cgi?action=chat&id=muxujsragxfffbdqnpzheazbsgeuhz&pause=
406  7/Jun/05 21:12  /cgi-bin/chat/chat.cgi?action=chat&id=sjfgaeyxlbtzdsybojnrsinvikflls&pause=
404 18/Jun/05 21:00  /cgi-bin/chat/chat.cgi?action=chat&id=xufiohwuxeswsymubjbjjwhetdnxkz&pause=
402 22/Jun/05 18:09  /cgi-bin/chat/chat.cgi?action=chat&id=kisawuphyeyvrecfghvopezpgvsfje
402 28/Jun/05 21:21  /cgi-bin/chat/chat.cgi?action=chat&id=gqzsxrksugpmjupmnqwdnaafshvuxa&pause=
401  2/Jun/05 22:11  /cgi-bin/chat/chat.cgi?action=chat&id=ianfuvfjddunxgwymuupamgcpdkkmi&pause=
400 20/Jun/05 20:41  /cgi-bin/chat/chat.cgi?action=chat&id=kxudpjkctjixcjqhvfjbnwdxfyavrm&pause=
398 24/Jun/05 21:16  /cgi-bin/chat/chat.cgi?action=chat&id=rnzoaddfwlharsolugidevhcsgedur&pause=
397  2/Jun/05 21:16  /cgi-bin/chat/chat.cgi?action=chat&id=ooecfqbbqzsosssxganhxvxorgpuvh
396 28/Jun/05 18:58  /cgi-bin/chat/chat.cgi?action=chat&id=skfrmrgiqzyogdzmjyhkeneunrskor
395 18/Jun/05 06:41  /cgi-bin/chat/chat.cgi?action=chat&id=monfkovccplwvxnvrewckbgmolluae&pause=
395 27/Jun/05 19:49  /cgi-bin/chat/chat.cgi?action=chat&id=gpssncbyzivgulvcbudtjrzlmpynci
394 14/Jun/05 21:13  /cgi-bin/chat/chat.cgi?action=chat&id=yeglfzzjjrolbshpebojxqyretpifr&pause=
391 21/Jun/05 22:35  /cgi-bin/chat/chat.cgi?action=chat&id=ljnlmmvnqsmrklzmxegawsxdnrjexe
391 19/Jun/05 20:34  /cgi-bin/chat/chat.cgi?action=chat&id=ovcbxllwxcuqlkgsmwcinsspnuetyt&pause=
388 17/Jun/05 21:51  /cgi-bin/chat/chat.cgi?action=chat&id=xkjzvpokerodqpizrldxghoczqmzvu
386 10/Jun/05 18:52  /cgi-bin/chat/chat.cgi?action=chat&id=mlmpqkvwwcihkkzydoxsntsycjbffe
386 28/Jun/05 15:59  /cgi-bin/chat/chat.cgi?action=chat&id=qkijkwwihssavdqhrppomhvkfgfouj
385 22/Jun/05 19:02  /cgi-bin/chat/chat.cgi?action=chat&id=ufdnwzhtiaqzfchusyqlerkwgumvwd
385 16/Jun/05 20:41  /cgi-bin/chat/chat.cgi?action=chat&id=wwaamlpidjcrqxatbgxogixkjawzae&pause=
383 14/Jun/05 15:29  /cgi-bin/chat/chat.cgi?action=chat&id=hsqkdkgfqztnjrzgmbjejwsycfqqzn&pause=
382 10/Jun/05 20:23  /cgi-bin/chat/chat.cgi?action=chat&id=yluipzlioihsldcvdnxnqxlsmvbjxy&pause=
376 21/Jun/05 19:51  /cgi-bin/chat/chat.cgi?action=chat&id=ythfvumfgogywuyspbaqhjtuqielqr&pause=
376 12/Jun/05 17:51  /cgi-bin/chat/chat.cgi?action=chat&id=flmbvuzchvluztiywczyapbiklapfd
374  2/Jun/05 20:53  /cgi-bin/chat/chat.cgi?action=chat&id=axbcnegqehrnzzksxcnkqeazjpfkle&pause=
373  9/Jun/05 21:25  /cgi-bin/chat/chat.cgi?action=chat&id=rvcgcfohvabelqqxtrggsgatlranqq&pause=
372  2/Jun/05 19:15  /cgi-bin/chat/chat.cgi?action=chat&id=wtobgzvrnlegcdloabupiyqbcvtgwc&pause=
369 24/Jun/05 19:50  /cgi-bin/chat/chat.cgi?action=chat&id=zsrjvsxkxaektbxmqubetfgcusabqp&pause=
368 18/Jun/05 21:19  /cgi-bin/chat/chat.cgi?action=chat&id=cxfzaxjrgzimzzfxprnhaealmiqyib&pause=
367 11/Jun/05 21:39  /cgi-bin/chat/chat.cgi?action=chat&id=ezbpfqfebimalysycnwqmsbpvygivy&pause=
367 21/Jun/05 19:06  /cgi-bin/chat/chat.cgi?action=chat&id=utgcdddcujcuvfottxckqgvuroziwm&pause=
363 14/Jun/05 15:29  /cgi-bin/chat/chat.cgi?action=chat&id=incghuowhjzulkmufvpzqaubwcbghf&pause=
362  2/Jun/05 20:20  /cgi-bin/chat/chat.cgi?action=chat&id=okkzocxbjtxamydplqhhrnuxacdmwk&pause=
361 12/Jun/05 20:50  /cgi-bin/chat/chat.cgi?action=chat&id=nqxzsiyfcwkvlspwlssscnpbpqgoyl&pause=
359  3/Jun/05 19:50  /cgi-bin/chat/chat.cgi?action=chat&id=yyiqnkawhmohkmpznauhpqizmhjxqk&pause=
358  1/Jun/05 09:26  /cgi-bin/chat/chat.cgi?action=chat&id=vftciumfhqgutgdzjjztnoqeraobyb&pause=
358 14/Jun/05 20:03  /cgi-bin/chat/chat.cgi?action=chat&id=ghfqlfiwblvvzyomhmzrzsownellif
357 17/Jun/05 16:48  /cgi-bin/chat/chat.cgi?action=chat&id=ajohbusnmshquxcupobjanquntvfcu
354 27/Jun/05 20:22  /cgi-bin/chat/chat.cgi?action=chat&id=eoivtqtxbcsadlrdbbclbfshgpprxv&pause=
352 24/Jun/05 19:58  /cgi-bin/chat/chat.cgi?action=chat&id=xwjekxdihxncwsxxoddjvbqwszdxsi&pause=
350 22/Jun/05 21:12  /cgi-bin/chat/chat.cgi?action=chat&id=vsylkpbqvdvgwiqibnqsfrzwlglqxm
350 25/Jun/05 20:31  /cgi-bin/chat/chat.cgi?action=chat&id=dwqhdlbrydouwwxtisurkxkxtxmpjn&pause=
348 26/Jun/05 19:13  /cgi-bin/chat/chat.cgi?action=chat&id=kzmmkuxvjtxcucchbbtlrosclarixu
344 17/Jun/05 21:56  /cgi-bin/chat/chat.cgi?action=chat&id=esyttzfuexnvbwwtjhqsepkjxkqtdy
343  6/Jun/05 20:49  /cgi-bin/chat/chat.cgi?action=chat&id=navietqzxoajtnqrgtqajqwmhysaoi&pause=
343  5/Jun/05 19:09  /cgi-bin/chat/chat.cgi?action=chat&id=gijkxoftpnzgyxvhaanzywsgewbboc
343 13/Jun/05 20:50  /cgi-bin/chat/chat.cgi?action=chat&id=gwptvulqmjgjcbzrjmsltqeenwdgoi&pause=
342 12/Jun/05 19:57  /cgi-bin/chat/chat.cgi?action=chat&id=zqtrhrbpdghuwnkvowwriuscmkurol
341  3/Jun/05 19:50  /cgi-bin/chat/chat.cgi?action=chat&id=sxtuyuwzfmbrfjlvshqcfeygvjholo
341 23/Jun/05 19:54  /cgi-bin/chat/chat.cgi?action=chat&id=ypywvvtmvqrydmsxbvahtemjfjmgoj&pause=
340 27/Jun/05 19:42  /cgi-bin/chat/chat.cgi?action=chat&id=ktfdefmtclarooejcibmkiywqmxxfv&pause=
340 22/Jun/05 19:42  /cgi-bin/chat/chat.cgi?action=chat&id=sguvzwtvuffmtmgqlqysivavzsodhq&pause=
339  9/Jun/05 20:30  /cgi-bin/chat/chat.cgi?action=chat&id=cgjsezvwodurglrixizoyuqedqybff&pause=
339  5/Jun/05 20:15  /cgi-bin/chat/chat.cgi?action=chat&id=uktqdzyxnlseugnwbggryzwztdedxr&pause=
334  1/Jun/05 19:25  /cgi-bin/chat/chat.cgi?action=chat&id=nfcfmgfbxtoiodqgnjqyinamlpmksa&pause=
332  7/Jun/05 21:11  /cgi-bin/chat/chat.cgi?action=chat&id=pcpvuepbkimozfsymmmcfqcgvongzy
332 21/Jun/05 19:44  /cgi-bin/chat/chat.cgi?action=chat&id=yixwjpyaruwnnscdyhoroeerrvcrpb
332  9/Jun/05 18:21  /cgi-bin/chat/chat.cgi?action=chat&id=raaoddzwqgtqxjfljxmicxungiozjy&pause=
331  3/Jun/05 17:39  /cgi-bin/chat/chat.cgi?action=chat&id=ipkprzuaclzijlgesrzyufznnqamse
330 17/Jun/05 20:39  /cgi-bin/chat/chat.cgi?action=chat&id=jxgntdljysxajfcjkttbmzptkdlqed&pause=
326 26/Jun/05 20:27  /cgi-bin/chat/chat.cgi?action=chat&id=spdeelesgswoxqoeqytdtseopipgjc
323 19/Jun/05 20:34  /cgi-bin/chat/chat.cgi?action=chat&id=ylrfxmdflilykgwigyqeoermwdakoe&pause=
322 24/Jun/05 19:37  /cgi-bin/chat/chat.cgi?action=chat&id=lboahglpfofhqrxhrunlnvlesuiytr&pause=
322 17/Jun/05 17:21  /cgi-bin/chat/chat.cgi?action=chat&id=clkvowtgiywejlzqpzkmliwxhhstmo
317 12/Jun/05 17:31  /cgi-bin/chat/chat.cgi?action=chat&id=pbwkjemvzamphqsupcldqfavyxxijz&pause=
317 26/Jun/05 19:38  /cgi-bin/chat/chat.cgi?action=chat&id=pouvuzzcdskxzvkfbnzlfpruxapxnl&pause=
317 21/Jun/05 20:15  /cgi-bin/chat/chat.cgi?action=chat&id=htkdpygxsacvtztfjacmwglzrxqotz&pause=
316 12/Jun/05 00:09  /cgi-bin/chat/chat.cgi?action=chat&id=oxgglkjudqfsphvsuvqcmenkbgrsoe&pause=
315 29/Jun/05 19:40  /cgi-bin/chat/chat.cgi?action=chat&id=jnsjywvbwccipltjfyblhccyakihfc
315 24/Jun/05 22:25  /cgi-bin/chat/chat.cgi?action=chat&id=ufspzacpohghgjpfxwzodppwufxhbc&pause=
314  3/Jun/05 17:11  /cgi-bin/chat/chat.cgi?action=chat&id=aelifwkuuvkciwfwpdyswqlskfuijk
313 13/Jun/05 19:18  /cgi-bin/chat/chat.cgi?action=chat&id=ziimnmfkhrkgemriskuxwdcyywtgal&pause=
313 29/Jun/05 20:00  /cgi-bin/chat/chat.cgi?action=chat&id=gkbcvllyseufxxizbacvkfqpwvofoh
312 16/Jun/05 20:11  /cgi-bin/chat/chat.cgi?action=chat&id=heyupzpeqpbpugjrfupohibzjnivlq&pause=
311 20/Jun/05 18:22  /cgi-bin/chat/chat.cgi?action=chat&id=fguvressvevjsgkxbafnrdcagzlwcz&pause=
311 12/Jun/05 19:03  /cgi-bin/chat/chat.cgi?action=chat&id=zfigpebyybuufylvuvttvhlhqmysyg&pause=
308 22/Jun/05 18:46  /cgi-bin/chat/chat.cgi?action=chat&id=vjccpmbsmspxekwpjtwwnpynswkxvp
308 12/Jun/05 20:54  /cgi-bin/chat/chat.cgi?action=chat&id=sqevkkipkxzdmzdxnfpxrhcgerbyso&pause=
307 14/Jun/05 20:17  /cgi-bin/chat/chat.cgi?action=chat&id=gzbflkaawyiundajhzncxibcpoveda&pause=
305 26/Jun/05 19:25  /cgi-bin/chat/chat.cgi?action=chat&id=spdeelesgswoxqoeqytdtseopipgjc&pause=
305 20/Jun/05 20:15  /cgi-bin/chat/chat.cgi?action=chat&id=uplyqlozattjpxorbytfvxzdfkqbxq&pause=
305 29/Jun/05 19:45  /cgi-bin/chat/chat.cgi?action=chat&id=wmkwggdgvvfpxkicbhetsuvklwtegf&pause=
305 18/Jun/05 19:51  /cgi-bin/chat/chat.cgi?action=chat&id=nwcqobonbdunszaqpyhhotyfsnuxht&pause=
304 12/Jun/05 19:44  /cgi-bin/chat/chat.cgi?action=chat&id=quwjcpqzlqwtqiluawnpiqadaxzvcd
302  1/Jun/05 19:56  /cgi-bin/chat/chat.cgi?action=chat&id=vulglgovnvgthstrogfaaykzisawwf&pause=
301 10/Jun/05 21:20  /cgi-bin/chat/chat.cgi?action=chat&id=ctvxkmcaimhkynjvzjixrrsyaddqmi&pause=
301  2/Jun/05 12:52  /cgi-bin/chat/chat.cgi?action=chat&id=vpgbxtwuavadobrmllvieslkqynjtq
300  2/Jun/05 10:56  /cgi-bin/chat/chat.cgi?action=chat&id=femgzgzijpewgzsfyasewqlrorbudg&pause=
300 17/Jun/05 19:26  /cgi-bin/chat/chat.cgi?action=chat&id=fieoscfzjdxpupzwbtdrxalczjkxsb&pause=
299 29/Jun/05 20:08  /cgi-bin/chat/chat.cgi?action=chat&id=vzexuofmnatlphvdppgdvbqaqchktr&pause=
299 21/Jun/05 20:53  /cgi-bin/chat/chat.cgi?action=chat&id=fgpjtckljawyeisrocngqdfbzcklbv
297  6/Jun/05 20:30  /cgi-bin/chat/chat.cgi?action=chat&id=feadjrcyeganyflcmgmgufjekqwnab&pause=
296 25/Jun/05 09:14  /cgi-bin/chat/chat.cgi?action=chat&id=hrsanvtzyaimbxoxoaajppcdxfgmrk&pause=
293 19/Jun/05 20:22  /cgi-bin/chat/chat.cgi?action=chat&id=dtkbqbufoyuqccmfcnmecpcdvyqtxl
292 18/Jun/05 19:07  /cgi-bin/chat/chat.cgi?action=chat&id=pcgjdvksagghwjkwydugngbswxkwso&pause=
289 28/Jun/05 20:02  /cgi-bin/chat/chat.cgi?action=chat&id=zxngvdrubzduxjtlunstzcdsnpxlow&pause=
288  1/Jun/05 20:44  /cgi-bin/chat/chat.cgi?action=chat&id=jtypjkmqaumhxkuaptusimdcubcelj&pause=
287 14/Jun/05 21:18  /cgi-bin/chat/chat.cgi?action=chat&id=fvjeaexmgcdmwsvkdjmqpvkodwyvkl
287 26/Jun/05 18:35  /cgi-bin/chat/chat.cgi?action=chat&id=lxwjgbhhgfsacxuofyjgnqeqlrqkje
286 23/Jun/05 20:20  /cgi-bin/chat/chat.cgi?action=chat&id=ipptqehezkglnbrijsemklwbsurzrk&pause=
285 17/Jun/05 19:17  /cgi-bin/chat/chat.cgi?action=chat&id=yfgcyjclckmctdelbnsasmdkpobvow
285 11/Jun/05 20:03  /cgi-bin/chat/chat.cgi?action=chat&id=gkkiwvnkbhrfphbmccdlkdpiyfvvwk&pause=
283 12/Jun/05 19:45  /cgi-bin/chat/chat.cgi?action=chat&id=decpaeqrvsqlbubzhtsunujnlxwbrk&pause=
283 16/Jun/05 20:02  /cgi-bin/chat/chat.cgi?action=chat&id=xolldhmjfrafoplxcazjlwrlhwfxih&pause=
282 24/Jun/05 22:52  /cgi-bin/chat/chat.cgi?action=chat&id=zcjpoaqtjtodwpjlamdforlacbybmt&pause=
282 27/Jun/05 19:52  /cgi-bin/chat/chat.cgi?action=chat&id=mrzajtldhjijpuooqbprigyurnmjqd&pause=
280 21/Jun/05 18:39  /cgi-bin/chat/chat.cgi?action=chat&id=uqeiddbkwuelhcpnbmmoqfrxhrzdvs&pause=
279 14/Jun/05 21:43  /cgi-bin/chat/chat.cgi?action=chat&id=tcerigrpuuycyjkwkbhmqdzdnspooa
278  4/Jun/05 21:25  /cgi-bin/chat/chat.cgi?action=chat&id=ouzptouzdktaxfdbcuubzbuorhytlt
275  7/Jun/05 21:12  /cgi-bin/chat/chat.cgi?action=chat&id=skfhfiynzrrrybmfnauyeduorbtqjw&pause=
274 13/Jun/05 21:03  /cgi-bin/chat/chat.cgi?action=chat&id=jarbemxxifkraqexntuprwghxvbagf&pause=
272  7/Jun/05 19:14  /cgi-bin/chat/chat.cgi?action=chat&id=stagtsaifmqpncqqfoeektgpuwldec
272 25/Jun/05 20:09  /cgi-bin/chat/chat.cgi?action=chat&id=slinadiqvnncomcrjtguhodirunnjk&pause=
269  1/Jun/05 18:50  /cgi-bin/chat/chat.cgi?action=chat&id=dmthafacgpmeqihmkpaswblksgodrq
268 24/Jun/05 22:52  /cgi-bin/chat/chat.cgi?action=chat&id=nhhvssqzzxghtwytuwwrgfspammadc&pause=
267 28/Jun/05 21:48  /cgi-bin/chat/chat.cgi?action=chat&id=yrucocyfjozvxgntparzjxvfknwbem&pause=
267  6/Jun/05 19:44  /cgi-bin/chat/chat.cgi?action=chat&id=rfedhuytnpcekuxbexjtwqhyofvkcx&pause=
267 12/Jun/05 17:38  /cgi-bin/chat/chat.cgi?action=chat&id=nqgegijofmywrsgktcwsqsjaozlshk&pause=
267 25/Jun/05 17:05  /cgi-bin/chat/chat.cgi?action=chat&id=bmfykrbdqcgtxtsdhoydxajyfeyxhr&pause=
265 26/Jun/05 00:08  /cgi-bin/chat/chat.cgi?action=chat&id=vvesbhtfiojjwdfsljixdrjbonnqlo&pause=
264 20/Jun/05 18:35  /cgi-bin/chat/chat.cgi?action=chat&id=nhjmoiqgfjneuanoopwhftzinuhyok&pause=
264 24/Jun/05 21:34  /cgi-bin/chat/chat.cgi?action=chat&id=ukwujveslyzjmxtchhalbeqnnxrbyh&pause=
263 21/Jun/05 17:50  /cgi-bin/chat/chat.cgi?action=chat&id=ynozdmjtlggcsfojnphgreineedvoj
262 17/Jun/05 14:22  /cgi-bin/chat/chat.cgi?action=chat&id=ghunppinateljtsnprqiifxgcweizv
261 24/Jun/05 23:22  /cgi-bin/chat/chat.cgi?action=chat&id=cyerfpxauejjyqdzerrvplykrbhqug&pause=
259  8/Jun/05 19:26  /cgi-bin/chat/chat.cgi?action=chat&id=uuqhbwlyatfjmbulutclfxckwvqbxr&pause=
258 16/Jun/05 21:31  /cgi-bin/chat/chat.cgi?action=chat&id=rveyptxqalpwcovtceidcbnhvuowcr&pause=
257  7/Jun/05 21:41  /cgi-bin/chat/chat.cgi?action=chat&id=llihxvtvejpbvixzjwvbvcwgmjstrw&pause=
255 26/Jun/05 19:14  /cgi-bin/chat/chat.cgi?action=chat&id=uamhtlxpsnndalggaoydfckjpkryyg
253 15/Jun/05 20:03  /cgi-bin/chat/chat.cgi?action=chat&id=zusgffkmipbzbvzrzhmjuxhlrmubnv&pause=
251 25/Jun/05 19:53  /cgi-bin/chat/chat.cgi?action=chat&id=ohexdkzfzjunfzzhqpfxmnstgvqugl
250 11/Jun/05 16:42  /cgi-bin/chat/chat.cgi?action=chat&id=wfzuofxkdoowoxlwyfktpgxdzzbcks&pause=
249 26/Jun/05 21:09  /cgi-bin/chat/chat.cgi?action=chat&id=fbjsdcptyoltotneoknrvkkxpfwsir
249 15/Jun/05 21:06  /cgi-bin/chat/chat.cgi?action=chat&id=cwrpvgjnhnvwdzcbgynrovntbmgdeh
247 21/Jun/05 19:48  /cgi-bin/chat/chat.cgi?action=chat&id=tfxcmbqlcwusxpyrbcbxfpqctajauh&pause=
246 15/Jun/05 22:00  /cgi-bin/chat/chat.cgi?action=chat&id=aawmmpuoxgmxcyyzrtjfnfbwfvvbbl&pause=
244 29/Jun/05 21:15  /cgi-bin/chat/chat.cgi?action=chat&id=nmftvcncjvldgejnjbeyqjtbiqpclw
240 16/Jun/05 17:02  /cgi-bin/chat/chat.cgi?action=chat&id=vekcihwnxkakvtapporhizrmofcmzx&pause=
239 26/Jun/05 14:46  /cgi-bin/chat/chat.cgi?action=chat&id=rgblxtpynkkjqfdlqqexqwgxrmdtuy&pause=
237 25/Jun/05 16:49  /cgi-bin/chat/chat.cgi?action=chat&id=bbpzmhxcjwdtbawgexaaxrlwwxqnby
237  6/Jun/05 20:44  /cgi-bin/chat/chat.cgi?action=chat&id=fmfejcvrqmowyrqtlkplhfwejtdzez&pause=
234 25/Jun/05 22:07  /cgi-bin/chat/chat.cgi?action=chat&id=tpjqnvhxcdwawtqpcfeygweobcfgzx&pause=
234 16/Jun/05 20:15  /cgi-bin/chat/chat.cgi?action=chat&id=qihrcoxuzhdhowultxcutimmtbeuiu&pause=
233 12/Jun/05 19:39  /cgi-bin/chat/chat.cgi?action=chat&id=tazhuisksjvoldlekmdkxquqhggrel
233 22/Jun/05 17:38  /cgi-bin/chat/chat.cgi?action=chat&id=vobeohjttngmfxqzzqphpzendbjbpb&pause=
232 29/Jun/05 20:49  /cgi-bin/chat/chat.cgi?action=chat&id=vyyqycijdalxmyxqknyfhgrtozxsod
232 21/Jun/05 17:07  /cgi-bin/chat/chat.cgi?action=chat&id=csavazejikwupjrjfortsxfcnezpzq&pause=
231 14/Jun/05 21:20  /cgi-bin/chat/chat.cgi?action=chat&id=qkvvqthsydbwzhxfafakbvzastikzg&pause=
230 29/Jun/05 20:24  /cgi-bin/chat/chat.cgi?action=chat&id=slthzdyxolxqhnqseqbjrpwzonntfg
229  7/Jun/05 20:32  /cgi-bin/chat/chat.cgi?action=chat&id=pcpvuepbkimozfsymmmcfqcgvongzy&pause=
229 20/Jun/05 18:12  /cgi-bin/chat/chat.cgi?action=chat&id=kxcczbjbzwlmuzthhjoarknthzewci&pause=
228 17/Jun/05 13:52  /cgi-bin/chat/chat.cgi?action=chat&id=ovadgoxkmzxhthinboieyuanlcjhrz
228 23/Jun/05 21:14  /cgi-bin/chat/chat.cgi?action=chat&id=jbqwavbamsifwcksxxjddraxgxefsj
227  1/Jun/05 18:27  /cgi-bin/chat/chat.cgi?action=chat&id=efvkxmlfhqzrxlqmdchiqqenvucnbk
225 25/Jun/05 20:49  /cgi-bin/chat/chat.cgi?action=chat&id=dyktathcmqermfvqumowvjybuablny&pause=
224  6/Jun/05 17:53  /cgi-bin/chat/chat.cgi?action=chat&id=ikgkiyqokaciurwzkiqqdweotileml
224  5/Jun/05 20:50  /cgi-bin/chat/chat.cgi?action=chat&id=kwiamwldjqpoaqojqvqwvgqhonneuk&pause=
218 28/Jun/05 16:30  /cgi-bin/chat/chat.cgi?action=chat&id=mraclwcgzzwoefrczwwumjuwxxfjnf
217 25/Jun/05 16:41  /cgi-bin/chat/chat.cgi?action=chat&id=lkujxjdtdzmzkfggmzrhghzoimlddr&pause=
216 21/Jun/05 21:02  /cgi-bin/chat/chat.cgi?action=chat&id=lqfjcxdfdpymmsymjkmastebhxmctl&pause=
216 26/Jun/05 21:01  /cgi-bin/chat/chat.cgi?action=chat&id=pkitkslkjppxnjohdhcwgcxoigfhyz&pause=
216  7/Jun/05 19:49  /cgi-bin/chat/chat.cgi?action=chat&id=wivxxfhhialwoduwyjhfleythafdlk&pause=
215  3/Jun/05 21:29  /cgi-bin/chat/chat.cgi?action=chat&id=jhruuuloxfscmqqpkjphnndrychliz
215 16/Jun/05 20:12  /cgi-bin/chat/chat.cgi?action=chat&id=cebiylbhtpcmppofmeoovrxijylwpv&pause=
214 22/Jun/05 17:47  /cgi-bin/chat/chat.cgi?action=chat&id=inwynbyroempqyeckzemahnvypszoz&pause=
214  4/Jun/05 19:42  /cgi-bin/chat/chat.cgi?action=chat&id=yvpmbdjiointthtufixarmkiquoovi
214  6/Jun/05 17:36  /cgi-bin/chat/chat.cgi?action=chat&id=hyjmwoxybdonqgjlxgoqmvuxrzjdbr
213 12/Jun/05 22:06  /cgi-bin/chat/chat.cgi?action=chat&id=pffobbnugvzcktpokppaphfdjtijvn
213 11/Jun/05 15:49  /cgi-bin/chat/chat.cgi?action=chat&id=tdtyqfcynqgnnaowzamupycgiuovgb&pause=
213 29/Jun/05 19:17  /cgi-bin/chat/chat.cgi?action=chat&id=vzexuofmnatlphvdppgdvbqaqchktr
212 11/Jun/05 16:05  /cgi-bin/chat/chat.cgi?action=chat&id=hihulualwwusuteaswkdqmqiwjxwxj
212  2/Jun/05 16:42  /cgi-bin/chat/chat.cgi?action=chat&id=ionsmvewiznthlgvdpqojtjoqvlvnp
211  1/Jun/05 19:59  /cgi-bin/chat/chat.cgi?action=chat&id=ngbdkakghpdhpaqglewtdhnsaygctv&pause=
211  7/Jun/05 19:21  /cgi-bin/chat/chat.cgi?action=chat&id=ekeghvvvhzaqnudewoomsxnzxolmue&pause=
210 11/Jun/05 16:56  /cgi-bin/chat/chat.cgi?action=chat&id=wryrjeiczvaecibcafuwzzimvcumhi
210 12/Jun/05 19:39  /cgi-bin/chat/chat.cgi?action=chat&id=terblmyeeiicfvxtmxmrnydpysznfe&pause=
207 19/Jun/05 19:42  /cgi-bin/chat/chat.cgi?action=chat&id=pvbddiefqdipqvmwvjefvjkuzfkanp&pause=
206 25/Jun/05 21:11  /cgi-bin/chat/chat.cgi?action=chat&id=dyktathcmqermfvqumowvjybuablny
205 15/Jun/05 21:03  /cgi-bin/chat/chat.cgi?action=chat&id=gtauhqpjlvgpnxfltjuyxmsjdbtmsw
204 23/Jun/05 15:54  /cgi-bin/chat/chat.cgi?action=chat&id=nstjitajdquqjvxdrwxufeblveqpwv&pause=
203 20/Jun/05 17:52  /cgi-bin/chat/chat.cgi?action=chat&id=ghgwlummbtdxxzlyxktejjqdclrqth&pause=
202 27/Jun/05 19:56  /cgi-bin/chat/chat.cgi?action=chat&id=usrnwwnxyacdrjphexqyasrlogxwmu&pause=
202 26/Jun/05 19:06  /cgi-bin/chat/chat.cgi?action=chat&id=zrkniskoanhrgkqzradaqibqpsvzcz&pause=
202  3/Jun/05 19:40  /cgi-bin/chat/chat.cgi?action=chat&id=vckpiwjtbrdcfgubjaeeuzxbrupiuj&pause=
202 12/Jun/05 17:32  /cgi-bin/chat/chat.cgi?action=chat&id=kymmlhkejkcvteptqeefdxskzyatkw
199 20/Jun/05 19:41  /cgi-bin/chat/chat.cgi?action=chat&id=nfsbvbwpldiyyqqdkwcgvirwzvzecf
198 17/Jun/05 20:28  /cgi-bin/chat/chat.cgi?action=chat&id=mhjavcgbvpnptzjtjnjusarlabamdj&pause=
198  1/Jun/05 18:40  /cgi-bin/chat/chat.cgi?action=chat&id=iwhbqmhthbzukfrenegkpyfkdwdzcc&pause=
198 28/Jun/05 20:12  /cgi-bin/chat/chat.cgi?action=chat&id=rpthrfinonowxxmgfqubcsfakcntqh&pause=
197 13/Jun/05 19:13  /cgi-bin/chat/chat.cgi?action=chat&id=ijedcgbsafozmutizewbktvquttgdv&pause=
197  5/Jun/05 21:11  /cgi-bin/chat/chat.cgi?action=chat&id=tltbylockymknyrfrvxgsykyaupcct&pause=
197 29/Jun/05 18:19  /cgi-bin/chat/chat.cgi?action=chat&id=qpyqueiqclghmkvhwxymhbbbemcwxx&pause=
195  4/Jun/05 21:21  /cgi-bin/chat/chat.cgi?action=chat&id=dxiytkqixwzmokyzrrulntdpdcswff&pause=
194  1/Jun/05 13:43  /cgi-bin/chat/chat.cgi?action=chat&id=qsogstcxfltphhhsnlmrwldmsomdfk&pause=
194 19/Jun/05 19:57  /cgi-bin/chat/chat.cgi?action=chat&id=reucwsovnrrgusizvzfkpcmxjnoqkz&pause=
193 18/Jun/05 18:40  /cgi-bin/chat/chat.cgi?action=chat&id=pepargtypxxnvlxvxxbtazyvtscmcz&pause=
193 18/Jun/05 21:33  /cgi-bin/chat/chat.cgi?action=chat&id=ovciegtajpguzqyyrqsuvrmtzoukrt&pause=
192 13/Jun/05 18:46  /cgi-bin/chat/chat.cgi?action=chat&id=mjgzsheqfwthsrqlomqllvsdaipoqp&pause=
192 29/Jun/05 19:43  /cgi-bin/chat/chat.cgi?action=chat&id=krfobwvpixynntiaakfjklphlrests&pause=
191 13/Jun/05 19:16  /cgi-bin/chat/chat.cgi?action=chat&id=ivcptcdhynialrtufymfmrswsadmpb&pause=
189 27/Jun/05 13:38  /cgi-bin/chat/chat.cgi?action=chat&id=xxwvryfydoduvjkrvpnchmsxqboyyz&pause=
188 26/Jun/05 00:09  /cgi-bin/chat/chat.cgi?action=chat&id=wwuckaekhnlrnuikexmodzawoldixb&pause=
185 17/Jun/05 18:38  /cgi-bin/chat/chat.cgi?action=chat&id=jlnfzlzownewueczbyodyzxajuvsbl&pause=
182 10/Jun/05 22:02  /cgi-bin/chat/chat.cgi?action=chat&id=tcbmosywhvbadctmnnzbmyrzixkkig&pause=
181 28/Jun/05 20:21  /cgi-bin/chat/chat.cgi?action=chat&id=cncxkjghmdiqqxqysyfvuqadqbkovw
181  1/Jun/05 21:12  /cgi-bin/chat/chat.cgi?action=chat&id=cvjzjevjxhavksloytyrdkhycwpqqs
179 21/Jun/05 21:10  /cgi-bin/chat/chat.cgi?action=chat&id=deyasvjfigyvuckqbojwujrgohbyue&pause=
179 10/Jun/05 20:20  /cgi-bin/chat/chat.cgi?action=chat&id=myueukrghehzbnpkelpxanhxvmuzla
178 27/Jun/05 13:36  /cgi-bin/chat/chat.cgi?action=chat&id=qbkdwlbskwnkulvscxgyntkqpssujg
178  6/Jun/05 17:09  /cgi-bin/chat/chat.cgi?action=chat&id=ikgkiyqokaciurwzkiqqdweotileml&pause=
178 16/Jun/05 16:49  /cgi-bin/chat/chat.cgi?action=chat&id=mmtkhgryompxmntzcqdikoxwxpunwy
177 24/Jun/05 21:30  /cgi-bin/chat/chat.cgi?action=chat&id=ifoelssgjfueyhevdpjggqnpxdaebj&pause=
176 13/Jun/05 18:34  /cgi-bin/chat/chat.cgi?action=chat&id=tdqzwstmlszlphbognmrduercyimkz&pause=
174  2/Jun/05 17:00  /cgi-bin/chat/chat.cgi?action=chat&id=iiwsnlsmkqlavitqtqjgmxfbiipgse
173  8/Jun/05 20:23  /cgi-bin/chat/chat.cgi?action=chat&id=gochhnlojafocjknskorohxkuqufus&pause=
172 23/Jun/05 21:15  /cgi-bin/chat/chat.cgi?action=chat&id=rsljhptypsksvyyyvsjeuxewwwwtmh&pause=
172  7/Jun/05 22:56  /cgi-bin/chat/chat.cgi?action=chat&id=dbolpokhfvpqwdgepvkexjwpetakvo
172  1/Jun/05 15:31  /cgi-bin/chat/chat.cgi?action=chat&id=bqufgfjnbturejjgmozpmghvokkfrq&pause=
171  6/Jun/05 17:37  /cgi-bin/chat/chat.cgi?action=chat&id=wpccqkqfeuktzsfoyzoeyqrawgmkud
171  3/Jun/05 21:25  /cgi-bin/chat/chat.cgi?action=chat&id=jldpdszldljtgidszrmbartgxcnskh
171  1/Jun/05 18:47  /cgi-bin/chat/chat.cgi?action=chat&id=iodziwoxpxsbzmttaewaislsxydqus
169 11/Jun/05 16:33  /cgi-bin/chat/chat.cgi?action=chat&id=fpjnxaqjlqfshynnjadturqmymvhkd
169 17/Jun/05 20:34  /cgi-bin/chat/chat.cgi?action=chat&id=ooqfgidwgiomjdsvmuqxrngjvglgzt&pause=
167 28/Jun/05 17:53  /cgi-bin/chat/chat.cgi?action=chat&id=nnwxusouxngmwvvlifmyvtoowypbbe
167 11/Jun/05 18:47  /cgi-bin/chat/chat.cgi?action=chat&id=ymbfkhkpdjzxcqirknrhifbadiqlsv&pause=
167 24/Jun/05 21:30  /cgi-bin/chat/chat.cgi?action=chat&id=mabkhtdaonvujvemffrktcjpmgmdvt
167 28/Jun/05 17:50  /cgi-bin/chat/chat.cgi?action=chat&id=onqhqilboizgqnqmqyojgzrawkfixc&pause=
166 27/Jun/05 20:41  /cgi-bin/chat/chat.cgi?action=chat&id=rdfxzzuajlbtbnfubcjbttxzsdwini&pause=
166 22/Jun/05 19:47  /cgi-bin/chat/chat.cgi?action=chat&id=gpuswzgroetwpolzzojoiswscicogf&pause=
166 23/Jun/05 20:18  /cgi-bin/chat/chat.cgi?action=chat&id=mbuujqsmgmijvbmfbzpektettuzflv&pause=
166 28/Jun/05 19:19  /cgi-bin/chat/chat.cgi?action=chat&id=vvrngekxvlujfpedhdnexvcyicxhla
166 16/Jun/05 20:26  /cgi-bin/chat/chat.cgi?action=chat&id=emfwhiuglmruigwbmicfwekebsyafn
165 11/Jun/05 21:08  /cgi-bin/chat/chat.cgi?action=chat&id=ignjajauxjwuxxuhwoyrutchvbgbbb&pause=
165  1/Jun/05 20:56  /cgi-bin/chat/chat.cgi?action=chat&id=cvjzjevjxhavksloytyrdkhycwpqqs&pause=
165 23/Jun/05 20:33  /cgi-bin/chat/chat.cgi?action=chat&id=xiqsrjmjvqdhraldhyewmrttkgyste
164 20/Jun/05 19:45  /cgi-bin/chat/chat.cgi?action=chat&id=ozmwpcbulescivhnonqjsynrflwdra
163  2/Jun/05 15:18  /cgi-bin/chat/chat.cgi?action=chat&id=vuhkvhcbnajihfsiicgmufrmlhzznd&pause=
162 27/Jun/05 19:29  /cgi-bin/chat/chat.cgi?action=chat&id=vzrefsikxirboapcirporfirceevao
161 18/Jun/05 19:42  /cgi-bin/chat/chat.cgi?action=chat&id=ixzqfzxpmrdrztwtgcwelkuuzxguvt&pause=
161 16/Jun/05 19:06  /cgi-bin/chat/chat.cgi?action=chat&id=tnljyqkvarnzkgygfxnhaycysngoyn
161 29/Jun/05 20:22  /cgi-bin/chat/chat.cgi?action=chat&id=vyyqycijdalxmyxqknyfhgrtozxsod&pause=
160  2/Jun/05 11:47  /cgi-bin/chat/chat.cgi?action=chat&id=fcocbrhznmfbiimwtobuwhsaznqzig&pause=
160  3/Jun/05 19:37  /cgi-bin/chat/chat.cgi?action=chat&id=qopmmcsadxadmxkowiyyeaqywhcyyc
159  2/Jun/05 11:47  /cgi-bin/chat/chat.cgi?action=chat&id=pwvmifayajhlejlkmnkxxqhgdjvxjn&pause=
159 28/Jun/05 18:56  /cgi-bin/chat/chat.cgi?action=chat&id=xweyqmbvmaurywevnlqdzmvbkcdnay
159 24/Jun/05 23:13  /cgi-bin/chat/chat.cgi?action=chat&id=shugqbrierkrqdgzymoghqdyhkpdhf&pause=
158  2/Jun/05 20:53  /cgi-bin/chat/chat.cgi?action=chat&id=dkxrpdwtggvslqommyhywdqyvasoee&pause=
158 19/Jun/05 16:54  /cgi-bin/chat/chat.cgi?action=chat&id=uyapmmatoagurayneqetdtzsdgfvot
158 18/Jun/05 19:22  /cgi-bin/chat/chat.cgi?action=chat&id=rhtjemfmujxbvfmsbbtvrdultwhkhp&pause=
155  3/Jun/05 19:32  /cgi-bin/chat/chat.cgi?action=chat&id=nfgrsmroqxmuatacbcujtxerwglgnr&pause=
155  1/Jun/05 20:19  /cgi-bin/chat/chat.cgi?action=chat&id=txzckumxeijtaijjivknmphbobjjxo
155 28/Jun/05 13:38  /cgi-bin/chat/chat.cgi?action=chat&id=zeekwjovsrucuwpenriiajkolayjtb
155 29/Jun/05 18:59  /cgi-bin/chat/chat.cgi?action=chat&id=jlotixnkvrzuwounjgzxsmkwebfscq
155 28/Jun/05 18:28  /cgi-bin/chat/chat.cgi?action=chat&id=gzmtnjgcypmxblpaclmbcrkdgoysdu&pause=
154  1/Jun/05 23:33  /cgi-bin/chat/chat.cgi?action=chat&id=xiruyoxamyxclibkrkvpbobafeiunf
154 23/Jun/05 15:54  /cgi-bin/chat/chat.cgi?action=chat&id=pfnpsnlpquhiomryguetxiccikkrgf&pause=
152  6/Jun/05 17:52  /cgi-bin/chat/chat.cgi?action=chat&id=qrhvraqdfotgedmctdoffftgqiyouc&pause=
151 26/Jun/05 21:02  /cgi-bin/chat/chat.cgi?action=chat&id=crbutwwtqcambjwdgbapugiietqgre&pause=
148 21/Jun/05 20:11  /cgi-bin/chat/chat.cgi?action=chat&id=tdugwhxjirrhkrninxhkvxnijibtjg
148  5/Jun/05 18:57  /cgi-bin/chat/chat.cgi?action=chat&id=hmndggzoamrylvlhhpumoqityhaejw&pause=
147 26/Jun/05 09:23  /cgi-bin/chat/chat.cgi?action=chat&id=vqhhbohpljlqugguhtcvnwrvndtqmo
147 16/Jun/05 17:43  /cgi-bin/chat/chat.cgi?action=chat&id=afyxysqwmvuykmvhtufqmqkkbxuess&pause=
146 11/Jun/05 19:46  /cgi-bin/chat/chat.cgi?action=chat&id=mlkfrgsmyfvzivyygoqpwkpjwfypwr
146 20/Jun/05 18:25  /cgi-bin/chat/chat.cgi?action=chat&id=mpyxrfrsxexqkbfdcrczfizbvswxfp
145 16/Jun/05 19:46  /cgi-bin/chat/chat.cgi?action=chat&id=qtidmtzrrscvwmmobezujyehviugxn&pause=
145 27/Jun/05 19:40  /cgi-bin/chat/chat.cgi?action=chat&id=rpfnakxhueprgzzwzpoeibrhgunhmc
144  6/Jun/05 16:56  /cgi-bin/chat/chat.cgi?action=chat&id=kmxuwdphdpmfperqziurhcaaqrzbvv
143  1/Jun/05 15:57  /cgi-bin/chat/chat.cgi?action=chat&id=vadbyavadqfmmarejbjrxkopzksyac
143 28/Jun/05 17:46  /cgi-bin/chat/chat.cgi?action=chat&id=osdxjuehjezklojghgigwphgbsepnk&pause=
143 22/Jun/05 19:48  /cgi-bin/chat/chat.cgi?action=chat&id=hbxhjenuqsbmrauygbaigedayjelog
142 11/Jun/05 16:31  /cgi-bin/chat/chat.cgi?action=chat&id=btmpxiwbdtjosfqhaywzcnugfiyivp
142 25/Jun/05 17:53  /cgi-bin/chat/chat.cgi?action=chat&id=hsdjpoomwghopdlhokvpejajhwlxhz
139  5/Jun/05 18:52  /cgi-bin/chat/chat.cgi?action=chat&id=cwaejdwzvupfoeigxgiuttzdkathcr&pause=
138 20/Jun/05 17:48  /cgi-bin/chat/chat.cgi?action=chat&id=eismhnronxdxrjkowiybnwxfkcdusu
137 21/Jun/05 18:42  /cgi-bin/chat/chat.cgi?action=chat&id=sxlwgkuumpsbtmcwuceofwtnqpibdn&pause=
137 11/Jun/05 18:43  /cgi-bin/chat/chat.cgi?action=chat&id=jbpkiutzffgypursbrhxqfjvghustv
136 23/Jun/05 19:56  /cgi-bin/chat/chat.cgi?action=chat&id=hzsklddoypqipuaqzpicgwiwblxhjc&pause=
135 20/Jun/05 18:26  /cgi-bin/chat/chat.cgi?action=chat&id=doohpykfqliqkbwhzzdhxcpbowzltj&pause=
135 11/Jun/05 19:54  /cgi-bin/chat/chat.cgi?action=chat&id=tyudbamxrikyonsqzdvybqtymlhjnm&pause=
135 16/Jun/05 20:03  /cgi-bin/chat/chat.cgi?action=chat&id=kqysuwqlqjfkndphuxxslzoucrmtuo&pause=
134  8/Jun/05 18:40  /cgi-bin/chat/chat.cgi?action=chat&id=iqqhouaiaychpzydhtvwpedchtyokt&pause=
133  4/Jun/05 20:25  /cgi-bin/chat/chat.cgi?action=chat&id=muukfifhnnzfdwxyohcowxxmtlyewv&pause=
133  7/Jun/05 20:32  /cgi-bin/chat/chat.cgi?action=chat&id=lzzvzakqhpaaiaucyrbgrnbxpcignn
133  1/Jun/05 18:28  /cgi-bin/chat/chat.cgi?action=chat&id=efvkxmlfhqzrxlqmdchiqqenvucnbk&pause=
133 13/Jun/05 10:58  /cgi-bin/chat/chat.cgi?action=chat&id=xpdwyjylnwdrlhalqzcizjwskgdulj&pause=
132 10/Jun/05 15:52  /cgi-bin/chat/chat.cgi?action=chat&id=mipnkskdjwgjxnvfzjdirypthahlyp
132 10/Jun/05 12:18  /cgi-bin/chat/chat.cgi?action=chat&id=hbitglhgaqaiwobxiwjamuvfkpnnhr
132 29/Jun/05 19:17  /cgi-bin/chat/chat.cgi?action=chat&id=xqlizhyyyreajbeezgxipnynoqeago&pause=
131  2/Jun/05 20:04  /cgi-bin/chat/chat.cgi?action=chat&id=uvqaacunuhalavjggvaptnvhjfcksh&pause=
130 12/Jun/05 16:39  /cgi-bin/chat/chat.cgi?action=chat&id=nowuzwyxfgvrwfszqssaygsdjbzhrz
130  6/Jun/05 15:59  /cgi-bin/chat/chat.cgi?action=chat&id=uraeokktdnopmyodogisydlqpsezwh&pause=
129 25/Jun/05 23:51  /cgi-bin/chat/chat.cgi?action=chat&id=xfdiupdtglmgntlzgqryzlrnghcely
129  6/Jun/05 16:38  /cgi-bin/chat/chat.cgi?action=chat&id=dkrxrlingbpzagenzhjqnjhfrwgwkm
127 20/Jun/05 17:43  /cgi-bin/chat/chat.cgi?action=chat&id=cjnztdmjgeaqmfxrgdqutuscwcngxu
126 17/Jun/05 20:58  /cgi-bin/chat/chat.cgi?action=chat&id=gwwokyhhpkavddeuoamokqiyvrorpr&pause=
126 21/Jun/05 18:45  /cgi-bin/chat/chat.cgi?action=chat&id=yixwjpyaruwnnscdyhoroeerrvcrpb&pause=
124 23/Jun/05 19:28  /cgi-bin/chat/chat.cgi?action=chat&id=vqdzdsjnsjeuvhacmskgwxlicptqdd&pause=
124  2/Jun/05 16:56  /cgi-bin/chat/chat.cgi?action=chat&id=ygirvetejrnndhyhlwanohytmsyhmz&pause=
123  3/Jun/05 21:20  /cgi-bin/chat/chat.cgi?action=chat&id=rbzvypaqwxztqqqgzzqwfcxfiycpsm&pause=
123 16/Jun/05 17:17  /cgi-bin/chat/chat.cgi?action=chat&id=oghnjryxcqmasijamgqdxasvyixqji&pause=
123 19/Jun/05 20:53  /cgi-bin/chat/chat.cgi?action=chat&id=fvbozxoonzwkkkcyebckxaaeepozof&pause=
122 22/Jun/05 18:30  /cgi-bin/chat/chat.cgi?action=chat&id=ayjkzxqluxtzjmyjirzetdikmvibfy&pause=
121 27/Jun/05 19:13  /cgi-bin/chat/chat.cgi?action=chat&id=tfbszigsxwlmzcwbbfyiwtsuwretoj
121  1/Jun/05 22:46  /cgi-bin/chat/chat.cgi?action=chat&id=xiruyoxamyxclibkrkvpbobafeiunf&pause=
120 29/Jun/05 19:42  /cgi-bin/chat/chat.cgi?action=chat&id=qnqywvzhujkuadjzeohxfbxjnqxwpb&pause=
119 17/Jun/05 18:17  /cgi-bin/chat/chat.cgi?action=chat&id=yughcqubbirciwcnxopbjyfgsxwbzx&pause=
119 28/Jun/05 14:25  /cgi-bin/chat/chat.cgi?action=chat&id=lsarvjzenxschxllmovdwymlvzmgms&pause=
119 28/Jun/05 21:03  /cgi-bin/chat/chat.cgi?action=chat&id=rivmkvlapqudxotaospchuscmkrfnb
118 21/Jun/05 17:24  /cgi-bin/chat/chat.cgi?action=chat&id=csnklthfhknyxkopmmnnmixjprdbfi
117  6/Jun/05 19:21  /cgi-bin/chat/chat.cgi?action=chat&id=reszbfqtpkliztmdkgffroppouolsx&pause=
117  6/Jun/05 16:25  /cgi-bin/chat/chat.cgi?action=chat&id=lyfbbnjllnsjjqcegbuxunsoeepmxl&pause=
116 25/Jun/05 13:18  /cgi-bin/chat/chat.cgi?action=chat&id=irhlacwiessniuxzobldfifkbwafcx
115 19/Jun/05 21:12  /cgi-bin/chat/chat.cgi?action=chat&id=ydllfufeqaytgwrxmrbgkthgoavguw
115  1/Jun/05 22:08  /cgi-bin/chat/chat.cgi?action=chat&id=stcdsubvclgzjewbvjrvmayekjtujv&pause=
115 27/Jun/05 19:36  /cgi-bin/chat/chat.cgi?action=chat&id=nqvahbrckvajiquwhhhnefqauoxlkf&pause=
113 26/Jun/05 18:42  /cgi-bin/chat/chat.cgi?action=chat&id=qnjqihjtrvnfvjlklhiiwgtbpxtqmp&pause=
113  1/Jun/05 16:04  /cgi-bin/chat/chat.cgi?action=chat&id=vadbyavadqfmmarejbjrxkopzksyac&pause=
113 12/Jun/05 18:52  /cgi-bin/chat/chat.cgi?action=chat&id=zqtrhrbpdghuwnkvowwriuscmkurol&pause=
112 15/Jun/05 19:09  /cgi-bin/chat/chat.cgi?action=chat&id=adlmcuzdeohwvzabtuwzwyrylzxzhm&pause=
112 27/Jun/05 20:00  /cgi-bin/chat/chat.cgi?action=chat&id=hltxeaxiyyzmoqypuhffelxfmhanje&pause=
112 22/Jun/05 18:49  /cgi-bin/chat/chat.cgi?action=chat&id=pxwktzszaewqxmrwujosispnutyhqj&pause=
110 29/Jun/05 21:12  /cgi-bin/chat/chat.cgi?action=chat&id=tnihizgbbeadhzvwyzdpqgextcpkgo&pause=
110  2/Jun/05 20:12  /cgi-bin/chat/chat.cgi?action=chat&id=acqynupuyxgfiknrhqayuolrcsnqiv
109 19/Jun/05 21:12  /cgi-bin/chat/chat.cgi?action=chat&id=nekzfwssqkfgyrbztoslyiqlaqpesz
108  8/Jun/05 19:22  /cgi-bin/chat/chat.cgi?action=chat&id=hiwdopsazjxiinlyqyrnwlpprbkymj&pause=
106 18/Jun/05 20:09  /cgi-bin/chat/chat.cgi?action=chat&id=azovkahjdndmcphlmyaknviqsctmez
106 26/Jun/05 23:21  /cgi-bin/chat/chat.cgi?action=chat&id=mtjzlpvwgbzcmcdmhtdjzjxnelzmnb&pause=
104 29/Jun/05 18:36  /cgi-bin/chat/chat.cgi?action=chat&id=tvwdqkcacedgmdmwidqdcafnprrefr&pause=
103 25/Jun/05 17:15  /cgi-bin/chat/chat.cgi?action=chat&id=bmfykrbdqcgtxtsdhoydxajyfeyxhr
103 14/Jun/05 12:36  /cgi-bin/chat/chat.cgi?action=chat&id=txrtlpzcmgqxxcueipioehbmiwwmhy&pause=
103 17/Jun/05 21:29  /cgi-bin/chat/chat.cgi?action=chat&id=sbezjdfveohljcgyrouurtciribtvb&pause=
103  7/Jun/05 17:41  /cgi-bin/chat/chat.cgi?action=chat&id=msriikfivzgchjnpaiaxikbifhhgtj
103 22/Jun/05 19:39  /cgi-bin/chat/chat.cgi?action=chat&id=ygqfynahtzabjohbxnjaynzonbivvb
103 11/Jun/05 11:49  /cgi-bin/chat/chat.cgi?action=chat&id=kwwvtiecoztzcbcfmhwzsxtwtrqvps&pause=
101 21/Jun/05 18:26  /cgi-bin/chat/chat.cgi?action=chat&id=spcwovjslsrcrwoilwdozyyvhgammw&pause=
101  8/Jun/05 19:22  /cgi-bin/chat/chat.cgi?action=chat&id=zqmlkbazajxzpfgfsbzsofkpqcldpf&pause=
100 23/Jun/05 19:28  /cgi-bin/chat/chat.cgi?action=chat&id=lgxpryypkedldjwidnjcdoenwznugm&pause=
100  7/Jun/05 21:08  /cgi-bin/chat/chat.cgi?action=chat&id=ufajfhbkbtuaqnpkvjyqctzxlrtifw&pause=
100 28/Jun/05 20:02  /cgi-bin/chat/chat.cgi?action=chat&id=jdznnhalocrfeuhnxwfrfqdoxfrogd
100  4/Jun/05 20:31  /cgi-bin/chat/chat.cgi?action=chat&id=ouzptouzdktaxfdbcuubzbuorhytlt&pause=
98 19/Jun/05 19:58  /cgi-bin/chat/chat.cgi?action=chat&id=sxuszajjcorbeuegzeuvozucqpkmhf
97 24/Jun/05 22:21  /cgi-bin/chat/chat.cgi?action=chat&id=pwuixohnplpsvsvrofetfqcbpqbgqh
97  4/Jun/05 19:40  /cgi-bin/chat/chat.cgi?action=chat&id=sqwlhssshxtdxkjlfzmmkwrmfmivqg&pause=
96 13/Jun/05 18:58  /cgi-bin/chat/chat.cgi?action=chat&id=noiiqmsjdhaqfxjzgcmuoiymfjmkhl&pause=
96  1/Jun/05 23:18  /cgi-bin/chat/chat.cgi?action=chat&id=oktqaxqbtmuhedpjjuwxomzynjrciv&pause=
94 17/Jun/05 19:12  /cgi-bin/chat/chat.cgi?action=chat&id=oxwtcolxkciegohzkgjnfeuhrtdqke&pause=
94 23/Jun/05 20:42  /cgi-bin/chat/chat.cgi?action=chat&id=mefajlvdmvzjkihibzcawjmmekmzmv
94 26/Jun/05 20:21  /cgi-bin/chat/chat.cgi?action=chat&id=kxvqxgfsxlziwzdmbuhmotdomljzwa&pause=
93 25/Jun/05 08:49  /cgi-bin/chat/chat.cgi?action=chat&id=mnprcjdmmcnmlazeivjjuyqlqxcdgn
93  3/Jun/05 15:36  /cgi-bin/chat/chat.cgi?action=chat&id=zmqozznferdtewlwhztgmzlaqkdnmm&pause=
92 11/Jun/05 11:26  /cgi-bin/chat/chat.cgi?action=chat&id=lluglrpqjvcobueutvgnjyhmokglqb&pause=
92 23/Jun/05 16:59  /cgi-bin/chat/chat.cgi?action=chat&id=yyofoejlzxsqqbusmlzxxollrsjxdb
91 26/Jun/05 21:49  /cgi-bin/chat/chat.cgi?action=chat&id=rbmiychtaudlmcwqpbmrlqirqnzjet&pause=
90 11/Jun/05 16:25  /cgi-bin/chat/chat.cgi?action=chat&id=rycgdsjtrguzjztqobiukfbvhduypg&pause=
89 16/Jun/05 18:57  /cgi-bin/chat/chat.cgi?action=chat&id=avxfrpbhkkcwpzdypzwzkangjlrexg&pause=
89 11/Jun/05 16:05  /cgi-bin/chat/chat.cgi?action=chat&id=tdtyqfcynqgnnaowzamupycgiuovgb
89 24/Jun/05 21:27  /cgi-bin/chat/chat.cgi?action=chat&id=rpfusipsuhxzipqlshcksrbaccvhyi&pause=
88  4/Jun/05 20:41  /cgi-bin/chat/chat.cgi?action=chat&id=vbchrfvsylpwcxnaknffaxqsdbbwzu
87 27/Jun/05 10:04  /cgi-bin/chat/chat.cgi?action=chat&id=fveoafxvagpcjogxymfzstozvtvltv
87  9/Jun/05 11:45  /cgi-bin/chat/chat.cgi?action=chat&id=esjcckbgqjbkbixtzelikanushxrqm&pause=
87  5/Jun/05 18:32  /cgi-bin/chat/chat.cgi?action=chat&id=gijkxoftpnzgyxvhaanzywsgewbboc&pause=
86 23/Jun/05 19:26  /cgi-bin/chat/chat.cgi?action=chat&id=dzfrwgvxfyrwlmzvmqulocegjtwbuu
85 26/Jun/05 18:39  /cgi-bin/chat/chat.cgi?action=chat&id=kzmmkuxvjtxcucchbbtlrosclarixu&pause=
85 28/Jun/05 06:38  /cgi-bin/chat/chat.cgi?action=chat&id=ezpuyodjtrsdhizlkqxchhexlztolb&pause=
85  3/Jun/05 19:55  /cgi-bin/chat/chat.cgi?action=chat&id=nmsesilhcjampipladaslhadkojnoo&pause=
84 12/Jun/05 20:39  /cgi-bin/chat/chat.cgi?action=chat&id=dsanusfrsfsnuhyifdblmsfxusprty&pause=
83 17/Jun/05 20:49  /cgi-bin/chat/chat.cgi?action=chat&id=ooqfgidwgiomjdsvmuqxrngjvglgzt
83 21/Jun/05 17:57  /cgi-bin/chat/chat.cgi?action=chat&id=gqlgeblfhmchspuqfmsrnswsdgcdnp&pause=
83  6/Jun/05 18:36  /cgi-bin/chat/chat.cgi?action=chat&id=ngkecnomewxvhifkpqsanwakrdmnyp&pause=
82 17/Jun/05 19:24  /cgi-bin/chat/chat.cgi?action=chat&id=cuegfqeeprmjwzlgjewzrlkzhzceir&pause=
81 28/Jun/05 19:29  /cgi-bin/chat/chat.cgi?action=chat&id=rwimnbvrnardidkbznkxaaxxspochb&pause=
81 25/Jun/05 15:59  /cgi-bin/chat/chat.cgi?action=chat&id=bbpzmhxcjwdtbawgexaaxrlwwxqnby&pause=
80 11/Jun/05 05:24  /cgi-bin/chat/chat.cgi?action=chat&id=jperpjyogpgzrmhebkdfbdmvnvtqfy&pause=
80  3/Jun/05 15:34  /cgi-bin/chat/chat.cgi?action=chat&id=xxvxurnrykglsktvbddhczgqztdseu&pause=
79 28/Jun/05 18:21  /cgi-bin/chat/chat.cgi?action=chat&id=weustdfhoeivbjyuysfgvbnvdwhtmn&pause=
79 16/Jun/05 17:37  /cgi-bin/chat/chat.cgi?action=chat&id=oimiiaoperovgkzxiyhgomcqopnowf
79  3/Jun/05 17:10  /cgi-bin/chat/chat.cgi?action=chat&id=iiqjfyrofpdpfasbhyjdrmstlvcgbd&pause=
79 15/Jun/05 04:03  /cgi-bin/chat/chat.cgi?action=chat&id=fxzybrvftattqmirkqgcxmmoietabi&pause=
79  3/Jun/05 19:17  /cgi-bin/chat/chat.cgi?action=chat&id=orbcmtsasfvrkwajxlwaejofvvnybu&pause=
78  4/Jun/05 20:01  /cgi-bin/chat/chat.cgi?action=chat&id=pnkjfxsqgqdbzhlldfjgnjyczotary
78 11/Jun/05 16:35  /cgi-bin/chat/chat.cgi?action=chat&id=vpvbqgcdgzdmcfayuultcqmihwdoex
78 28/Jun/05 19:09  /cgi-bin/chat/chat.cgi?action=chat&id=fjikazyicejotwyfizcaryrsmbtque&pause=
77 28/Jun/05 20:11  /cgi-bin/chat/chat.cgi?action=chat&id=qqpcotlqtsrrftxaiopgrewzklofxu
77 27/Jun/05 18:20  /cgi-bin/chat/chat.cgi?action=chat&id=qhbawicsepmmmjqishvrsayffekwmr&pause=
77 11/Jun/05 22:05  /cgi-bin/chat/chat.cgi?action=chat&id=rxcgdlibykashglpzfsjuvewpieomh
77  8/Jun/05 19:45  /cgi-bin/chat/chat.cgi?action=chat&id=jtfzmoqhvdmldgmezffevfzpgwjskw&pause=
76 10/Jun/05 18:47  /cgi-bin/chat/chat.cgi?action=chat&id=ctsnwenziihdgkueqwzvsnaxomeunj&pause=
76 22/Jun/05 21:25  /cgi-bin/chat/chat.cgi?action=chat&id=osuwojfoxiyacesfzirmohtmgpeehs&pause=
76  2/Jun/05 19:31  /cgi-bin/chat/chat.cgi?action=chat&id=abcriffqkdrmscyzitwucfnjvhsowa&pause=
76 12/Jun/05 13:21  /cgi-bin/chat/chat.cgi?action=chat&id=sipjpwoxulfhgkovipaitpajeszhgp&pause=
75 20/Jun/05 18:49  /cgi-bin/chat/chat.cgi?action=chat&id=doohpykfqliqkbwhzzdhxcpbowzltj
75 17/Jun/05 18:21  /cgi-bin/chat/chat.cgi?action=chat&id=hzbxumharsaolgqjciuecmphfkbjnd
75 15/Jun/05 20:18  /cgi-bin/chat/chat.cgi?action=chat&id=htuckzinucpzwmpjfzddjynnbdmlby&pause=
75 25/Jun/05 19:04  /cgi-bin/chat/chat.cgi?action=chat&id=owibyfiakaisiqjlycofmnrvkackjl&pause=
75  8/Jun/05 18:44  /cgi-bin/chat/chat.cgi?action=chat&id=iftaqebyckpoetaenbqgktskrvuczc&pause=
74 12/Jun/05 13:16  /cgi-bin/chat/chat.cgi?action=chat&id=eabhvufozofbthcztytwldxsnseqmt
74 22/Jun/05 18:07  /cgi-bin/chat/chat.cgi?action=chat&id=rgwrizjwxocmalgzhatdhnwymtkkfa
73 16/Jun/05 20:35  /cgi-bin/chat/chat.cgi?action=chat&id=bamqazeyeabuzhxizkkzfpjuppuhxj
73 26/Jun/05 21:32  /cgi-bin/chat/chat.cgi?action=chat&id=nofpjouebgucstmiwvtpurbxljlhio&pause=
73 29/Jun/05 18:12  /cgi-bin/chat/chat.cgi?action=chat&id=pzphuetlpswtmaracvaiizwrxepjqk
73 11/Jun/05 19:46  /cgi-bin/chat/chat.cgi?action=chat&id=bkilfojwzzvyamxdhlujwqwccthron&pause=
72  6/Jun/05 18:01  /cgi-bin/chat/chat.cgi?action=chat&id=xmdsxomofuywecxexjcnjqbydfyrfq&pause=
71  1/Jun/05 21:51  /cgi-bin/chat/chat.cgi?action=chat&id=ramwlozdippzxvcwjcsnjofizhyjdj&pause=
70 24/Jun/05 19:57  /cgi-bin/chat/chat.cgi?action=chat&id=sqahdktihqupljrkctjuhwqrvhignn
70 22/Jun/05 19:06  /cgi-bin/chat/chat.cgi?action=chat&id=lcafvyjqpagkckopcbknckoxshrtht&pause=
69 16/Jun/05 21:25  /cgi-bin/chat/chat.cgi?action=chat&id=bcxkgdzvxdmixjjskbylghnqxwlrjo&pause=
69 17/Jun/05 13:59  /cgi-bin/chat/chat.cgi?action=chat&id=rrckvvlgabhajyoizbfnilbvprdlhe
68 21/Jun/05 17:02  /cgi-bin/chat/chat.cgi?action=chat&id=csnklthfhknyxkopmmnnmixjprdbfi&pause=
68 22/Jun/05 19:23  /cgi-bin/chat/chat.cgi?action=chat&id=sguvzwtvuffmtmgqlqysivavzsodhq
67 26/Jun/05 19:47  /cgi-bin/chat/chat.cgi?action=chat&id=yjxhooxuqkeqxqcunjsegcljxkqhmv
67  7/Jun/05 21:09  /cgi-bin/chat/chat.cgi?action=chat&id=pzbqvjcygifqeifplowubaardulnly&pause=
67 11/Jun/05 13:05  /cgi-bin/chat/chat.cgi?action=chat&id=ywcvgclqgwksstkrlihabgkwrffjzf&pause=
65 26/Jun/05 16:52  /cgi-bin/chat/chat.cgi?action=chat&id=dkrlyqrltsfadgwyoylhlhzuodliyf&pause=
65  6/Jun/05 17:42  /cgi-bin/chat/chat.cgi?action=chat&id=ucedjgchftxcqiyvyypribrmxwdbar&pause=
64 28/Jun/05 17:38  /cgi-bin/chat/chat.cgi?action=chat&id=lyurstpsgvewmnxvadzcpyqkfeqqxk&pause=
63  3/Jun/05 19:23  /cgi-bin/chat/chat.cgi?action=chat&id=bkackfxhstyvvzqhzypqwsortloram&pause=
63 29/Jun/05 19:17  /cgi-bin/chat/chat.cgi?action=chat&id=xdhqenegoedsmppjvofgvenlecpwyb&pause=
63 28/Jun/05 12:21  /cgi-bin/chat/chat.cgi?action=chat&id=qrinkkepwzjgeeaoffsnmpancgafcw&pause=
62  1/Jun/05 14:51  /cgi-bin/chat/chat.cgi?action=chat&id=sdugnprimaqycrajjmxebpwoycelso&pause=
62 14/Jun/05 20:34  /cgi-bin/chat/chat.cgi?action=chat&id=xsnpfctwzljmgjigjlnoirczhitaqj&pause=
62  1/Jun/05 13:35  /cgi-bin/chat/chat.cgi?action=chat&id=icfqiejhwsanifpuurexutvianmzjs&pause=
62 26/Jun/05 09:52  /cgi-bin/chat/chat.cgi?action=chat&id=wpzdqnbtghqnqsjqwrfvqrreqyrtrk
61 26/Jun/05 17:39  /cgi-bin/chat/chat.cgi?action=chat&id=vihfrrmvshonijpbxzrhvkeusiigdr
60 27/Jun/05 20:13  /cgi-bin/chat/chat.cgi?action=chat&id=ymwcgdsadyajlkatawpxvwjppamiyi&pause=
60 11/Jun/05 16:35  /cgi-bin/chat/chat.cgi?action=chat&id=ybxfdvtpmdtuoqcdrcpgxwyhtldnak&pause=
59 28/Jun/05 06:51  /cgi-bin/chat/chat.cgi?action=chat&id=ezpuyodjtrsdhizlkqxchhexlztolb
59 19/Jun/05 19:17  /cgi-bin/chat/chat.cgi?action=chat&id=ivbxuiokhprgbhjjraayrbuxbeajws
59  4/Jun/05 16:43  /cgi-bin/chat/chat.cgi?action=chat&id=lltprpxrxdrjsjxeeuolgwlrhpssyw&pause=
59  1/Jun/05 20:07  /cgi-bin/chat/chat.cgi?action=chat&id=edwouliojxibkyvyuaooaxxubvjiwk&pause=
58 20/Jun/05 19:17  /cgi-bin/chat/chat.cgi?action=chat&id=ozmwpcbulescivhnonqjsynrflwdra&pause=
58  4/Jun/05 18:54  /cgi-bin/chat/chat.cgi?action=chat&id=amfwgqikmpchqwwudcencskyrryugx&pause=
58  6/Jun/05 19:58  /cgi-bin/chat/chat.cgi?action=chat&id=kmkkttnnenknptwdccilfycyfaidjt&pause=
57  1/Jun/05 21:13  /cgi-bin/chat/chat.cgi?action=chat&id=qnwipnemjlicjmyevyxuebncfzabse
57 29/Jun/05 19:37  /cgi-bin/chat/chat.cgi?action=chat&id=afahnfqflkxsdnwjzbfbrjlsozjpjm&pause=
56  2/Jun/05 08:12  /cgi-bin/chat/chat.cgi?action=chat&id=mojbgmxvcbrwhukulihdnhcfcgcxhf&pause=
56  9/Jun/05 18:08  /cgi-bin/chat/chat.cgi?action=chat&id=iokthnejrqkylhtsomoyyscmnyowip&pause=
55 26/Jun/05 18:46  /cgi-bin/chat/chat.cgi?action=chat&id=ehxwzmdsvtrnjwsrrqxspfrtyppizn
55  6/Jun/05 15:58  /cgi-bin/chat/chat.cgi?action=chat&id=tkxozbkdkyuiwnepddvorombcsnter
55  8/Jun/05 20:24  /cgi-bin/chat/chat.cgi?action=chat&id=ddxiybxzlrijnadtqvbmxitusojbye&pause=
54  6/Jun/05 16:35  /cgi-bin/chat/chat.cgi?action=chat&id=advnplwwvhzxeslzojjchphlrrzvop&pause=
54 20/Jun/05 18:45  /cgi-bin/chat/chat.cgi?action=chat&id=nyuapkqoxeabmhvdmbsnqdsvkeabey&pause=
54 19/Jun/05 20:42  /cgi-bin/chat/chat.cgi?action=chat&id=tufnafnshltwdkfzvpbkwperghrtpu
54 22/Jun/05 18:28  /cgi-bin/chat/chat.cgi?action=chat&id=licmdqonmjixafhavkrbqohkwxzguv
54  5/Jun/05 20:36  /cgi-bin/chat/chat.cgi?action=chat&id=xphbujvkprmcgoazwbuwuwegreoygl&pause=
53  3/Jun/05 19:18  /cgi-bin/chat/chat.cgi?action=chat&id=xdrajukvpwbmoqaiqekytadxladrxg&pause=
53  3/Jun/05 21:30  /cgi-bin/chat/chat.cgi?action=chat&id=tybusxabamtowjvsginbkiluefmrzp&pause=
53 14/Jun/05 21:24  /cgi-bin/chat/chat.cgi?action=chat&id=ptzknobohpmleariotieralzkejgdc&pause=
53 10/Jun/05 19:54  /cgi-bin/chat/chat.cgi?action=chat&id=jfgvscztbymnnniyaaawbzfxjkcjjy&pause=
53  4/Jun/05 19:31  /cgi-bin/chat/chat.cgi?action=chat&id=hlxgwcflfgrxmqozcvftggidvsuwhy&pause=
52 11/Jun/05 16:51  /cgi-bin/chat/chat.cgi?action=chat&id=ujebvpzjxnjgeufinxfuyssjqabmpu&pause=
52  5/Jun/05 18:47  /cgi-bin/chat/chat.cgi?action=chat&id=ysjycznbkoumrwaazbfdithbmwayno
52  5/Jun/05 17:24  /cgi-bin/chat/chat.cgi?action=chat&id=zrktdcacxpnfbwooaruzfgndlmvvyy
52 26/Jun/05 14:41  /cgi-bin/chat/chat.cgi?action=chat&id=gizdwwouvirlxtfnpfppuqtnavxqco&pause=
51  2/Jun/05 12:23  /cgi-bin/chat/chat.cgi?action=chat&id=toyjijkhovjoghiibflqxaehrkctco
51 25/Jun/05 19:27  /cgi-bin/chat/chat.cgi?action=chat&id=bubnmhvnnremghomjzjgdvtbvtgkbs&pause=
51 27/Jun/05 19:23  /cgi-bin/chat/chat.cgi?action=chat&id=hjrehdzwnetqadcljlbinyiafvsiqw&pause=
50  7/Jun/05 19:17  /cgi-bin/chat/chat.cgi?action=chat&id=ndjzedujsjnghpgrtheufbhccekoqy&pause=
50  2/Jun/05 22:35  /cgi-bin/chat/chat.cgi?action=chat&id=ptmobmepgaamezvfjlqsigervhetru
50 11/Jun/05 21:51  /cgi-bin/chat/chat.cgi?action=chat&id=rxcgdlibykashglpzfsjuvewpieomh&pause=
50 19/Jun/05 11:50  /cgi-bin/chat/chat.cgi?action=chat&id=hzpekqmhoexlnqpnwsdpjgjblridbv&pause=
50 28/Jun/05 20:33  /cgi-bin/chat/chat.cgi?action=chat&id=vexcrjdbewxtktpkbekebycwsyenno
49  7/Jun/05 05:44  /cgi-bin/chat/chat.cgi?action=chat&id=dxfuslivlsopyevlhpbuegmtforxww&pause=
49  7/Jun/05 20:04  /cgi-bin/chat/chat.cgi?action=chat&id=lzzvzakqhpaaiaucyrbgrnbxpcignn&pause=
49  5/Jun/05 20:13  /cgi-bin/chat/chat.cgi?action=chat&id=cljgjzemglxjhwthgmyftmnwqqxbju
48 21/Jun/05 17:08  /cgi-bin/chat/chat.cgi?action=chat&id=aluzitggxuayixdhcejbfuznjlklqr&pause=
48 27/Jun/05 19:30  /cgi-bin/chat/chat.cgi?action=chat&id=kyrjrylmqrfuhrulajnbwcliascukq
48  6/Jun/05 20:50  /cgi-bin/chat/chat.cgi?action=chat&id=svmgkwfmwdjurhfrnfaumafdliumwt&pause=
48 17/Jun/05 21:10  /cgi-bin/chat/chat.cgi?action=chat&id=unywgeeauntvgqtkornxwrnfqfhmkd&pause=
48 11/Jun/05 21:53  /cgi-bin/chat/chat.cgi?action=chat&id=whbkexpjgxhlmmvrwidyoektzzaerk
47 17/Jun/05 18:20  /cgi-bin/chat/chat.cgi?action=chat&id=tqciqwhseajaklavqfqdynrhqhgccd
47 21/Jun/05 18:34  /cgi-bin/chat/chat.cgi?action=chat&id=hooqmdreochuwsmwgoztfbmfdzzhkp
47 17/Jun/05 18:04  /cgi-bin/chat/chat.cgi?action=chat&id=muwgrjzxycvpdahsdfaegahdyoagcr
46  2/Jun/05 12:20  /cgi-bin/chat/chat.cgi?action=chat&id=kazssqjvrewtfbmmjwtuscshneggxd&pause=
46 24/Jun/05 19:43  /cgi-bin/chat/chat.cgi?action=chat&id=zsrjvsxkxaektbxmqubetfgcusabqp
46 11/Jun/05 11:05  /cgi-bin/chat/chat.cgi?action=chat&id=lluglrpqjvcobueutvgnjyhmokglqb
45 27/Jun/05 00:59  /cgi-bin/chat/chat.cgi?action=chat&id=yuaccyqmtdazepqyqbigzrtribibxm&pause=
45 16/Jun/05 18:59  /cgi-bin/chat/chat.cgi?action=chat&id=xyoiwiljkitmectlteihhncmeqdetq&pause=
44  3/Jun/05 19:27  /cgi-bin/chat/chat.cgi?action=chat&id=xdrajukvpwbmoqaiqekytadxladrxg
44 26/Jun/05 16:38  /cgi-bin/chat/chat.cgi?action=chat&id=gmebaunuexnddegrirvrttlfpqgaam
44 10/Jun/05 18:20  /cgi-bin/chat/chat.cgi?action=chat&id=sxfwlgczmantzbpaumlzrnghrctabe
44 20/Jun/05 21:40  /cgi-bin/chat/chat.cgi?action=chat&id=zijvuxxoladxnnkohyxaivbshlmlfc
43  4/Jun/05 19:38  /cgi-bin/chat/chat.cgi?action=chat&id=riuvpsmbmkxjnsddnkozutigaiajxx
43 12/Jun/05 23:02  /cgi-bin/chat/chat.cgi?action=chat&id=xddnbcmjhivlozylsmzgemguwzfshl
43  9/Jun/05 13:45  /cgi-bin/chat/chat.cgi?action=chat&id=pajcfpakxrozyouvjwkygqislsrfaj
43 19/Jun/05 19:41  /cgi-bin/chat/chat.cgi?action=chat&id=sxuszajjcorbeuegzeuvozucqpkmhf&pause=
42  3/Jun/05 19:58  /cgi-bin/chat/chat.cgi?action=chat&id=leppsrznxpzftykxwvgeuevtzzhhrj&pause=
41 18/Jun/05 17:20  /cgi-bin/chat/chat.cgi?action=chat&id=uyesdupxbdfpshdrgrjomnykejmyci
41 16/Jun/05 19:07  /cgi-bin/chat/chat.cgi?action=chat&id=tnljyqkvarnzkgygfxnhaycysngoyn&pause=
40 24/Jun/05 23:22  /cgi-bin/chat/chat.cgi?action=chat&id=lqimhrqqpndtzgqhltesizegvhpgbc&pause=
40 10/Jun/05 18:12  /cgi-bin/chat/chat.cgi?action=chat&id=mlmpqkvwwcihkkzydoxsntsycjbffe&pause=
40 21/Jun/05 19:48  /cgi-bin/chat/chat.cgi?action=chat&id=wjblpieevbawyohlpsudtwdpsdlacd&pause=
40  9/Jun/05 19:40  /cgi-bin/chat/chat.cgi?action=chat&id=bzokafiukrckjvmmzmrwtytjdkfpqa&pause=
40  9/Jun/05 13:45  /cgi-bin/chat/chat.cgi?action=chat&id=xzoeidudfhwyjjmsrbxclaffrorgvi
40  4/Jun/05 19:03  /cgi-bin/chat/chat.cgi?action=chat&id=lorlgbplqgemrpevibchnfjqwpwpea&pause=
40 29/Jun/05 18:31  /cgi-bin/chat/chat.cgi?action=chat&id=jlotixnkvrzuwounjgzxsmkwebfscq&pause=
38 10/Jun/05 18:24  /cgi-bin/chat/chat.cgi?action=chat&id=cfwigsdnwhlhezqjoxcehvzdhhgygz&pause=
38 25/Jun/05 10:21  /cgi-bin/chat/chat.cgi?action=chat&id=nqigzktrkwooxbzydxcvijkpfkzwhx&pause=
38  2/Jun/05 17:45  /cgi-bin/chat/chat.cgi?action=chat&id=hksolczfaocxocupinbspckzoduhoj&pause=
38 28/Jun/05 19:24  /cgi-bin/chat/chat.cgi?action=chat&id=luubbxzyvjdllkzlagccdyebtmgojc&pause=
38 28/Jun/05 15:44  /cgi-bin/chat/chat.cgi?action=chat&id=orxereilswloiseotmponuiwemybnw
38 21/Jun/05 21:10  /cgi-bin/chat/chat.cgi?action=chat&id=lqfjcxdfdpymmsymjkmastebhxmctl
37 28/Jun/05 19:36  /cgi-bin/chat/chat.cgi?action=chat&id=cwkhywxedztjfgnnacfakgkvceaqyq&pause=
37 12/Jun/05 17:37  /cgi-bin/chat/chat.cgi?action=chat&id=pbwkjemvzamphqsupcldqfavyxxijz
37 12/Jun/05 14:08  /cgi-bin/chat/chat.cgi?action=chat&id=sjezfrllvssgmetaogsfwjnfaqkhoe
37  1/Jun/05 19:14  /cgi-bin/chat/chat.cgi?action=chat&id=ylngyfbjdtipibjiicpwpqvnrikywf
37 12/Jun/05 13:32  /cgi-bin/chat/chat.cgi?action=chat&id=zcidutbxneidrsvcsrbpfijuqmkecq&pause=
36 15/Jun/05 12:50  /cgi-bin/chat/chat.cgi?action=chat&id=yfngeksdkqpuwcsomsfbeitzgngafd
36  3/Jun/05 15:20  /cgi-bin/chat/chat.cgi?action=chat&id=zmqozznferdtewlwhztgmzlaqkdnmm
36 22/Jun/05 18:29  /cgi-bin/chat/chat.cgi?action=chat&id=pdmafvipkfpvodvadnflkwnygivilo&pause=
36  4/Jun/05 20:13  /cgi-bin/chat/chat.cgi?action=chat&id=nghqdaznyyjytcijqtkoovegmjeics&pause=
36  3/Jun/05 16:40  /cgi-bin/chat/chat.cgi?action=chat&id=npenzdshkktawwechdjkzwhopwtdgn&pause=
36 17/Jun/05 14:06  /cgi-bin/chat/chat.cgi?action=chat&id=xbihtwphtcqyvzhnunvxbxibhynewt
35 24/Jun/05 14:31  /cgi-bin/chat/chat.cgi?action=chat&id=jtuytzaaiyeckyscixgnxgvnknvzcu
35 26/Jun/05 12:28  /cgi-bin/chat/chat.cgi?action=chat&id=ufmpnaveaurtpspqsqmxphafywfgfi&pause=
35  4/Jun/05 20:20  /cgi-bin/chat/chat.cgi?action=chat&id=elzhkoohllotfzuwqbdmlvhfrkifpd&pause=
35 11/Jun/05 16:36  /cgi-bin/chat/chat.cgi?action=chat&id=btmpxiwbdtjosfqhaywzcnugfiyivp&pause=
35 27/Jun/05 19:11  /cgi-bin/chat/chat.cgi?action=chat&id=vzrefsikxirboapcirporfirceevao&pause=
35 26/Jun/05 10:39  /cgi-bin/chat/chat.cgi?action=chat&id=odsikwdidtrckulnreyliocpqycjyt
34 11/Jun/05 15:58  /cgi-bin/chat/chat.cgi?action=chat&id=dwxnumbnmscfcixczxyparrynbbjun&pause=
34 16/Jun/05 18:33  /cgi-bin/chat/chat.cgi?action=chat&id=afyxysqwmvuykmvhtufqmqkkbxuess
34 28/Jun/05 19:46  /cgi-bin/chat/chat.cgi?action=chat&id=jdznnhalocrfeuhnxwfrfqdoxfrogd&pause=
34 17/Jun/05 10:29  /cgi-bin/chat/chat.cgi?action=chat&id=lrmxiakkfjuamacvtjuoremspeksww&pause=
33 12/Jun/05 13:29  /cgi-bin/chat/chat.cgi?action=chat&id=dyscresidoxcxoztkxvcxmteduhhdx
33  6/Jun/05 20:47  /cgi-bin/chat/chat.cgi?action=chat&id=cqeigckzphxrtjscxxwoypufotovcm&pause=
33 15/Jun/05 19:50  /cgi-bin/chat/chat.cgi?action=chat&id=wwatfuvcinkdoffgcvwuqsoaspvial&pause=
33  6/Jun/05 16:06  /cgi-bin/chat/chat.cgi?action=chat&id=jxboqqowoiicesocucztrcuqpuzbhz&pause=
33 10/Jun/05 18:17  /cgi-bin/chat/chat.cgi?action=chat&id=cfwigsdnwhlhezqjoxcehvzdhhgygz
33 17/Jun/05 20:38  /cgi-bin/chat/chat.cgi?action=chat&id=tuvilljauoynvjhrfbatkabhjozwle&pause=
33 28/Jun/05 15:44  /cgi-bin/chat/chat.cgi?action=chat&id=mnjgigyzkdymeszmealyifrujexdin&pause=
33 26/Jun/05 15:10  /cgi-bin/chat/chat.cgi?action=chat&id=radlihtmptqjuyqnwvugebaodqoyfd&pause=
32 11/Jun/05 18:22  /cgi-bin/chat/chat.cgi?action=chat&id=cdsyosfbhghrhpfhctxfdgbcosgxyn&pause=
32 20/Jun/05 18:47  /cgi-bin/chat/chat.cgi?action=chat&id=ftkzefybqrdxfdmhioastoixjwgegv&pause=
32 11/Jun/05 14:50  /cgi-bin/chat/chat.cgi?action=chat&id=lgkyvgkuyyrneleqxzjibtloafdpos
32  8/Jun/05 19:27  /cgi-bin/chat/chat.cgi?action=chat&id=robjuhcgswbsdevtmoanpoudlhekxo
32  3/Jun/05 12:38  /cgi-bin/chat/chat.cgi?action=chat&id=zujwdcjkzegmyvhlxfqcrhgaevupdr&pause=
32 17/Jun/05 21:56  /cgi-bin/chat/chat.cgi?action=chat&id=fzrhfgalssbvchetqoxndphpqvobvq&pause=
31 20/Jun/05 00:22  /cgi-bin/chat/chat.cgi?action=chat&id=ujrmceccqkotpcraxujbbohvdcsrml
31 11/Jun/05 11:56  /cgi-bin/chat/chat.cgi?action=chat&id=awbttosdkpcydsolrchxzzihhqqcfp&pause=
31  8/Jun/05 17:31  /cgi-bin/chat/chat.cgi?action=chat&id=elzhkoohllotfzuwqbdmlvhfrkifpd
30 27/Jun/05 02:32  /cgi-bin/chat/chat.cgi?action=chat&id=xujdwjqnjefjenkbmbjvwvrdwxtnrp&pause=
30 20/Jun/05 17:03  /cgi-bin/chat/chat.cgi?action=chat&id=zjvsnfptoicsmlygphslvqtezfokcr&pause=
30 24/Jun/05 20:31  /cgi-bin/chat/chat.cgi?action=chat&id=dmusszielwispyquoeddqclrbzsljo&pause=
30  8/Jun/05 20:34  /cgi-bin/chat/chat.cgi?action=chat&id=dxivcwmujiuvugqjdnevnerqjjhutg&pause=
30  6/Jun/05 20:55  /cgi-bin/chat/chat.cgi?action=chat&id=geopdepqdnvodbwefgnmqlohsbmgrk&pause=
29 22/Jun/05 20:30  /cgi-bin/chat/chat.cgi?action=chat&id=guyjtcshhfsojopfhaqlapoiqzwvxx
28  8/Jun/05 18:49  /cgi-bin/chat/chat.cgi?action=chat&id=uuqhbwlyatfjmbulutclfxckwvqbxr
28 12/Jun/05 13:40  /cgi-bin/chat/chat.cgi?action=chat&id=kiusgbyloengdgecwilllpjjzveeuw&pause=
28 15/Jun/05 12:44  /cgi-bin/chat/chat.cgi?action=chat&id=yfngeksdkqpuwcsomsfbeitzgngafd&pause=
28 12/Jun/05 19:18  /cgi-bin/chat/chat.cgi?action=chat&id=tazhuisksjvoldlekmdkxquqhggrel&pause=
28 17/Jun/05 06:35  /cgi-bin/chat/chat.cgi?action=chat&id=hjbucwxqlsoonlfbfkwtjxjhhulzfd
27 21/Jun/05 12:53  /cgi-bin/chat/chat.cgi?action=chat&id=zwwaedeohmwxtwzhonlydqzasemnth&pause=
27  2/Jun/05 12:14  /cgi-bin/chat/chat.cgi?action=chat&id=toyjijkhovjoghiibflqxaehrkctco&pause=
27 14/Jun/05 14:14  /cgi-bin/chat/chat.cgi?action=chat&id=nkonvdjzgatyucdtegncivcbtgsfby
27 12/Jun/05 17:41  /cgi-bin/chat/chat.cgi?action=chat&id=mzmydgnsxbxrkkrqvwyxiqldxctwyx&pause=
26  5/Jun/05 20:59  /cgi-bin/chat/chat.cgi?action=chat&id=wcmvwhvphqaqszbeomvphtsxidmfap&pause=
26 29/Jun/05 08:32  /cgi-bin/chat/chat.cgi?action=chat&id=xanmuqxdjfbducdlabzqhvtvgivzmx
26  4/Jun/05 19:04  /cgi-bin/chat/chat.cgi?action=chat&id=tziccutxlzvllajwkbswrmzifyopzj&pause=
26  6/Jun/05 16:04  /cgi-bin/chat/chat.cgi?action=chat&id=ivlptznphqiwzfkelmpqfpzrbpclpw
26 27/Jun/05 23:51  /cgi-bin/chat/chat.cgi?action=chat&id=ybghyqxejzeqcgtqukugppezwqhomg
26  8/Jun/05 20:56  /cgi-bin/chat/chat.cgi?action=chat&id=gikzzkrbmyjvehysefijgbpafthxlu&pause=
26  2/Jun/05 13:38  /cgi-bin/chat/chat.cgi?action=chat&id=yaormouzsbmxluniojoujecrlfetwt&pause=
25 17/Jun/05 17:26  /cgi-bin/chat/chat.cgi?action=chat&id=xhcwimvbhczxtiybqqsiumtzvobvok
25 28/Jun/05 14:27  /cgi-bin/chat/chat.cgi?action=chat&id=wvnumbmslvhyjitniqjsnwenuvwqvc
25 14/Jun/05 14:11  /cgi-bin/chat/chat.cgi?action=chat&id=aybkatfweikjnnyyitscvwmklleaiz&pause=
25 11/Jun/05 15:50  /cgi-bin/chat/chat.cgi?action=chat&id=jbuylqdavstyquadgoabrcgsmgwjql&pause=
25 21/Jun/05 20:01  /cgi-bin/chat/chat.cgi?action=chat&id=fgpjtckljawyeisrocngqdfbzcklbv&pause=
25  1/Jun/05 13:49  /cgi-bin/chat/chat.cgi?action=chat&id=klktselrhwgghavmgxcblgqjplgody&pause=
25 18/Jun/05 20:49  /cgi-bin/chat/chat.cgi?action=chat&id=kpkcxdvzuhulltnhpmiuegnbagjuaj
25 15/Jun/05 05:07  /cgi-bin/chat/chat.cgi?action=chat&id=rcydoznttdxvnerbbwbfybkmntuelm&pause=
25 17/Jun/05 18:46  /cgi-bin/chat/chat.cgi?action=chat&id=xpwsezxgtyyzikxkdkumxectekgdav&pause=
25 17/Jun/05 19:27  /cgi-bin/chat/chat.cgi?action=chat&id=ndiiuwodxrhyvhwkbddqcyiztcxgja&pause=
24 12/Jun/05 21:07  /cgi-bin/chat/chat.cgi?action=chat&id=lggdazjadsqqoknmlnaqxkpatsozxn&pause=
24 10/Jun/05 18:33  /cgi-bin/chat/chat.cgi?action=chat&id=mfcybbkgwprbcuytutrfjnshpgvuvx
24 12/Jun/05 13:59  /cgi-bin/chat/chat.cgi?action=chat&id=sjezfrllvssgmetaogsfwjnfaqkhoe&pause=
24 25/Jun/05 10:19  /cgi-bin/chat/chat.cgi?action=chat&id=nprdglkhbgdzbbbxxrjgxvjhiimnhl&pause=
24 26/Jun/05 22:14  /cgi-bin/chat/chat.cgi?action=chat&id=bcgtshvnqikwmohcchgldqaznmvbfm&pause=
24 20/Jun/05 01:18  /cgi-bin/chat/chat.cgi?action=chat&id=mccubzwncrfzuvguhqmxiihctokneo&pause=
24  1/Jun/05 19:02  /cgi-bin/chat/chat.cgi?action=chat&id=vvyojjvzbgyrrljeuhuecnyxirhznh
23 28/Jun/05 09:33  /cgi-bin/chat/chat.cgi?action=chat&id=palhppiqxwwpiokxdbytstxotvsslm&pause=
23 16/Jun/05 21:05  /cgi-bin/chat/chat.cgi?action=chat&id=vchaxbvyjjjqummobzywuochbexepq&pause=
23  3/Jun/05 16:53  /cgi-bin/chat/chat.cgi?action=chat&id=nxwbbpvqlqqactnjkshbwiibmxcsox&pause=
23 24/Jun/05 21:29  /cgi-bin/chat/chat.cgi?action=chat&id=rpfusipsuhxzipqlshcksrbaccvhyi
23 26/Jun/05 17:28  /cgi-bin/chat/chat.cgi?action=chat&id=vihfrrmvshonijpbxzrhvkeusiigdr&pause=
23 14/Jun/05 20:39  /cgi-bin/chat/chat.cgi?action=chat&id=xsnpfctwzljmgjigjlnoirczhitaqj
23 29/Jun/05 19:31  /cgi-bin/chat/chat.cgi?action=chat&id=wnrnxgqibwfcihfrsflpzqlzbijnqy&pause=
23 23/Jun/05 19:29  /cgi-bin/chat/chat.cgi?action=chat&id=qiupkoikolgmhubtpbreefktkvlovw&pause=
23 22/Jun/05 10:38  /cgi-bin/chat/chat.cgi?action=chat&id=xehepizjuoklraislgcqqqmfvfarqb&pause=
22 25/Jun/05 12:56  /cgi-bin/chat/chat.cgi?action=chat&id=irhlacwiessniuxzobldfifkbwafcx&pause=
22 25/Jun/05 16:58  /cgi-bin/chat/chat.cgi?action=chat&id=lfflkfftqgjumyxjhctntpfemtugel&pause=
22  9/Jun/05 11:52  /cgi-bin/chat/chat.cgi?action=chat&id=hziexlovuurdjpuxipzloffnmfmrak&pause=
22 25/Jun/05 21:48  /cgi-bin/chat/chat.cgi?action=chat&id=hwpmfwhsopzhltclxjodpilqfpdxlm&pause=
22 25/Jun/05 14:14  /cgi-bin/chat/chat.cgi?action=chat&id=mizkkvrajntjgzcrvmisfgdkalxtmk&pause=
22  3/Jun/05 19:42  /cgi-bin/chat/chat.cgi?action=chat&id=dtwaohvqrtucoktorvtpbityqtuxwu&pause=
22 25/Jun/05 16:41  /cgi-bin/chat/chat.cgi?action=chat&id=snjopnhwcyuljineycssnmpqcohjnc
21  6/Jun/05 15:57  /cgi-bin/chat/chat.cgi?action=chat&id=vbdygrnvthtezsgohnrngqixaaxgys&pause=
21 10/Jun/05 16:28  /cgi-bin/chat/chat.cgi?action=chat&id=smckcevhiwpoowrmirqqkuyiytcgau&pause=
21 17/Jun/05 21:57  /cgi-bin/chat/chat.cgi?action=chat&id=aubqftaobivfrbmyebmwjvwvldzqfs&pause=
21 12/Jun/05 22:54  /cgi-bin/chat/chat.cgi?action=chat&id=xddnbcmjhivlozylsmzgemguwzfshl&pause=
21  4/Jun/05 19:50  /cgi-bin/chat/chat.cgi?action=chat&id=eyxtagckhfzqqojaldwiqzupsixgsn&pause=
21  8/Jun/05 18:56  /cgi-bin/chat/chat.cgi?action=chat&id=gkvflwfplzwblrbpllhlgxvnguoshf
21 10/Jun/05 13:23  /cgi-bin/chat/chat.cgi?action=chat&id=sliliqhugsnrljutpyirzedoyncumu&pause=
21 10/Jun/05 08:13  /cgi-bin/chat/chat.cgi?action=chat&id=ibzxjqcdopqwiazwfsbjoneukhczsa&pause=
20 29/Jun/05 14:53  /cgi-bin/chat/chat.cgi?action=chat&id=fcumaidgffzimhhitwhvmfngpzwmal
20 15/Jun/05 05:12  /cgi-bin/chat/chat.cgi?action=chat&id=dcbjaomjaqmldldwspdeqberyoqswu&pause=
20 18/Jun/05 17:43  /cgi-bin/chat/chat.cgi?action=chat&id=edhyalqppnhwlkfmajkeixkznrfyrq
20  4/Jun/05 11:35  /cgi-bin/chat/chat.cgi?action=chat&id=ewwlctuznesylrczxlvydpzqlaftlt&pause=
20 10/Jun/05 18:34  /cgi-bin/chat/chat.cgi?action=chat&id=drafattpfpmlevdykurguthjvxwexo&pause=
20 20/Jun/05 17:04  /cgi-bin/chat/chat.cgi?action=chat&id=yyjvcoeebjadjgcneuuradpfyqcpve
19 20/Jun/05 17:24  /cgi-bin/chat/chat.cgi?action=chat&id=msixskhphabksbafyvphbzmbdwlwpc
19 16/Jun/05 21:08  /cgi-bin/chat/chat.cgi?action=chat&id=vchaxbvyjjjqummobzywuochbexepq
19 14/Jun/05 19:49  /cgi-bin/chat/chat.cgi?action=chat&id=hmqgbxjbiqbfrgpmvfmwlhkjaqqzkn
19 28/Jun/05 10:26  /cgi-bin/chat/chat.cgi?action=chat&id=ftoeuhzuxvoshhoyrixxcqvucgutoh&pause=
19  6/Jun/05 19:17  /cgi-bin/chat/chat.cgi?action=chat&id=ygngsauxsmtrpcyzojqpxmstlcxrbu&pause=
19 14/Jun/05 20:49  /cgi-bin/chat/chat.cgi?action=chat&id=tcerigrpuuycyjkwkbhmqdzdnspooa&pause=
19 18/Jun/05 10:14  /cgi-bin/chat/chat.cgi?action=chat&id=cfmhhnntupmxysrgadrvhikfglqhpw&pause=
19  2/Jun/05 16:26  /cgi-bin/chat/chat.cgi?action=chat&id=iiwsnlsmkqlavitqtqjgmxfbiipgse&pause=
19 29/Jun/05 18:11  /cgi-bin/chat/chat.cgi?action=chat&id=fvgaijjufvqonetoheffobnaascwzy&pause=
19 11/Jun/05 11:20  /cgi-bin/chat/chat.cgi?action=chat&id=supmlcxoulaqjscvoysipjbspvevjs
19  7/Jun/05 20:02  /cgi-bin/chat/chat.cgi?action=chat&id=fddzfbhqluorsdqyburlfubknfixzw&pause=
19 15/Jun/05 20:18  /cgi-bin/chat/chat.cgi?action=chat&id=nupdwkdthesjxycwpywnmhofxknsvn&pause=
19 28/Jun/05 21:36  /cgi-bin/chat/chat.cgi?action=chat&id=szvmnpjaabjqtcmhsmctuvnoyictwx&pause=
18 29/Jun/05 15:23  /cgi-bin/chat/chat.cgi?action=chat&id=pycaxwjmpzialhyporslolworgaqvt&pause=
18 28/Jun/05 13:30  /cgi-bin/chat/chat.cgi?action=chat&id=rvtowzqgbywhnpcntnlhuffeuadjoz&pause=
18 12/Jun/05 17:40  /cgi-bin/chat/chat.cgi?action=chat&id=uuudjojfuvdbuczuekmdewlkgwulcs&pause=
18  8/Jun/05 20:48  /cgi-bin/chat/chat.cgi?action=chat&id=ltrovuzdrhnllxwhqeuteqcqrixfno&pause=
18 15/Jun/05 15:52  /cgi-bin/chat/chat.cgi?action=chat&id=ohmcrfvlsjaxajnmmafenhimnzqeom
18 16/Jun/05 18:38  /cgi-bin/chat/chat.cgi?action=chat&id=uxzrtnnhuhuctwygjpifugasyqlury
18 12/Jun/05 13:54  /cgi-bin/chat/chat.cgi?action=chat&id=encinsklnlzvopjbbhwriowosjaiod&pause=
18 12/Jun/05 14:08  /cgi-bin/chat/chat.cgi?action=chat&id=yuuscptpjkazsvphvosqhqrvudedhl&pause=
18  9/Jun/05 14:05  /cgi-bin/chat/chat.cgi?action=chat&id=cydsqoumekvfbtwugwnjscawedgoek&pause=
18 20/Jun/05 21:02  /cgi-bin/chat/chat.cgi?action=chat&id=fqqozfeogsfdtqqwarnnptqofwukyu
18 29/Jun/05 13:33  /cgi-bin/chat/chat.cgi?action=chat&id=cnpbihbzscleapikjnbculscznmimr
17  8/Jun/05 14:31  /cgi-bin/chat/chat.cgi?action=chat&id=otxxrsiqntlopfjfhpikseuojmklbi&pause=
17  3/Jun/05 14:58  /cgi-bin/chat/chat.cgi?action=chat&id=tpmvnfxhcybqebxmfsrydnsnliccge&pause=
17 28/Jun/05 16:48  /cgi-bin/chat/chat.cgi?action=chat&id=ccmrkhwpjplsngxwyklvhchepvgtqa&pause=
17 18/Jun/05 19:11  /cgi-bin/chat/chat.cgi?action=chat&id=gypnbpfkuxqdzhjhoujhxpabdoamxu&pause=
17  6/Jun/05 09:19  /cgi-bin/chat/chat.cgi?action=chat&id=xawejuvmfoirlywnrlmrqgkekwwwcp&pause=
17 20/Jun/05 12:54  /cgi-bin/chat/chat.cgi?action=chat&id=cgnvbcuiozntwdvplwgqmgsckclwjf&pause=
17 23/Jun/05 17:03  /cgi-bin/chat/chat.cgi?action=chat&id=kjxxjssqyfoafoutfdwrpdhrbxxiyz&pause=
17 28/Jun/05 21:18  /cgi-bin/chat/chat.cgi?action=chat&id=dqjsakmfszdgrdiuhkvetpqiksnipy&pause=
17 12/Jun/05 18:22  /cgi-bin/chat/chat.cgi?action=chat&id=gziajvjwjcplgjklelhcauytcejcbu&pause=
16 22/Jun/05 19:27  /cgi-bin/chat/chat.cgi?action=chat&id=crezuqkowpsifbjszfnfhtjkooxqel&pause=
16 13/Jun/05 13:02  /cgi-bin/chat/chat.cgi?action=chat&id=jgutmtlyduwnleeqwiulrpegajfvef&pause=
16 21/Jun/05 13:03  /cgi-bin/chat/chat.cgi?action=chat&id=spdstdjbtigvnwagvngkifwrhtdinm&pause=
16 23/Jun/05 15:36  /cgi-bin/chat/chat.cgi?action=chat&id=torcwpclulqfwnlhpnopojhnycytmn&pause=
16 11/Jun/05 11:17  /cgi-bin/chat/chat.cgi?action=chat&id=supmlcxoulaqjscvoysipjbspvevjs&pause=
16 29/Jun/05 19:21  /cgi-bin/chat/chat.cgi?action=chat&id=qcpvcgauftpmaqlaaxietmaocybdyj&pause=
16 15/Jun/05 10:27  /cgi-bin/chat/chat.cgi?action=chat&id=chnbtemvsnqcjccoyrgteuqtrtlyjb&pause=
16 20/Jun/05 13:15  /cgi-bin/chat/chat.cgi?action=chat&id=sntpattodetckjjabmvkdwotapcvcl&pause=
16 22/Jun/05 19:17  /cgi-bin/chat/chat.cgi?action=chat&id=oywvotabdfbxbmndzaluhhgzmtvicr&pause=
16  9/Jun/05 20:25  /cgi-bin/chat/chat.cgi?action=chat&id=kyyhproucvmddfzbzqepxrkjhmbwns&pause=
16 23/Jun/05 19:38  /cgi-bin/chat/chat.cgi?action=chat&id=djpxhwocflgwoucglsthrbrfgzammc
16 13/Jun/05 20:42  /cgi-bin/chat/chat.cgi?action=chat&id=rxspytrvgjutvkqdsxwnrpgpgywyfv&pause=
15  1/Jun/05 20:43  /cgi-bin/chat/chat.cgi?action=chat&id=eijnwaipvvkigjriqrwdxmfmkvcelx&pause=
15  2/Jun/05 08:33  /cgi-bin/chat/chat.cgi?action=chat&id=mabeewltovazxmnfeshmucyyzyxzxj&pause=
15 10/Jun/05 18:30  /cgi-bin/chat/chat.cgi?action=chat&id=mfcybbkgwprbcuytutrfjnshpgvuvx&pause=
15 22/Jun/05 19:06  /cgi-bin/chat/chat.cgi?action=chat&id=azcwskmqrgqvjptcwhxdqilmntjzck&pause=
15 10/Jun/05 21:30  /cgi-bin/chat/chat.cgi?action=chat&id=pwukwntdqubqjcfnelbmnnjcbugwyh&pause=
15 29/Jun/05 08:03  /cgi-bin/chat/chat.cgi?action=chat&id=pqnomyfhugggvgwfzmzqkzlohdayda&pause=
15 10/Jun/05 20:23  /cgi-bin/chat/chat.cgi?action=chat&id=vcajjypkltrivvyybgyixzebmdrkzi&pause=
15  3/Jun/05 10:59  /cgi-bin/chat/chat.cgi?action=chat&id=bwgocjkgxqtubjttnnlvzlioxuehxe&pause=
15 14/Jun/05 21:05  /cgi-bin/chat/chat.cgi?action=chat&id=pusoclvorlpqrabytpypvtqliiigfj
14 18/Jun/05 18:18  /cgi-bin/chat/chat.cgi?action=chat&id=nxjpniyqpiatbryehbvzketohojnfb&pause=
14 16/Jun/05 06:50  /cgi-bin/chat/chat.cgi?action=chat&id=abglnnekympcjaysuvjrxwftangrdj&pause=
14  9/Jun/05 19:16  /cgi-bin/chat/chat.cgi?action=chat&id=rlditgehllrivxnidmwgylkwbejlkj
14 10/Jun/05 06:37  /cgi-bin/chat/chat.cgi?action=chat&id=nzgvlzjtbqqgdhvkbnzmblbrfdsjel&pause=
14  1/Jun/05 01:42  /cgi-bin/chat/chat.cgi?action=chat&id=kvufwfawtkcyixffxavugmdztjwsbm
14 26/Jun/05 20:06  /cgi-bin/chat/chat.cgi?action=chat&id=qbzqxjaglmvqdpigqqhggrxpdyzprg&pause=
14  8/Jun/05 15:59  /cgi-bin/chat/chat.cgi?action=chat&id=auoyjbumexyiahacjjzeugpbxosben&pause=
14  6/Jun/05 15:26  /cgi-bin/chat/chat.cgi?action=chat&id=zvmkjzgdmrwphqhiwjbumrzvzdvmfe&pause=
14  7/Jun/05 22:24  /cgi-bin/chat/chat.cgi?action=chat&id=dzpzyyekababxtyawiodkfztykjfwh&pause=
14  8/Jun/05 19:22  /cgi-bin/chat/chat.cgi?action=chat&id=robjuhcgswbsdevtmoanpoudlhekxo&pause=
14 14/Jun/05 20:24  /cgi-bin/chat/chat.cgi?action=chat&id=mmshzcbxuqoipxhvobcoequheuhzfx&pause=
14 14/Jun/05 22:23  /cgi-bin/chat/chat.cgi?action=chat&id=afrltwryvirmlptvwirwrtuxutisel
13 11/Jun/05 14:35  /cgi-bin/chat/chat.cgi?action=chat&id=zjwahbwmftmqovtvkvbbaoxtcakzhk
13 27/Jun/05 02:59  /cgi-bin/chat/chat.cgi?action=chat&id=jnnjblsyzecyakwkimwydgcuxssqzd&pause=
13 12/Jun/05 13:07  /cgi-bin/chat/chat.cgi?action=chat&id=eabhvufozofbthcztytwldxsnseqmt&pause=
13 13/Jun/05 00:13  /cgi-bin/chat/chat.cgi?action=chat&id=dfvjnhxrofrrmeljkqykldpmqtthfy&pause=
13 12/Jun/05 14:40  /cgi-bin/chat/chat.cgi?action=chat&id=mhuezrxbbtbsakcxftuznmrxcumavi&pause=
13 19/Jun/05 15:49  /cgi-bin/chat/chat.cgi?action=chat&id=sfitwcvcnxczptmhqgevuddxajjulj&pause=
13 11/Jun/05 14:16  /cgi-bin/chat/chat.cgi?action=chat&id=yrqggawmvkuddotoxasnmtlepiopzd
13 27/Jun/05 12:49  /cgi-bin/chat/chat.cgi?action=chat&id=setlkgqhkcjlsyrlqcmhnsjindfhpl&pause=
12 25/Jun/05 08:58  /cgi-bin/chat/chat.cgi?action=chat&id=pieteellnrxergetaouxkmrvetpkru&pause=
12 27/Jun/05 19:31  /cgi-bin/chat/chat.cgi?action=chat&id=kyrjrylmqrfuhrulajnbwcliascukq&pause=
12  1/Jun/05 17:12  /cgi-bin/chat/chat.cgi?action=chat&id=omdtjfhmocmwkytspfumfldjmqfnuk&pause=
12 21/Jun/05 00:04  /cgi-bin/chat/chat.cgi?action=chat&id=bsrjaifepdkisbzhxtenjfjosotcvr&pause=
12  4/Jun/05 04:22  /cgi-bin/chat/chat.cgi?action=chat&id=mgwzmoqcswgwchncrgjmlrmjaqghqa
12  4/Jun/05 19:06  /cgi-bin/chat/chat.cgi?action=chat&id=lorlgbplqgemrpevibchnfjqwpwpea
12 13/Jun/05 05:16  /cgi-bin/chat/chat.cgi?action=chat&id=nmtwbxhokwonscsxqpisfkwwlpbitd&pause=
12 22/Jun/05 11:20  /cgi-bin/chat/chat.cgi?action=chat&id=ogsdyjzgesmuokvcrdtimgghtlhgli&pause=
12 13/Jun/05 15:24  /cgi-bin/chat/chat.cgi?action=chat&id=uivxjwvafuedbfwcbbxupotwdybsor
11  6/Jun/05 10:33  /cgi-bin/chat/chat.cgi?action=chat&id=gultdsvczahmkxwotwuyjncowyqvya&pause=
11  1/Jun/05 19:02  /cgi-bin/chat/chat.cgi?action=chat&id=fxgyxalewsszopnjxvsgvzvxigtzqt&pause=
11  4/Jun/05 20:39  /cgi-bin/chat/chat.cgi?action=chat&pause=1&id=vbchrfvsylpwcxnaknffaxqsdbbwzu
11  6/Jun/05 11:42  /cgi-bin/chat/chat.cgi?action=chat&id=vwaqsucqwkefivlekxqqzgthuctqxe&pause=
11 17/Jun/05 19:14  /cgi-bin/chat/chat.cgi?action=chat&id=iykxgrtxxqsvbeauvdqzkhhqxoxenx&pause=
11  6/Jun/05 21:20  /cgi-bin/chat/chat.cgi?action=chat&id=qcexgtvxngpyrgsiwfpvexdmrpprym
11 18/Jun/05 05:29  /cgi-bin/chat/chat.cgi?action=chat&id=ebzabmojwlcofvkgctmmzafcvobwjs&pause=
11 23/Jun/05 21:18  /cgi-bin/chat/chat.cgi?action=chat&id=dmnwansmtvaoiqgxuwbpedivarabdm&pause=
11  4/Jun/05 19:54  /cgi-bin/chat/chat.cgi?action=chat&id=fbzhxxlzxurcdtzrwrzcugmwavtjvb&pause=
11 16/Jun/05 09:53  /cgi-bin/chat/chat.cgi?action=chat&id=ujbeqekpynntgeplrzwmiblnhiyrrl
11 22/Jun/05 20:24  /cgi-bin/chat/chat.cgi?action=chat&id=guyjtcshhfsojopfhaqlapoiqzwvxx&pause=
11 26/Jun/05 07:17  /cgi-bin/chat/chat.cgi?action=chat&id=ykcjsajjnsihidxefjywkpycnajubb&pause=
11 10/Jun/05 18:35  /cgi-bin/chat/chat.cgi?action=chat&id=drafattpfpmlevdykurguthjvxwexo
11 11/Jun/05 14:29  /cgi-bin/chat/chat.cgi?action=chat&id=uegugtsgimhbyqhxhleahodfbrtvst&pause=
11  6/Jun/05 15:48  /cgi-bin/chat/chat.cgi?action=chat&id=tkxozbkdkyuiwnepddvorombcsnter&pause=
11 21/Jun/05 11:39  /cgi-bin/chat/chat.cgi?action=chat&id=zrrwlieltutcotwhzzhtjdzgfrmumi&pause=
11  1/Jun/05 18:14  /cgi-bin/chat/chat.cgi?action=chat&id=iodziwoxpxsbzmttaewaislsxydqus&pause=
11  6/Jun/05 05:40  /cgi-bin/chat/chat.cgi?action=chat&id=oeksawkhysmnqqiukzbegcxiyrgtzl&pause=
11  7/Jun/05 19:51  /cgi-bin/chat/chat.cgi?action=chat&id=rgllftqljifyofmyaempmtdiivccew&pause=
11  3/Jun/05 10:46  /cgi-bin/chat/chat.cgi?action=chat&id=fadsosstzccxygwrykdzxuxoyifbeb
10 21/Jun/05 14:10  /cgi-bin/chat/chat.cgi?action=chat&id=kyoaogszjfdbcboazugqiyklpubidi&pause=
10 28/Jun/05 14:12  /cgi-bin/chat/chat.cgi?action=chat&id=bxeojlhefjoduxcrrebjmozcebitkm&pause=
10 29/Jun/05 12:10  /cgi-bin/chat/chat.cgi?action=chat&id=flfeutbovfwgneeylwitemduxlvvwm&pause=
10  6/Jun/05 18:53  /cgi-bin/chat/chat.cgi?action=chat&id=bmxprzlgaxgihjwtopmeztsitxhfxj
10 21/Jun/05 17:11  /cgi-bin/chat/chat.cgi?action=chat&id=aluzitggxuayixdhcejbfuznjlklqr
10  7/Jun/05 17:50  /cgi-bin/chat/chat.cgi?action=chat&id=vbfnkyuqdxomvjpqrmvbxqxqkscpmu&pause=
10 22/Jun/05 23:28  /cgi-bin/chat/chat.cgi?action=chat&id=gphyivtcnmhreljskuufbpnjmtdejr&pause=
10 17/Jun/05 20:21  /cgi-bin/chat/chat.cgi?action=chat&id=qtasamnochcitakenvapenzuxidptb
10 25/Jun/05 11:17  /cgi-bin/chat/chat.cgi?action=chat&id=rzjkxlgzxiazgygmnnwttyuewcvkgx&pause=
10 12/Jun/05 18:18  /cgi-bin/chat/chat.cgi?action=chat&id=krgwekbjemyfwsgimbpfztxqulslre&pause=
10  2/Jun/05 08:05  /cgi-bin/chat/chat.cgi?action=chat&id=hwxcagdtecgevrsiveswkcckeywxqq&pause=
10 20/Jun/05 14:17  /cgi-bin/chat/chat.cgi?action=chat&id=tnmgizennzzncxcnywwlvzhpxhljqa&pause=
10  1/Jun/05 13:44  /cgi-bin/chat/chat.cgi?action=chat&id=ardiutnitouygyeiqmdtctkataupdc&pause=
10 18/Jun/05 17:20  /cgi-bin/chat/chat.cgi?action=chat&id=jiyktcylrijgrpguphqigudwzulkzi
10 16/Jun/05 16:56  /cgi-bin/chat/chat.cgi?action=chat&id=pyswatfshuryjlgjijtqdmlchjsita&pause=
10 23/Jun/05 17:55  /cgi-bin/chat/chat.cgi?action=chat&id=yfuijutnjkicvbfswhrugmhqvierco&pause=
227704 0.01%30/Jun/05 00:06/graphics/resources/pixel.gif
215640 0.67%30/Jun/05 00:06/graphics/logo-footer.gif
202944 0.02%30/Jun/05 00:06/graphics/foot-line.gif
200084 0.14%30/Jun/05 00:06/graphics/banners/bottom.gif
199341 0.36%30/Jun/05 00:06/graphics/banners/top.gif
120582 0.27%30/Jun/05 00:06/graphics/he.gif
114328 0.02%30/Jun/05 00:06/graphics/email-text.gif
114256 0.02%30/Jun/05 00:06/graphics/print-text.gif
108212 0.09%30/Jun/05 00:06/spam_vaccine/spam_vaccine.js
107977 0.18%30/Jun/05 00:06/graphics/helpinglogo1.gif
104800 0.01%30/Jun/05 00:06/graphics/triangle.gif
91295 0.16%29/Jun/05 22:18/cgi-bin/chat/chatsa.cgi
86596 1.99%30/Jun/05 00:06/
17 28/Jun/05 06:48  /?wb_co=excitejapan
77898 0.03%30/Jun/05 00:06/graphics/banners/fun-r.gif
77456 0.15%30/Jun/05 00:06/graphics/banners/fun-l.gif
61963 0.21%30/Jun/05 00:05/graphics/banners/faq-l.gif
61838 0.02%30/Jun/05 00:05/graphics/banners/faq-r.gif
59507 0.27%30/Jun/05 00:06/joinsm.gif
58915 0.23%30/Jun/05 00:05/graphics/banners/care-l.gif
58623 0.02%30/Jun/05 00:05/graphics/banners/care-r.gif
57500 0.84%30/Jun/05 00:06/graphics/homepage/left.gif
57289 0.02%30/Jun/05 00:06/graphics/homepage/backbar2.gif
57190 1.44%30/Jun/05 00:06/graphics/homepage/right.gif
4772210.73%30/Jun/05 00:04/graphics/fun/netbunnies/
175 0.05%29/Jun/05 21:44  /graphics/fun/netbunnies/?M=A
62 0.01%28/Jun/05 20:33  /graphics/fun/netbunnies/?S=D
55 0.02%29/Jun/05 21:16  /graphics/fun/netbunnies/?M=D
46 0.01%29/Jun/05 11:41  /graphics/fun/netbunnies/?S=A
45 0.01%29/Jun/05 05:02  /graphics/fun/netbunnies/?N=D
36 0.01%28/Jun/05 13:31  /graphics/fun/netbunnies/?D=A
36 0.01%29/Jun/05 13:55  /graphics/fun/netbunnies/?N=A
30 0.01%28/Jun/05 15:21  /graphics/fun/netbunnies/?D=D
46869 0.14%29/Jun/05 19:08/graphics/homepage/homepage-banner-text.gif
33594 0.06%30/Jun/05 00:06/favicon.ico
32248 0.07%29/Jun/05 22:18/cgi-bin/chat/chatpm.cgi
17 29/Jun/05 20:48  /cgi-bin/chat/chatpm.cgi?action=chatinput_html&id=icrgawmdbblefozlijasryidawpvot
13  5/Jun/05 19:59  /cgi-bin/chat/chatpm.cgi?action=chatinput_html&id=zxrhzgtlaqtstxddaayqojvctfjkfs
12  6/Jun/05 19:45  /cgi-bin/chat/chatpm.cgi?action=chatinput_html&id=ohjabgbaoupfnfidrrjpdfrapbmkkl
12 29/Jun/05 19:21  /cgi-bin/chat/chatpm.cgi?action=chatinput_html&id=qcpvcgauftpmaqlaaxietmaocybdyj
10 12/Jun/05 18:18  /cgi-bin/chat/chatpm.cgi?action=chatinput_html&id=krgwekbjemyfwsgimbpfztxqulslre
30896 0.15%30/Jun/05 00:04/easter/hrs-banner-easter.gif
28539 0.01%30/Jun/05 00:03/icons/blank.gif
27270 0.01%30/Jun/05 00:00/icons/back.gif
26263 0.01%30/Jun/05 00:00/icons/image2.gif
26153 0.12%30/Jun/05 00:06/graphics/banners/hrs-info-l.gif
26127 0.01%30/Jun/05 00:06/graphics/banners/hrs-info-r.gif
25015 0.01%29/Jun/05 23:33/graphics/notify-me.gif
24842 0.33%29/Jun/05 23:55/fun/
24405 0.01%30/Jun/05 00:03/chapters/san-diego/subnav/sn_emailoff.gif
24385 0.01%30/Jun/05 00:03/chapters/san-diego/buttongo.gif
24340 0.01%30/Jun/05 00:03/chapters/san-diego/subnav/sn_productsoff.gif
24307 0.01%30/Jun/05 00:03/chapters/san-diego/subnav/sn_faqoff.gif
24238 0.01%30/Jun/05 00:03/chapters/san-diego/subnav/sn_homeoff.gif
24095 0.01%30/Jun/05 00:03/chapters/san-diego/subnav/sn_adoptionon.gif
24067 0.01%30/Jun/05 00:03/chapters/san-diego/subnav/sn_healthon.gif
23852 0.01%30/Jun/05 00:03/chapters/san-diego/subnav/sn_aboutusoff.gif
23500 0.01%30/Jun/05 00:03/chapters/san-diego/subnav/sn_behavioron.gif
23292 0.01%30/Jun/05 00:03/chapters/san-diego/subnav/linedown.gif
23102 0.01%30/Jun/05 00:03/chapters/san-diego/subnav/sn_dieton.gif
22923 0.70%30/Jun/05 00:06/care/
22821 0.35%30/Jun/05 00:04/faq/
22482 0.01%30/Jun/05 00:03/chapters/san-diego/subnav/sn_aboutuson.gif
22125 0.01%30/Jun/05 00:03/chapters/san-diego/subnav/sn_productson.gif
21908 0.09%29/Jun/05 23:56/easter/hrs-square-easter.gif
21809 0.01%30/Jun/05 00:03/chapters/san-diego/subnav/sn_faqon.gif
21660 0.01%30/Jun/05 00:03/chapters/san-diego/subnav/sn_behavioroff.gif
21631 0.01%30/Jun/05 00:03/chapters/san-diego/subnav/sn_dietoff.gif
21627 0.01%30/Jun/05 00:03/chapters/san-diego/subnav/sn_emailon.gif
21498 0.01%30/Jun/05 00:03/chapters/san-diego/subnav/sn_homeon.gif
21275 0.01%30/Jun/05 00:00/icons/unknown.gif
20736 0.01%30/Jun/05 00:03/chapters/san-diego/subnav/sn_adoptionoff.gif
20378 0.05%30/Jun/05 00:06/styles/styles.css
19824 0.07%30/Jun/05 00:03/graphics/banners/behavior-l.gif
19791 0.01%30/Jun/05 00:03/graphics/banners/behavior-r.gif
19775 0.86%30/Jun/05 00:03/faq/sections/orphan.html
17787 0.31%30/Jun/05 00:03/behavior/
15370 29/Jun/05 23:58/chapters/san-diego/subnav/sn_healthoff.gif
15212 29/Jun/05 23:49/icons/folder.gif
14212 0.28%29/Jun/05 23:48/health/
13460 0.05%30/Jun/05 00:06/graphics/banners/health-l.gif
13413 0.01%30/Jun/05 00:06/graphics/banners/health-r.gif
13063 29/Jun/05 23:49/icons/binary.gif
11846 0.13%30/Jun/05 00:06/behavior/body-language.html
11739 0.21%30/Jun/05 00:04/faq/sections/diet.html
11573 0.02%29/Jun/05 23:55/graphics/donate.png
11354 0.25%30/Jun/05 00:05/adoption/
11324 0.09%30/Jun/05 00:06/graphics/homepage/hrs-bannerc.gif
11004 0.11%30/Jun/05 00:03/care/new-bunny-index.html
10961 0.45%30/Jun/05 00:05/faq/sections/litter.html
10845 0.17%30/Jun/05 00:03/chapters/san-diego/health/graphics/health_headergraphic_v2.jpg
10194 0.03%30/Jun/05 00:05/graphics/banners/adoption-l.gif
10159 0.01%30/Jun/05 00:05/graphics/banners/adoption-r.gif
9443 0.20%29/Jun/05 23:41/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Capodimonte_flower_basket.JPG
9073 0.03%30/Jun/05 00:02/graphics/banners/help-l.gif
9043 30/Jun/05 00:02/graphics/banners/help-r.gif
8946 0.02%29/Jun/05 22:18/cgi-bin/chat/chat2.cgi
1717 0.01%29/Jun/05 22:18  /cgi-bin/chat/chat2.cgi?action=banner
442 29/Jun/05 12:04  /cgi-bin/chat/chat2.cgi?action=register
123 29/Jun/05 19:08  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Poopybunny
109 29/Jun/05 21:14  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Jikuu
107 29/Jun/05 19:26  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Flemishr2cool
86 29/Jun/05 19:11  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=littlegem
83 29/Jun/05 20:21  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=bunnylover1017
73 29/Jun/05 20:47  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=JoW
71 29/Jun/05 13:49  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Legolas
61 28/Jun/05 19:35  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=luvreese
61 26/Jun/05 20:38  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=lilac
53 29/Jun/05 19:39  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Riokko
49 29/Jun/05 20:14  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Kermit
45 29/Jun/05 20:02  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Lisaxx
45 28/Jun/05 18:20  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=jackismck
41 29/Jun/05 17:59  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=katie296
41 28/Jun/05 19:05  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=putter
40 29/Jun/05 18:57  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Rose_Luna_Puff
38 27/Jun/05 19:29  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=rm
35 27/Jun/05 19:07  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=llmelville
34 22/Jun/05 20:55  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=buns2luv
33 16/Jun/05 18:33  /cgi-bin/chat/chat2.cgi?action=options_html&id=afyxysqwmvuykmvhtufqmqkkbxuess
33 29/Jun/05 21:12  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=TJJ
27 25/Jun/05 16:55  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=anthonylover412
27 29/Jun/05 19:35  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Hopnoodle
25 23/Jun/05 20:46  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=SunStar85
25 17/Jun/05 17:26  /cgi-bin/chat/chat2.cgi?action=options_html&id=xhcwimvbhczxtiybqqsiumtzvobvok
24 29/Jun/05 20:14  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=LapLap
24 18/Jun/05 20:48  /cgi-bin/chat/chat2.cgi?action=options_html&id=kpkcxdvzuhulltnhpmiuegnbagjuaj
24 26/Jun/05 20:37  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=BekasBunnies
23 17/Jun/05 19:03  /cgi-bin/chat/chat2.cgi?
21 28/Jun/05 21:35  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Snowfyre
21 27/Jun/05 20:34  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=MJCHIKA
21 25/Jun/05 17:01  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=luv4bunnies79
20  3/Jun/05 20:03  /cgi-bin/chat/chat2.cgi?action=changeuserinfo&id=leppsrznxpzftykxwvgeuevtzzhhrj
20  5/Jun/05 18:43  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=monkeykidder
20 27/Jun/05 19:25  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Angel_Hallie
19 23/Jun/05 20:23  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=wharf
19 18/Jun/05 20:13  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=princess101
18 23/Jun/05 17:18  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Nanoke2004
18 28/Jun/05 19:21  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=L.A.B.B.
17 28/Jun/05 21:26  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=legzandwheelz
17 29/Jun/05 20:48  /cgi-bin/chat/chat2.cgi?action=rooms&id=icrgawmdbblefozlijasryidawpvot
16 22/Jun/05 19:08  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=kanga445
16 25/Jun/05 19:53  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=ticklemeyellow24
15 28/Jun/05 17:55  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=wtiggr
15 17/Jun/05 16:19  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=jan.ice
15 18/Jun/05 20:18  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Aura
14 12/Jun/05 13:04  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=raboi
14  5/Jun/05 20:25  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Gretchen
13 24/Jun/05 19:54  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=AuroraS
13 28/Jun/05 21:08  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Raby
13  5/Jun/05 19:59  /cgi-bin/chat/chat2.cgi?action=rooms&id=zxrhzgtlaqtstxddaayqojvctfjkfs
13 28/Jun/05 17:34  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=CookiesMom
12 23/Jun/05 20:14  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=KatieBunnyGirl
12 17/Jun/05 19:03  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=jamster
12  6/Jun/05 19:45  /cgi-bin/chat/chat2.cgi?action=rooms&id=ohjabgbaoupfnfidrrjpdfrapbmkkl
12 29/Jun/05 19:21  /cgi-bin/chat/chat2.cgi?action=rooms&id=qcpvcgauftpmaqlaaxietmaocybdyj
12 28/Jun/05 19:38  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=ashleigh
10 17/Jun/05 20:21  /cgi-bin/chat/chat2.cgi?action=options_html&id=qtasamnochcitakenvapenzuxidptb
10 26/Jun/05 19:47  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=pottersmom
10  6/Jun/05 17:36  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=ladybug
10 12/Jun/05 18:18  /cgi-bin/chat/chat2.cgi?action=rooms&id=krgwekbjemyfwsgimbpfztxqulslre
10 10/Jun/05 18:48  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=lopster-mobster-lobster
10 22/Jun/05 17:37  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=HyperCello
10 23/Jun/05 19:47  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=iluvbunnies004
8415 30/Jun/05 00:02/graphics/resources/red.gif
7361 0.14%29/Jun/05 23:20/faq/sections/housing.html
7336 0.31%29/Jun/05 23:57/graphics/babies/babiesnow.jpg
7197 0.27%29/Jun/05 23:58/graphics/fun/netbunnies/lucky-nuui1.jpg
7177 0.08%30/Jun/05 00:05/care/veggies.html
6880 0.11%30/Jun/05 00:00/faq/sections/toys.html
6843 0.01%30/Jun/05 00:03/graphics/houserabbitsociety.gif
6830 0.13%30/Jun/05 00:06/chapters/
6770 0.19%29/Jun/05 23:59/graphics/fun/netbunnies/annie-berrie1.jpg
6692 0.08%29/Jun/05 23:55/journal/3-9/cute-quotes.html
6560 0.02%29/Jun/05 23:55/graphics/hrs.gif
6371 0.06%29/Jun/05 23:55/journal/3-9/graphics/6.gif
6334 0.10%29/Jun/05 23:23/care/newborn.html
6320 0.02%30/Jun/05 00:04/graphics/link-hrsz.gif
6289 0.07%29/Jun/05 23:55/journal/3-9/graphics/1.gif
6289 0.14%30/Jun/05 00:04/care/living-with-a-house-rabbit.html
6273 0.15%29/Jun/05 23:29/faq/sections/spay-neuter.html
5980 0.06%29/Jun/05 23:55/journal/3-9/graphics/2.gif
5961 0.12%30/Jun/05 00:05/faq/sections/medical.html
5861 0.06%29/Jun/05 23:55/journal/3-9/graphics/5.gif
5859 0.28%29/Jun/05 23:15/care/babies.html
5854 0.02%29/Jun/05 23:35/graphics/banners/opinion-l.gif
5851 0.05%29/Jun/05 23:55/journal/3-9/graphics/3.gif
5847 0.06%29/Jun/05 23:55/journal/3-9/graphics/4.gif
5841 29/Jun/05 23:35/graphics/banners/opinion-r.gif
5801 0.07%29/Jun/05 23:55/journal/3-9/graphics/7.gif
5781 0.07%29/Jun/05 23:55/journal/3-9/graphics/8.gif
5703 29/Jun/05 22:59/graphics/banners/links-r.gif
5697 0.02%29/Jun/05 22:59/graphics/banners/links-l.gif
5641 0.05%29/Jun/05 22:13/hrs-info/
5624 0.03%29/Jun/05 23:50/links/rabbit-pictures.html
5529 0.10%29/Jun/05 23:52/care/vets.html
5368 0.50%29/Jun/05 23:15/graphics/babies/sixteenday.jpg
5318 0.09%29/Jun/05 23:20/chapters/san-diego/adoption/graphics/adoption_headergraphic_v2.jpg
5205 0.06%29/Jun/05 23:20/journal/hrj-gallery.html
5175 0.02%30/Jun/05 00:06/graphics/banners/chapters-l.gif
5144 0.02%29/Jun/05 23:15/graphics/banners/kids-l.gif
5129 30/Jun/05 00:06/graphics/banners/chapters-r.gif
5129 29/Jun/05 23:16/graphics/banners/kids-r.gif
4917 0.06%29/Jun/05 23:15/kids/
4894 0.11%29/Jun/05 23:04/care/orphan.html
4864 0.08%29/Jun/05 23:58/chapters/san-diego/behavior/graphics/behavior_headergraphic_v2.jpg
4815 0.33%29/Jun/05 23:15/graphics/babies/nestbabyfirst.jpg
4749 0.11%29/Jun/05 23:20/graphics/hrs-rabbits/cecil.gif
4739 0.25%30/Jun/05 00:00/graphics/fun/netbunnies/willow-having-a-chat.jpg
4729 0.02%29/Jun/05 23:15/graphics/babies/kplogo.gif
4679 0.06%30/Jun/05 00:02/graphics/books/hrh.gif
4622 0.11%29/Jun/05 23:20/graphics/hrs-rabbits/benny.gif
4598 0.06%29/Jun/05 23:26/graphics/hrs-rabbits/sara.gif
4576 0.07%29/Jun/05 23:58/chapters/san-diego/diet/graphics/diet_headergraphic_v2.jpg
4575 0.13%29/Jun/05 23:20/graphics/hrs-rabbits/freckels.gif
4572 0.45%29/Jun/05 22:48/graphics/hrs-rabbits/minnie-in-tunnel.gif
4552 0.07%30/Jun/05 00:02/care/drollery.html
4552 0.04%29/Jun/05 22:48/graphics/hrs-rabbits/guy.gif
4532 0.09%29/Jun/05 22:48/graphics/hrs-rabbits/jimmy.gif
4498 0.08%29/Jun/05 22:48/graphics/hrs-rabbits/petunia.gif
4493 0.09%29/Jun/05 22:48/graphics/hrs-rabbits/ruby.gif
4392 0.16%29/Jun/05 23:43/rabbit-center/
4388 30/Jun/05 00:05/robots.txt
4374 0.07%29/Jun/05 22:48/graphics/hrs-rabbits/thomas.gif
4343 0.08%29/Jun/05 22:48/graphics/hrs-rabbits/three-spots.gif
4328 0.06%29/Jun/05 22:48/graphics/hrs-rabbits/tinket-bell.gif
4311 0.11%29/Jun/05 22:48/graphics/hrs-rabbits/vanessa.gif
4300 0.34%29/Jun/05 23:28/graphics/mine/king-foo.gif
4291 0.08%29/Jun/05 22:48/graphics/hrs-rabbits/walter.gif
4147 0.02%29/Jun/05 23:28/graphics/mine/baby-zowie-profile-l.gif
4146 0.02%29/Jun/05 23:28/graphics/mine/baby-zowie-profile-r.gif
4139 0.09%29/Jun/05 23:04/graphics/brushbaby.jpg
4109 0.09%29/Jun/05 23:28/graphics/mine/foo-t.jpg
4086 0.16%29/Jun/05 23:28/graphics/mine/izzy-zippy.gif
4059 0.25%29/Jun/05 23:28/graphics/mine/foo-zippy-by-comp.gif
4050 0.17%29/Jun/05 23:28/graphics/mine/foo-zowie-by-tv.gif
4017 0.15%29/Jun/05 23:28/graphics/mine/zowie-on-bed.gif
4001 0.27%29/Jun/05 23:28/graphics/mine/zowie-on-couch.gif
3952 0.35%29/Jun/05 23:28/graphics/mine/mom-zippy.gif
3898 0.08%29/Jun/05 23:01/links/mail-order-resources.html
3708 29/Jun/05 23:36/graphics/bunny-butt.gif
3700 0.04%29/Jun/05 22:48/links/
3593 0.06%29/Jun/05 23:50/links/story-of-foobar-1.html
3511 0.17%29/Jun/05 23:55/graphics/fun/netbunnies/GaryMaggie-Bottorff1.jpg
3460 0.08%29/Jun/05 23:43/rabbit-center/randomize/image9.gif
3446 0.09%29/Jun/05 23:43/rabbit-center/randomize/image7.gif
3444 0.06%29/Jun/05 23:32/faq/sections/vet.html
3433 0.08%29/Jun/05 23:43/rabbit-center/randomize/image11.gif
3432 0.11%29/Jun/05 23:50/graphics/fun/netbunnies/bunny-hays1.jpg
3415 0.10%29/Jun/05 23:43/rabbit-center/randomize/image5.gif
3381 0.08%29/Jun/05 23:43/rabbit-center/randomize/image4.gif
3368 0.08%29/Jun/05 23:43/rabbit-center/randomize/image3.gif
3352 29/Jun/05 23:33/rabbit-center/graphics/resources/pixel.gif
3347 0.08%29/Jun/05 23:33/rabbit-center/randomize/image2.gif
3331 0.04%29/Jun/05 23:33/rabbit-center/randomize/image10.jpg
3308 0.13%29/Jun/05 23:33/rabbit-center/graphics/bun.gif
3288 0.06%29/Jun/05 23:33/rabbit-center/randomize/image1.gif
3288 0.09%29/Jun/05 20:42/rabbit-center/rabbit_ofthe_month/may05/images/lily_small.gif
3265 0.04%29/Jun/05 23:33/rabbit-center/graphics/adoption-center-banner_gr.gif
3255 0.07%29/Jun/05 23:33/rabbit-center/randomize/image8.gif
3224 29/Jun/05 23:33/rabbit-center/graphics/icon_rabbit_r.gif
3216 0.11%29/Jun/05 23:56/chapters/san-diego/
3212 29/Jun/05 23:33/rabbit-center/graphics/icon_events.gif
3210 0.03%29/Jun/05 23:33/rabbit-center/events/images/arf.jpg
3210 0.09%29/Jun/05 23:33/rabbit-center/retail/images/lavbun.jpg
3206 0.01%29/Jun/05 23:33/rabbit-center/graphics/icon_news_update.gif
3192 0.01%29/Jun/05 23:33/rabbit-center/graphics/icon_donation.gif
3186 0.03%29/Jun/05 23:47/care/fruits.html
3183 0.01%29/Jun/05 23:33/rabbit-center/graphics/icon_adopt_rabbit.gif
3177 0.01%29/Jun/05 23:33/rabbit-center/graphics/icon_boarding.gif
3170 29/Jun/05 23:33/rabbit-center/graphics/icon_services.gif
3165 0.01%29/Jun/05 23:33/rabbit-center/graphics/icon_get_involved.gif
3163 0.01%29/Jun/05 23:33/rabbit-center/graphics/icon_bunny_buddy.gif
3158 0.03%29/Jun/05 23:21/fun/izzy-zowie/
3148 0.02%29/Jun/05 23:46/graphics/link-hrslogo.gif
3147 0.05%29/Jun/05 23:42/vets/
3146 0.03%29/Jun/05 23:50/graphics/mine/foo/2-pumpkin-foo-50.jpg
3138 0.03%29/Jun/05 23:50/graphics/mine/foo/3-under-bed-50.jpg
3132 0.09%29/Jun/05 23:50/graphics/mine/foo/gifs/1-baby-foo-25.gif
3130 0.08%29/Jun/05 23:29/journal/1/liver-disease.html
3122 0.05%29/Jun/05 23:50/graphics/mine/foo/4-under-bed-50.jpg
3122 0.05%29/Jun/05 23:50/graphics/mine/foo/6-licking-50.jpg
3117 0.05%29/Jun/05 23:50/graphics/mine/foo/5-under-table-50.jpg
3101 0.04%29/Jun/05 23:50/graphics/mine/foo/7-by-couch-50.jpg
3088 0.04%29/Jun/05 23:50/graphics/mine/foo/8-zowie-holiday-inn-50.jpg
2960 0.15%29/Jun/05 22:20/graphics/fun/netbunnies/3bunnies-chercat1.jpg
2942 0.49%29/Jun/05 23:35/rabbit-center/adoptables/
2915 0.01%29/Jun/05 21:32/cgi-bin/postcard.cgi
10  8/Jun/05 19:11  /cgi-bin/postcard.cgi?code=1118124955j-donegan@pacbell.net
10 20/Jun/05 16:01  /cgi-bin/postcard.cgi?code=1118005472fjcooke@sasktel.net
2850 0.02%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_AlfieAndy_Apr05b.jpg
2827 0.12%29/Jun/05 23:39/graphics/fun/netbunnies/0246.jpg
2761 0.08%29/Jun/05 23:29/care/vhd.html
2710 0.06%29/Jun/05 23:48/faq/sections/hazards.html
2705 0.07%29/Jun/05 23:57/chapters/san-diego/health/sick.html
2681 0.07%29/Jun/05 22:46/faq/sections/aggression.html
2669 29/Jun/05 23:06/chapters/san-diego/navfront_behavioroff.gif
2667 29/Jun/05 23:06/chapters/san-diego/navfront_dietoff.gif
2636 0.08%29/Jun/05 23:32/faq/sections/training.html
2625 0.04%29/Jun/05 23:33/faq/sections/warm-weather.html
2611 0.01%29/Jun/05 23:06/chapters/san-diego/navfront_healthoff.gif
2600 0.05%29/Jun/05 22:16/graphics/postcard/Muggs.jpg
2589 0.01%29/Jun/05 23:06/chapters/san-diego/navfront_productsoff.gif
2588 29/Jun/05 23:06/chapters/san-diego/navfront_adoptionoff.gif
2574 0.06%29/Jun/05 23:41/faq/sections/introductions.html
2566 29/Jun/05 22:52/graphics/babies/
15 28/Jun/05 19:22  /graphics/babies/?N=D
14 28/Jun/05 19:19  /graphics/babies/?D=A
11 28/Jun/05 19:21  /graphics/babies/?M=A
10 28/Jun/05 19:20  /graphics/babies/?S=A
2565 0.01%29/Jun/05 23:06/chapters/san-diego/navfront_aboutusoff.gif
2552 0.04%29/Jun/05 23:59/easter/
2547 0.06%29/Jun/05 23:57/journal/3-4/two-rabbits.html
2537 0.11%29/Jun/05 23:57/graphics/fun/netbunnies/2dumb.jpg
2530 0.03%29/Jun/05 22:03/care/facts.html
2514 0.06%29/Jun/05 23:24/faq/sections/groom.html
2504 0.06%29/Jun/05 23:25/graphics/fun/netbunnies/2bunnies8-agape1.jpg
2501 0.01%29/Jun/05 23:06/chapters/san-diego/navfront_adoptionon.gif
2491 0.01%29/Jun/05 23:06/chapters/san-diego/navfront_dieton.gif
2488 0.07%29/Jun/05 23:38/graphics/fun/netbunnies/1016sleepycuddle.jpg
2479 0.01%29/Jun/05 23:06/chapters/san-diego/navfront_behavioron.gif
2473 0.03%29/Jun/05 21:16/graphics/fun/netbunnies/P1010005.jpg
2449 0.01%29/Jun/05 23:06/chapters/san-diego/donateoff.gif
2445 0.03%29/Jun/05 23:20/journal/3-11/legs.html
2438 0.01%29/Jun/05 23:06/chapters/san-diego/navfront_healthon.gif
2416 0.01%29/Jun/05 23:06/chapters/san-diego/navfront_productson.gif
2414 0.07%29/Jun/05 23:06/chapters/san-diego/rabbits.jpg
2404 0.04%29/Jun/05 23:52/faq/sections/outdoors.html
2403 0.01%29/Jun/05 23:06/chapters/san-diego/navfront_aboutuson.gif
2402 0.01%29/Jun/05 23:06/chapters/san-diego/front_top.gif
2397 0.01%29/Jun/05 23:06/chapters/san-diego/sandiego_.gif
2397 0.12%29/Jun/05 23:20/journal/3-11/graphics/feet-out-on-couch.gif
2393 0.01%29/Jun/05 23:06/chapters/san-diego/society.gif
2392 0.01%29/Jun/05 22:54/graphics/links/japanese.gif
2391 0.01%29/Jun/05 23:06/chapters/san-diego/houserabbit.gif
2387 0.01%29/Jun/05 23:06/chapters/san-diego/sandieg_2.gif
2382 29/Jun/05 23:06/chapters/san-diego/yourresource.gif
2378 0.03%29/Jun/05 23:46/journal/1/rabbit-run.html
2364 0.01%29/Jun/05 23:06/chapters/san-diego/rabbits2.jpg
2357 0.05%29/Jun/05 23:21/fun/izzy-zowie/izzy-up-t.jpg
2338 29/Jun/05 23:06/chapters/san-diego/quiz.gif
2319 29/Jun/05 22:33/styles/joining.css
2318 0.04%29/Jun/05 23:38/faq/sections/chewing.html
2313 0.04%29/Jun/05 23:21/fun/izzy-zowie/izzy-zowie.jpg
2285 0.03%29/Jun/05 23:21/fun/izzy-zowie/izzy-portrait-t.jpg
2264 0.04%29/Jun/05 23:21/fun/izzy-zowie/izzy-t.jpg
2263 0.01%29/Jun/05 23:06/chapters/san-diego/donateon.gif
2260 0.04%29/Jun/05 23:21/fun/izzy-zowie/zowie2-t.jpg
2257 0.05%29/Jun/05 23:21/fun/izzy-zowie/who-me-t.jpg
2248 0.04%29/Jun/05 23:21/fun/izzy-zowie/zowie1-t.jpg
2245 0.05%29/Jun/05 23:21/fun/izzy-zowie/zowie-izzy-t.jpg
2245 0.03%30/Jun/05 00:00/stories/
2240 29/Jun/05 23:42/graphics/banners/vets-r.gif
2234 0.01%29/Jun/05 23:42/graphics/banners/vets-l.gif
2230 0.04%29/Jun/05 23:20/journal/3-11/graphics/laying-out-by-wall.gif
2224 0.01%29/Jun/05 23:35/rabbit-center/adoptables/header_gr.gif
2221 0.02%29/Jun/05 23:20/journal/3-11/graphics/flopped-on-each-other.gif
2216 0.07%29/Jun/05 23:21/fun/izzy-zowie/carl-chasing-izzy-t.jpg
2215 0.24%29/Jun/05 23:45/graphics/fun/netbunnies/2-rabbits-outside.jpg
2207 0.01%29/Jun/05 22:55/rabbit-center/graphics/header.gif
2202 0.42%29/Jun/05 23:35/rabbit-center/adoptables/graphics/big/duncansiliconvalley.JPG
2182 0.01%29/Jun/05 23:36/links/zippy-izzy.html
2167 29/Jun/05 23:35/rabbit-center/adoptables/adopt-t.gif
2154 0.04%29/Jun/05 23:20/chapters/san-diego/adoption/
2139 0.03%29/Jun/05 22:19/cgi-bin/print-article.cgi
2134 0.03%30/Jun/05 00:06/fun/ascii-art.html
2134 0.01%29/Jun/05 23:35/rabbit-center/adoptables/images/lily_small.jpg
2121 0.09%30/Jun/05 00:06/graphics/fun/netbunnies/2buns-herrington1.jpg
2088 0.18%29/Jun/05 23:39/graphics/fun/netbunnies/2-white-rabbits-cushons.jpg
2074 0.08%29/Jun/05 23:38/graphics/fun/netbunnies/bunnies-cook1.jpg
2057 0.11%29/Jun/05 23:58/graphics/fun/netbunnies/bunny-wai1.jpg
2055 0.17%29/Jun/05 23:35/rabbit-center/adoptables/graphics/big/bigwig.jpg
2053 29/Jun/05 23:53/spam_vaccine/at_medium.gif
2042 0.15%29/Jun/05 23:44/journal/
2036 0.05%29/Jun/05 23:01/graphics/fun/netbunnies/Lapin-profil.jpg
2029 0.12%29/Jun/05 22:10/hrs-info/contacts.html
2023 0.06%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/dante04tiny.jpg
2000 0.06%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/basil46tiny.jpg
1994 0.05%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/helga25tiny.jpg
1989 0.05%29/Jun/05 23:58/chapters/san-diego/behavior/
1971 0.04%30/Jun/05 00:06/faq/sections/treat.html
1970 0.01%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/baloo-tiny.jpg-41
1969 0.03%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/sara1-tiny.jpg
1966 0.05%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/hazel55tiny.jpg
1956 0.13%29/Jun/05 20:20/rabbit-center/adoptables/graphics/thumb/Eva31sml.jpg
1955 0.12%29/Jun/05 23:35/rabbit-center/adoptables/graphics/big/artemis06sml.jpg
1954 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/r835heidi25tiny.jpg
1949 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/r834hayley11tiny.jpg
1944 0.05%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/adam r1432 32tiny.jpg
1941 0.02%29/Jun/05 23:36/graphics/mine/emmybunny-s.gif
1936 0.08%29/Jun/05 23:36/faq/sections/children.html
1932 0.04%29/Jun/05 23:36/graphics/mine/zippy2-s.gif
1932 0.04%29/Jun/05 23:36/graphics/mine/zippy1-s.gif
1924 0.03%29/Jun/05 23:36/graphics/mine/zippy3-s.gif
1911 0.06%29/Jun/05 23:35/rabbit-center/adoptables/graphics/big/Spike25sml.jpg
1890 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/big/sasparilla22tiny.jpg
1889 0.06%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/phoebe13tiny.jpg
1873 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/patootie-r1295-27tiny.jpg
1871 0.09%29/Jun/05 23:06/graphics/fun/netbunnies/panda-rudd1.jpg
1871 0.05%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/sailor11tiny.jpg
1869 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/julie03tiny.jpg
1861 0.05%29/Jun/05 22:54/links/translate.html
1857 0.08%29/Jun/05 21:52/graphics/fun/netbunnies/cute-jones1.jpg
1839 0.05%29/Jun/05 23:25/graphics/fun/netbunnies/2bunnies7-agape1.jpg
1839 0.10%29/Jun/05 23:35/rabbit-center/adoptables/graphics/big/ebony.jpg
1835 0.05%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/natasha03tiny.jpg
1822 0.03%29/Jun/05 21:32/journal/4-3/new-home.html
1818 0.02%29/Jun/05 23:29/journal/1/rejection.html
1816 0.03%30/Jun/05 00:01/care/box-toy.html
1811 0.01%29/Jun/05 23:35/rabbit-center/adoptables/images/altimage.gif
1807 0.05%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/mohawk r1424 09tiny.jpg
1803 0.05%29/Jun/05 23:21/journal/3-6/chew-stick.html
1802 0.05%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/thomyorke r1421 39tiny.jpg
1802 0.03%29/Jun/05 23:09/journal/3-1/just-for-fun.html
1801 0.05%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/johnnyramone r1418 25tiny.jpg
1800 0.04%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/lindaperry r1420 56tiny.jpg
1798 0.05%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/johncoltrane r1417 36tiny.jpg
1794 0.01%29/Jun/05 22:17/chat/
1792 0.05%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/bounce27tiny.jpg
1782 0.05%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/fred r1412-09tiny.jpg
1779 0.05%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/debbie r1411 09tiny.jpg
1776 0.04%29/Jun/05 23:42/chapters/san-diego/health/
1774 0.05%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/tia r1409 06tiny.jpg
1774 0.05%29/Jun/05 20:20/rabbit-center/adoptables/graphics/thumb/mariam r1414 62tiny.jpg
1773 0.08%29/Jun/05 21:25/graphics/fun/netbunnies/Annabelle-Geisler1.jpg
1770 0.06%29/Jun/05 22:05/graphics/fun/netbunnies/fuzzy-link1.jpg
1760 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/satin-r1308-01tiny.jpg
1752 0.03%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/annie05tiny.jpg
1750 0.02%29/Jun/05 23:35/rabbit-center/adoptables/images/zela31tiny.jpg
1749 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/charms-r1352-47tiny.jpg
1747 0.02%29/Jun/05 23:35/rabbit-center/adoptables/images/venus06tiny.jpg
1746 0.02%29/Jun/05 20:20/rabbit-center/adoptables/graphics/thumb/yuna-r1395-16tiny.jpg
1746 0.02%29/Jun/05 23:35/rabbit-center/adoptables/images/eileen_small.gif
1743 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/michael046tiny.jpg
1742 0.03%29/Jun/05 22:35/journal/2-11/cats-and-rabbits.html
1740 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/lewis122tiny.jpg
1739 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/richard131tiny.jpg
1736 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/johanna095tiny.jpg
1732 0.03%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/danny116tiny.jpg
1729 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/frankie041tiny.jpg
1728 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/benton111tiny.jpg
1725 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/angel062tiny.jpg
1724 0.01%29/Jun/05 23:35/rabbit-center/adoptables/images/jenny_small.jpg
1722 0.03%29/Jun/05 22:21/graphics/fun/netbunnies/Bear-Zehpyr1.jpg
1721 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/ichiro12tiny.jpg
1718 0.03%29/Jun/05 22:13/hrs-info/joining.html
1718 0.04%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/berklee03tiny.jpg
1712 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/peaches26tiny.jpg
1709 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/gretchen15tiny.jpg
1707 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/timothy27tiny.jpg
1706 0.03%29/Jun/05 23:17/chapters/san-diego/diet/
1706 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/anusha07tiny.jpg
1702 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/bungee08tiny.jpg
1701 0.10%29/Jun/05 23:39/graphics/fun/netbunnies/1.jpg
1701 0.11%29/Jun/05 23:35/rabbit-center/adoptables/images/mazi_000.gif
1697 0.03%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/buzz25tiny.jpg
1695 0.13%29/Jun/05 23:35/rabbit-center/adoptables/images/mr_missy.gif
1694 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/moca+bean30tiny.jpg
1693 0.04%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/julliette64tiny.jpg
1691 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/valentino02tiny.jpg
1689 0.03%29/Jun/05 23:23/journal/2-8/honorary-rabbit.html
1686 0.03%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/Brittany.jpg
1674 0.02%29/Jun/05 23:35/rabbit-center/adoptables/images/r1165claudia096tiny.jpg
1672 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/r1215sami16tiny.jpg
1671 0.02%29/Jun/05 23:35/rabbit-center/adoptables/images/r1179josephine62tiny.jpg
1669 0.02%29/Jun/05 23:35/rabbit-center/adoptables/images/phoebe2_64tiny.jpg
1668 0.03%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/r1180anabelle40tiny.jpg
1666 0.02%29/Jun/05 23:35/rabbit-center/adoptables/images/r1071honda58tiny.jpg
1665 0.02%29/Jun/05 23:35/rabbit-center/adoptables/images/casey43tiny.jpg
1665 0.03%29/Jun/05 23:35/rabbit-center/adoptables/images/honey32tiny.jpg
1664 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/r967natalia19tiny.jpg
1661 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/r1009greta08tiny.jpg
1659 0.02%29/Jun/05 23:35/rabbit-center/adoptables/images/poppy49tiny.jpg
1658 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/r1017mini81tiny.jpg
1655 0.02%29/Jun/05 23:35/rabbit-center/adoptables/images/r1034sergio61tiny.jpg
1654 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/r934brownie16tiny.jpg
1653 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/r963teddy2-13tiny.jpg
1652 0.02%29/Jun/05 23:35/rabbit-center/adoptables/graphics/thumb/r964emma2-21tiny.jpg
1646 0.02%29/Jun/05 22:58/faq/sections/handling.html
1644 0.03%29/Jun/05 22:36/journal/1/dogs.html
1636 0.11%29/Jun/05 23:19/graphics/fun/netbunnies/3rabbitsonchair.jpg
1634 0.08%29/Jun/05 22:34/graphics/fun/netbunnies/Bunny-Davis1.jpg
1631 0.04%29/Jun/05 21:38/journal/2-4/emergency-preparedness.html
1601 0.27%29/Jun/05 22:54/graphics/links/chinese.bmp
1595 29/Jun/05 22:54/graphics/links/hebrew.gif
1594 0.06%30/Jun/05 00:02/graphics/fun/netbunnies/sedona-shopping.jpg
1591 0.03%29/Jun/05 23:46/faq/sections/rabbit-proofing.html
1589 0.01%30/Jun/05 00:00/graphics/banners/stories-l.gif
1586 0.01%29/Jun/05 23:21/journal/3-6/graphics/tossing-2.gif
1585 0.01%29/Jun/05 23:21/journal/3-6/graphics/tossing-3.gif
1584 30/Jun/05 00:00/graphics/banners/stories-r.gif
1580 0.01%29/Jun/05 23:21/journal/3-6/graphics/tossing-1.gif
1579 0.04%29/Jun/05 23:21/journal/3-6/graphics/baskets-pinecones.gif
1579 0.01%29/Jun/05 23:21/journal/3-6/graphics/tossing-4.gif
1577 0.04%29/Jun/05 23:21/journal/3-6/graphics/basket-keys.gif
1577 29/Jun/05 22:54/graphics/links/araanib.gif
1576 0.02%29/Jun/05 23:21/journal/3-6/graphics/lop-in-basket.gif
1573 29/Jun/05 22:54/graphics/links/arneb.gif
1570 0.02%29/Jun/05 23:21/journal/3-6/graphics/digging.gif
1567 0.06%29/Jun/05 23:21/journal/3-6/graphics/under-chair.gif
1567 0.01%29/Jun/05 23:21/journal/3-6/graphics/batting-toys.gif
1563 29/Jun/05 22:54/graphics/links/Persian.gif
1560 29/Jun/05 22:54/graphics/links/youn.gif
1556 0.03%29/Jun/05 23:09/journal/3-1/graphics/trio-3.gif
1551 0.03%29/Jun/05 23:09/journal/3-1/graphics/trio-2.gif
1551 29/Jun/05 22:54/graphics/links/tibet.gif
1551 0.03%29/Jun/05 23:09/journal/3-1/graphics/trio-1.gif
1546 0.02%29/Jun/05 22:42/journal/2-7/max.html
1540 0.03%29/Jun/05 22:53/journal/4-4/pen-living.html
1531 0.01%29/Jun/05 23:33/rabbit-center/graphics/header_gr.gif
1521 0.04%29/Jun/05 23:52/graphics/fun/netbunnies/bugs-arobinson1.jpg
1520 0.02%29/Jun/05 22:37/graphics/fun/netbunnies/Rabbits5.jpg
1502 0.02%29/Jun/05 21:32/postcard/
1489 0.05%29/Jun/05 22:46/rabbit-center/hayward_rabbits.html
1472 0.04%29/Jun/05 23:52/journal/4-4/tough-bonding.html
1457 0.03%29/Jun/05 23:58/chapters/san-diego/diet/hay_grass.html
1424 29/Jun/05 23:36/rabbit-center/lucky/css/mm_health_nutr.css
1424 0.03%29/Jun/05 23:38/graphics/fun/netbunnies/peach-herrington1.jpg
1407 0.52%29/Jun/05 23:57/chapters/san-diego/adoption/colorbook.pdf
1407 0.05%29/Jun/05 22:20/graphics/fun/netbunnies/6V46_006.jpg
1401 0.03%29/Jun/05 22:24/hrs-info/feedback.html
1396 0.10%29/Jun/05 22:20/graphics/fun/netbunnies/2rabbitsinbasketjanwild.jpg
1393 0.03%29/Jun/05 22:13/links/sections/groups.html
1388 0.02%29/Jun/05 22:42/journal/2-7/graphics/black-max.gif
1370 0.05%29/Jun/05 23:17/chapters/san-diego/adoption/Cages/cage.html
1358 0.04%29/Jun/05 21:52/graphics/fun/netbunnies/leah-nancy1.jpg
1357 0.03%29/Jun/05 22:18/faq/sections/multiple.html
1345 0.02%29/Jun/05 22:24/chapters/san-diego/diet/foods.html
1343 0.03%29/Jun/05 23:46/graphics/misc/cable-wrap-pkg.jpg
1336 0.02%29/Jun/05 23:46/graphics/misc/wrapped-cord.jpg
1327 0.03%29/Jun/05 23:20/graphics/fun/netbunnies/xmasweb-hyperchick1.jpg
1321 0.03%29/Jun/05 23:58/chapters/san-diego/diet/graphics/timothy.jpg
1319 0.06%29/Jun/05 22:20/graphics/fun/netbunnies/6V46_003.jpg
1315 0.04%29/Jun/05 23:58/chapters/san-diego/diet/graphics/alfalfa.jpg
1315 0.02%29/Jun/05 22:19/fun/biscuts.html
1312 0.02%29/Jun/05 23:37/journal/2-12/fly-strike.html
1312 0.02%29/Jun/05 23:22/chapters/san-diego/aboutus/graphics/aboutus_headergraphic_v2.jpg
1312 0.05%29/Jun/05 23:58/chapters/san-diego/diet/graphics/bermuda.jpg
1312 0.01%29/Jun/05 22:48/hrs-info/whats-popular.html
1311 0.02%29/Jun/05 22:21/journal/3-1/games-rabbits-play.html
1304 0.03%29/Jun/05 23:58/chapters/san-diego/diet/graphics/oat.jpg
1301 0.02%29/Jun/05 21:56/journal/3-1/red-urine.html
1298 0.09%29/Jun/05 23:36/graphics/fun/netbunnies/2rabbitsoutsideleaves.jpg
1293 0.01%29/Jun/05 23:58/chapters/san-diego/diet/graphics/orchard_grass_small.jpg
1285 0.36%29/Jun/05 22:21/chapters/san-diego/diet/graphics/Food_Chart.pdf
1283 0.03%30/Jun/05 00:06/journal/3-8/head-tilt.html
1280 0.02%29/Jun/05 21:45/graphics/fun/netbunnies/funny.jpg
1269 0.03%29/Jun/05 23:03/journal/3-4/pellets.html
1262 0.02%29/Jun/05 22:24/hrs-info/whats-new.html
1259 0.01%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Kisser_4_Apr05.jpg
1255 0.02%29/Jun/05 23:36/rabbit-center/lucky_rescue.html
1254 0.02%29/Jun/05 22:44/journal/3-12/disabled-litter.html
1252 0.04%29/Jun/05 23:50/graphics/fun/netbunnies/slinky-Smudge1.jpg
1245 0.02%29/Jun/05 23:21/adoption/baby-bunnies.html
1242 0.02%29/Jun/05 22:12/journal/2-10/mellow-lops.html
1242 0.12%29/Jun/05 23:17/chapters/san-diego/diet/graphics/Food_pyramid.jpg
1227 29/Jun/05 21:30/cgi-bin/chat/chatgu.cgi
744 29/Jun/05 21:30  /cgi-bin/chat/chatgu.cgi?chat.cgi
18 24/Jun/05 21:15  /cgi-bin/chat/chatgu.cgi?http://i6.photobucket.com/albums/y212/Lisaxx/E1 and E2/E1E2bowl.jpg
13 28/Jun/05 14:14  /cgi-bin/chat/chatgu.cgi?http://i7.photobucket.com/albums/y278/Phantom_Gerard/Rubby004.jpg
11 26/Jun/05 18:39  /cgi-bin/chat/chatgu.cgi?http://i3.photobucket.com/albums/y95/BertsBarbieDoll/Bambi1.jpg
11 28/Jun/05 10:27  /cgi-bin/chat/chatgu.cgi?http://www.ralfchat.com
10 24/Jun/05 21:15  /cgi-bin/chat/chatgu.cgi?http://i6.photobucket.com/albums/y212/Lisaxx/E1 and E2/E.jpg
10 22/Jun/05 20:47  /cgi-bin/chat/chatgu.cgi?http://photobucket.com/albums/v497/jackfruit/?action=view&current=DSCN0130.jpg
1216 0.02%29/Jun/05 23:59/journal/3-11/lift.html
1213 0.10%29/Jun/05 23:07/chapters/san-diego/adoption/adoption_photos.html
1212 29/Jun/05 23:36/rabbit-center/lucky/images/mm_dashed_line.gif
1210 0.04%29/Jun/05 20:36/graphics/fun/netbunnies/bruno+leah1-nancy1.jpg
1210 0.05%29/Jun/05 23:42/graphics/fun/netbunnies/bunny-stak1.jpg
1207 0.04%29/Jun/05 22:03/graphics/fun/netbunnies/Snickers-Flanagan1.jpg
1206 29/Jun/05 23:36/rabbit-center/lucky/images/mm_spacer.gif
1204 0.10%29/Jun/05 21:39/graphics/fun/netbunnies/suki-1yr-rear-end.jpg
1201 0.01%29/Jun/05 22:13/help/
1185 0.06%29/Jun/05 23:24/graphics/fun/netbunnies/bunny-white.jpg
1182 29/Jun/05 23:40/links/foo.html
1173 0.03%29/Jun/05 22:47/rabbit-center/hayward_rescue/hayward_graphics/first_day.jpg
1163 29/Jun/05 23:39/graphics/fun/
33 28/Jun/05 13:50  /graphics/fun/?M=A
32 29/Jun/05 23:14  /graphics/fun/?D=A
29 29/Jun/05 07:42  /graphics/fun/?N=D
28 28/Jun/05 20:33  /graphics/fun/?M=D
27 29/Jun/05 06:08  /graphics/fun/?S=A
19 28/Jun/05 07:28  /graphics/fun/?N=A
18 29/Jun/05 15:15  /graphics/fun/?D=D
10 27/Jun/05 18:04  /graphics/fun/?S=D
1161 0.01%29/Jun/05 22:47/rabbit-center/graphics/header_gr_hw.gif
1149 0.02%29/Jun/05 23:40/journal/1/lap-rabbit.html
1144 0.04%29/Jun/05 19:25/graphics/fun/netbunnies/sexy-szafranski1.jpg
1141 0.11%29/Jun/05 23:17/chapters/san-diego/adoption/Cages/Libby_cage_setup.jpg
1134 0.06%29/Jun/05 22:47/graphics/fun/netbunnies/freddy-lalonde1.jpg
1133 0.05%29/Jun/05 23:20/graphics/fun/netbunnies/Athene-Owdicat1.jpg
1125 0.03%29/Jun/05 22:20/graphics/fun/netbunnies/8-28-20.jpg
1124 0.01%29/Jun/05 22:39/links/sections/reference.html
1119 0.04%29/Jun/05 22:21/graphics/fun/netbunnies/Baby_Honey-Simon1.jpg
1116 0.02%29/Jun/05 21:42/faq/sections/sources.html
1114 0.02%29/Jun/05 21:32/graphics/postcard/paddington-craddick-tmb.jpg
1114 0.04%29/Jun/05 23:17/chapters/san-diego/adoption/Cages/Cage-Dolce.jpg
1113 0.02%29/Jun/05 23:31/journal/3-3/age-related-behavior.html
1110 0.07%29/Jun/05 23:17/chapters/san-diego/adoption/Cages/Honey_famroom_pen.JPG
1109 0.05%29/Jun/05 22:21/graphics/fun/netbunnies/BBunny17-Myers1.jpg
1103 0.03%29/Jun/05 22:20/graphics/fun/netbunnies/BISCOTTO-Negro1.jpg
1103 0.06%29/Jun/05 22:20/graphics/fun/netbunnies/BabyBunnies-Kiddazzle1.jpg
1096 0.06%29/Jun/05 21:32/graphics/postcard/izzy-portrait-crop-tmb.jpg
1096 0.01%29/Jun/05 22:44/fun/answer.html
1093 0.02%29/Jun/05 21:32/graphics/postcard/lavender-tmb.jpg
1091 0.02%29/Jun/05 21:32/graphics/postcard/tabatha-tmb.jpg
1089 0.01%29/Jun/05 23:35/hrs-info/site-map.html
1088 0.01%29/Jun/05 21:32/graphics/postcard/willow-in-bed-teddy-tmb.jpg
1086 0.01%29/Jun/05 21:32/graphics/postcard/Tommy2-tmb.jpg
1086 29/Jun/05 16:08/graphics/easter/anti-victoria-circle.jpg
1085 0.01%29/Jun/05 21:32/graphics/postcard/Pl-sch10-tmb.jpg
1083 0.01%29/Jun/05 21:32/graphics/postcard/amos-tmb.jpg
1083 0.03%29/Jun/05 21:51/graphics/fun/netbunnies/baby-Jalasco1.jpg
1083 0.02%29/Jun/05 22:21/graphics/fun/netbunnies/BomBom-Southall1.jpg
1083 0.01%29/Jun/05 21:32/graphics/postcard/tracy-tmb.jpg
1081 0.01%29/Jun/05 21:32/graphics/postcard/Rab1-tmb.jpg
1080 0.03%29/Jun/05 21:31/graphics/fun/netbunnies/chandler-craig1.jpg
1079 0.02%29/Jun/05 21:32/graphics/postcard/strawberry-white-baby-tmb.gif
1078 0.02%29/Jun/05 23:21/chapters/san-diego/products/graphics/products_headergraphic_v2.jpg
1074 0.03%29/Jun/05 23:17/chapters/san-diego/adoption/Cages/Cage-LaceyBeau.jpg
1068 29/Jun/05 21:44/graphics/pixel.gif
1067 0.01%29/Jun/05 23:15/journal/3-1/graphics/herman.gif
1067 0.03%29/Jun/05 21:58/graphics/chinese-bunny.gif
1059 0.02%29/Jun/05 23:49/chapters/san-diego/health/poisonous.html
1059 0.07%29/Jun/05 23:17/chapters/san-diego/adoption/Cages/Alison_pen_1.JPG
1058 0.02%29/Jun/05 23:17/chapters/san-diego/adoption/Cages/Shelley_office_1.JPG
1055 0.01%29/Jun/05 22:53/journal/3-6/play-ed.html
1054 0.07%29/Jun/05 23:17/chapters/san-diego/adoption/Cages/Alison_pen_2.JPG
1053 0.03%29/Jun/05 22:04/faq/sections/rescue.html
1053 0.01%29/Jun/05 21:12/health/exotic-diseases.html
1050 0.02%29/Jun/05 23:21/journal/1/place-space.html
1047 0.04%29/Jun/05 23:17/chapters/san-diego/adoption/Cages/LeithPetwerks_condo.JPG
1033 0.06%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Bandit_3_19May05.jpg
1031 0.04%29/Jun/05 23:59/journal/3-11/graphics/pickup123.gif
1031 0.02%29/Jun/05 23:59/journal/3-11/graphics/pickup4.gif
1030 0.04%29/Jun/05 23:36/rabbit-center/lucky/images/lucky_1_002.gif
1029 0.03%29/Jun/05 23:17/chapters/san-diego/adoption/Cages/Bess_cage.JPG
1028 0.03%29/Jun/05 22:20/graphics/fun/netbunnies/9.jpg
1027 0.04%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Bonnie_3_Jan05.jpg
1022 0.02%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Rachel_2_Apr05.jpg
1016 0.03%29/Jun/05 20:54/graphics/fun/netbunnies/buddies-broley1.jpg
1013 0.14%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Leeland.jpg
1012 0.01%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Madeline_2_Feb05.jpg
1011 0.02%30/Jun/05 00:06/journal/3-8/graphics/head-tilt.gif
1010 0.03%29/Jun/05 22:20/graphics/fun/netbunnies/BabySammy-Singleton1.jpg
1009 0.02%29/Jun/05 22:37/chapters/san-diego/health/vet-talk/pasteurella.html
1008 0.03%29/Jun/05 23:17/chapters/san-diego/adoption/Cages/Patio_setup_1.JPG
1007 0.02%29/Jun/05 22:22/graphics/fun/netbunnies/Asher2-Denise1.jpg
1006 0.11%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_NatashaBeau3_Jan05.jpg
1000 0.49%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Taxi-Tuxedo_May05.jpg
998 0.01%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Daisy2_Jan05.jpg
995 0.01%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Savannah_Feb05.jpg
994 0.01%29/Jun/05 22:33/journal/2-7/letterman.html
993 0.07%29/Jun/05 22:21/graphics/fun/netbunnies/Ben-Trent1.jpg
993 0.03%29/Jun/05 21:35/journal/3-2/e-cuniculi.html
981 0.01%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Jasper_17Aug04.jpg
980 0.01%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Sammie_4_Mar05.jpg
975 0.06%29/Jun/05 21:50/graphics/fun/netbunnies/my bunnies-sukiennik1.jpg
972 0.01%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Taylor_Dec04.jpg
970 0.01%29/Jun/05 21:38/care/medical-leads.html
966 0.02%29/Jun/05 22:38/journal/2-5/men-women-bunnies.html
961 0.03%29/Jun/05 23:25/graphics/fun/netbunnies/Biba-Vangeel1.jpg
958 0.01%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Samantha_Nov04.jpg
957 0.01%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Lilly_2_Jun04.JPG
955 0.02%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Honey_4_11Jul03.JPG
954 0.01%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Miranda_2_Mar05.jpg
949 0.01%29/Jun/05 23:50/opinion/
948 0.07%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_BJ_Hunnibun_3_19May05.jpg
941 0.07%29/Jun/05 22:42/chapters/san-francisco/graphics/adoptables/SF_nicolas1.jpg
941 0.12%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Luke_4_Apr05.jpg
940 0.02%29/Jun/05 21:40/journal/1/place-space-update.html
938 0.02%29/Jun/05 20:30/journal/2-8/eye-problems.html
938 0.04%29/Jun/05 22:21/graphics/fun/netbunnies/BallBall-Choi1.jpg
937 0.03%29/Jun/05 22:21/graphics/fun/netbunnies/Beatrice-Pipkorn1.jpg
935 0.01%29/Jun/05 22:05/chapters/san-diego/products/
934 0.01%29/Jun/05 23:39/journal/2-7/chateau.html
934 0.01%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Lizetta_Dec04.jpg
933 0.02%29/Jun/05 22:21/graphics/fun/netbunnies/BoboIndy-Niemi1.jpg
932 0.01%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Wynne_Brooks_Jan05.jpg
930 0.01%29/Jun/05 20:17/graphics/fun/netbunnies/C-H-eating.jpg
923 0.01%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Ranger_4_20Oct04.JPG
922 0.02%29/Jun/05 23:17/graphics/fun/netbunnies/bunnies-stradeski1.jpg
921 0.04%29/Jun/05 23:19/graphics/fun/netbunnies/creepy 11-khas1.jpg
921 0.10%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Gwen_2_17Sept04.JPG
921 0.08%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/blossom1.jpg
919 0.03%29/Jun/05 20:58/journal/3-7/gi.html
915 0.03%29/Jun/05 22:47/graphics/fun/netbunnies/Bunny+Dog-Tsang1.jpg
913 0.02%29/Jun/05 23:40/graphics/mine/foo/9-cds-50.jpg
912 0.04%29/Jun/05 22:22/graphics/fun/netbunnies/Bunny-Hiler1.jpg
905 0.02%29/Jun/05 21:37/chapters/san-diego/diet/graphics/poops.jpg
905 0.06%29/Jun/05 20:27/graphics/fun/netbunnies/high2.jpg
903 0.01%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Keera_Monroe_DEc04.jpg
901 0.01%29/Jun/05 22:33/adoption/why-not-to-breed.html
898 0.01%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Georgia_4_11Jul03.JPG
897 0.03%29/Jun/05 22:22/graphics/fun/netbunnies/BunBun.jpg
895 0.02%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Dusty_Ronan_4_Dec04.jpg
892 0.07%29/Jun/05 22:38/graphics/fun/netbunnies/WABBIT-Wes1.jpg
886 0.04%29/Jun/05 21:25/graphics/fun/netbunnies/amelia-mcsherry1.jpg
886 0.02%29/Jun/05 23:38/graphics/fun/netbunnies/FlyingBunny-Krissy1.jpg
884 0.03%29/Jun/05 22:24/graphics/fun/netbunnies/BloopButt-Altitude1.jpg
878 0.03%30/Jun/05 00:05/graphics/fun/netbunnies/checkers-tolle1.jpg
878 0.01%29/Jun/05 23:39/graphics/
16 29/Jun/05 01:51  /graphics/?D=A
16 28/Jun/05 19:11  /graphics/?M=A
16 28/Jun/05 19:11  /graphics/?N=D
13 28/Jun/05 19:07  /graphics/?S=A
12 29/Jun/05 13:55  /graphics/?M=D
10 29/Jun/05 07:11  /graphics/?D=D
877 0.01%29/Jun/05 23:18/rabbit-center/hayward_rescue/hayward_graphics/abscess.jpg
875 0.02%29/Jun/05 23:35/journal/3-3/digestibility.html
872 0.04%29/Jun/05 21:29/graphics/fun/netbunnies/Bunny2-Hough1.jpg
870 0.02%29/Jun/05 22:21/graphics/fun/netbunnies/Belle-Chase1.jpg
863 0.03%29/Jun/05 23:20/graphics/fun/netbunnies/Biscotto-Negro1.jpg
861 0.01%29/Jun/05 22:03/adoption/hidden-cost-of-breeding.html
860 0.03%29/Jun/05 20:36/graphics/fun/netbunnies/Bunny1-Hough1.jpg
856 0.02%29/Jun/05 22:53/journal/3-3/fiber.html
856 0.10%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/pamela.jpg
855 0.07%26/Jun/05 20:49/chapters/san-diego/adoption/Adoption_Photos/HRS_Cadbury_3_19May05.jpg
855 0.03%29/Jun/05 18:52/faq/sections/medicating.html
853 0.01%29/Jun/05 22:24/easter/hrs-square-easter-75.jpg
853 0.02%29/Jun/05 23:36/rabbit-center/lucky/images/front_001.gif
852 0.01%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Simon_Dec04.jpg
852 0.01%29/Jun/05 22:35/graphics/fun/netbunnies/C-H-resting.jpg
851 0.04%29/Jun/05 21:34/graphics/fun/netbunnies/rabbits1-reeves1.jpg
846 0.02%29/Jun/05 22:55/rabbit-center/hayward_rescue/hayward_rabbits_media-alert.html
846 0.01%29/Jun/05 22:46/hrs-info/link-to-hrs.html
845 29/Jun/05 23:36/rabbit-center/lucky/images/logo-footer.gif
841 0.01%29/Jun/05 20:28/graphics/fun/netbunnies/C-H-circle.jpg
839 0.03%30/Jun/05 00:00/journal/3-9/graphics/mouth.gif
837 0.02%29/Jun/05 21:34/chapters/san-diego/adoption/graphics/JulieJessica3-333-250.jpg
836 0.02%29/Jun/05 22:31/journal/3-5/bladder-disease.html
835 0.01%29/Jun/05 21:19/journal/2-7/graphics/top-10.gif
833 0.03%29/Jun/05 21:20/graphics/fun/netbunnies/rabbit2-weinberg1.jpg
832 0.03%29/Jun/05 21:21/graphics/fun/netbunnies/chicha-gerald1.jpg
825 0.02%29/Jun/05 23:08/rabbit-center/lucky/images/lucky.gif
822 0.02%29/Jun/05 14:40/chapters/san-diego/adoption/Adoption_Photos/HRS_Romeo_Raindrop_23Sept04.jpg
822 0.13%29/Jun/05 20:31/graphics/fun/netbunnies/fuzzy-lop-outside-lowe.jpg
819 0.01%29/Jun/05 22:50/journal/2-2/mean-rabbit.html
813 0.02%29/Jun/05 22:37/journal/3-4/marriage.html
808 0.01%29/Jun/05 20:49/journal/4-5/bunny-rules.html
807 0.02%29/Jun/05 23:02/chapters/san-diego/behavior/litterbox_setup.html
807 0.01%29/Jun/05 13:20/chapters/san-diego/adoption/Adoption_Photos/HRS_Angel_Dec04.jpg
807 0.02%29/Jun/05 23:41/graphics/fun/netbunnies/jangles2.jpg
806 29/Jun/05 21:33/graphics/postcard/rabbit-stamp.gif
805 0.02%29/Jun/05 22:43/journal/3-2/bridging-com-gaps.html
804 0.02%29/Jun/05 21:26/graphics/fun/netbunnies/Bub&Pink-Ervin1.jpg
798 0.02%29/Jun/05 23:41/chapters/san-diego/health/vet-talk/spay_neuter.html
795 0.01%29/Jun/05 22:18/chapters/san-francisco/graphics/wavtile.gif
795 0.03%29/Jun/05 22:43/journal/2-7/graphics/iowa-house.gif
795 0.02%29/Jun/05 14:40/chapters/san-diego/adoption/Adoption_Photos/HRS_Dallas_Randi_4_4_ezr.jpg
791 0.04%29/Jun/05 20:33/graphics/fun/netbunnies/Cappuccino-Philips1.jpg
791 0.02%29/Jun/05 23:29/care/pasteurella.html
790 0.02%29/Jun/05 22:37/chapters/san-diego/behavior/dothat.html
786 0.06%29/Jun/05 22:22/graphics/fun/netbunnies/Buddy1-Lepage1.jpg
785 0.02%29/Jun/05 22:00/graphics/fun/netbunnies/rabbit2-wlals1.jpg
783 0.02%29/Jun/05 13:17/chapters/san-diego/adoption/Adoption_Photos/HRS_Sierra_Dec04.jpg
783 0.02%29/Jun/05 23:53/graphics/fun/netbunnies/Cuddles.jpg
782 0.04%29/Jun/05 22:22/graphics/fun/netbunnies/Bugsi-bc1.jpg
781 0.04%29/Jun/05 22:22/graphics/fun/netbunnies/Buddy-Rowan1.jpg
781 0.01%29/Jun/05 22:21/rabbit-center/hayward_rescue/hayward_graphics/rabbit.jpg
780 0.01%29/Jun/05 22:00/journal/1/aloof.html
780 0.02%29/Jun/05 22:22/graphics/fun/netbunnies/Bunny-Sepesy1.jpg
780 0.03%29/Jun/05 23:20/graphics/fun/netbunnies/Bunnies-Cohen1.jpg
779 0.02%29/Jun/05 23:18/journal/3-11/rabbits-teaching-rabbits.html
778 29/Jun/05 22:01/graphics/banners/banner-m.gif
775 0.04%29/Jun/05 22:22/graphics/fun/netbunnies/Bunnies-Catmichel1.jpg
774 0.03%29/Jun/05 22:46/graphics/fun/netbunnies/Cujo -marfell1.jpg
774 0.05%29/Jun/05 22:22/graphics/fun/netbunnies/BubbaPinky-Ervin1.jpg
768 0.02%29/Jun/05 21:17/graphics/fun/netbunnies/Dexter-Ambear1.jpg
767 0.01%29/Jun/05 23:52/translations/japanese/
767 0.06%29/Jun/05 22:55/rabbit-center/hayward_rescue/hayward_graphics/hayward_bunnies_1.jpg
766 0.06%29/Jun/05 22:22/graphics/fun/netbunnies/Buddy2-Lepage1.jpg
764 0.04%29/Jun/05 22:46/graphics/fun/netbunnies/BunBun-Kelly1.jpg
763 0.01%29/Jun/05 23:06/chapters/san-diego/adoption/available.html
761 0.02%29/Jun/05 22:08/journal/3-4/pellet-info.html
760 0.05%29/Jun/05 22:22/graphics/fun/netbunnies/BunniesBasket-Krissy1.jpg
760 0.02%29/Jun/05 21:50/graphics/fun/netbunnies/Cadbury-Beckemeyer1.jpg
757 0.02%29/Jun/05 21:30/graphics/fun/netbunnies/spencer.jpg
755 0.02%29/Jun/05 23:53/graphics/fun/netbunnies/bear1-binks1.jpg
754 0.01%29/Jun/05 23:00/faq/sections/intro.html
754 0.04%29/Jun/05 22:17/rabbit-center/adoptables/graphics/big/debbie r1411 09sml.jpg
754 0.01%29/Jun/05 20:58/journal/3-7/graphics/gi-tract-ill.gif
753 0.01%29/Jun/05 23:11/journal/2-12/tools-of-the-trade.html
749 0.01%29/Jun/05 19:11/journal/3-8/soft-stools.html
748 0.01%29/Jun/05 22:03/care/bibliography.html
747 0.03%29/Jun/05 22:22/graphics/fun/netbunnies/Bunny-Mbhjch1.jpg
744 0.02%29/Jun/05 22:22/graphics/fun/netbunnies/Bun-hahn1.jpg
743 0.03%29/Jun/05 23:22/chapters/san-diego/faq/
743 0.01%29/Jun/05 22:37/graphics/fun/netbunnies/FoofSanta-Williford1.jpg
743 0.01%29/Jun/05 21:36/journal/3-2/graphics/health-2.gif
741 0.01%29/Jun/05 21:36/journal/3-2/graphics/health-1.gif
739 0.02%29/Jun/05 21:44/links/sections/rabbits.html
738 0.03%29/Jun/05 22:22/graphics/fun/netbunnies/Bunnies02.jpg
738 0.02%29/Jun/05 21:59/graphics/fun/netbunnies/bunny-mirage1.jpg
738 0.01%29/Jun/05 23:35/links/sections/pictures.html
735 0.01%29/Jun/05 21:58/journal/1/cage-manufacturers.html
734 0.12%29/Jun/05 23:35/faq/faq.txt
732 0.01%29/Jun/05 21:12/care/litterbox.html
725 0.02%29/Jun/05 22:35/faq/sections/classroom.html
724 0.05%29/Jun/05 20:01/graphics/fun/netbunnies/Dcp67099.jpg
723 0.02%29/Jun/05 21:45/journal/4-3/maggots.html
722 0.01%29/Jun/05 15:48/graphics/easter/anti-gabriella-circle.jpg
718 0.01%29/Jun/05 23:53/journal/3-1/repellent.html
716 0.04%29/Jun/05 22:10/graphics/fun/netbunnies/ambrosia-sagartz1.jpg
715 0.02%29/Jun/05 21:41/graphics/fun/netbunnies/rabbits5-reeves1.jpg
710 0.04%29/Jun/05 22:56/rabbit-center/hayward_rescue/hayward_graphics/hayward_shelter.jpg
708 0.02%29/Jun/05 21:49/graphics/fun/netbunnies/Cbunny-Easteregg1.jpg
708 0.02%29/Jun/05 20:00/graphics/fun/netbunnies/CottonFeedcloseup1.jpg
707 0.03%29/Jun/05 20:40/graphics/fun/netbunnies/alien-tenma1.jpg
706 0.02%29/Jun/05 16:59/graphics/fun/netbunnies/rabbits-beth1jpg.jpg
706 0.01%29/Jun/05 20:32/graphics/fun/netbunnies/DSC00024.jpg
705 0.06%29/Jun/05 22:55/rabbit-center/hayward_rescue/hayward_graphics/boy_tumor.jpg
704 0.02%29/Jun/05 22:47/graphics/fun/netbunnies/Pandora-Burrascano1.jpg
703 0.06%29/Jun/05 23:25/graphics/fun/netbunnies/Duke-Rowan1.jpg
700 0.01%29/Jun/05 22:43/chapters/san-diego/behavior/graphics/fresh_cf.JPG
700 0.03%29/Jun/05 21:20/graphics/fun/netbunnies/Bunny4-Hough1.jpg
699 0.03%29/Jun/05 21:23/graphics/fun/netbunnies/Bunny3-Hough1.jpg
696 0.04%29/Jun/05 22:37/graphics/fun/netbunnies/Bunny2-Emig1.jpg
694 0.02%29/Jun/05 23:36/graphics/fun/netbunnies/zoe-ffitch1.jpg
692 0.02%29/Jun/05 19:43/graphics/fun/netbunnies/darcy-benson1.jpg
690 0.11%29/Jun/05 22:14/graphics/fun/netbunnies/bunnikins.jpg
688 0.01%29/Jun/05 20:18/journal/2-7/bringing-baby-home.html
688 0.03%29/Jun/05 21:30/graphics/fun/netbunnies/winnie-sugalski1.jpg
686 0.05%29/Jun/05 22:43/chapters/san-diego/behavior/graphics/large_catpan.JPG
686 0.02%29/Jun/05 20:31/graphics/fun/netbunnies/Mister-Mizzrizz1.jpg
685 0.02%29/Jun/05 20:50/graphics/fun/netbunnies/ZZ-small-Cvetan1.jpg
683 0.02%29/Jun/05 21:33/chapters/san-diego/adoption/new_zealand_white.html
683 0.12%29/Jun/05 22:43/chapters/san-diego/behavior/graphics/fresh_hay.JPG
683 0.02%29/Jun/05 20:01/graphics/fun/netbunnies/DSC00008.jpg
681 0.03%29/Jun/05 20:04/graphics/fun/netbunnies/Cuddles-Barker1.jpg
680 0.02%29/Jun/05 22:45/graphics/fun/netbunnies/spunky-miller1.jpg
680 0.01%29/Jun/05 22:38/graphics/fun/netbunnies/DSC00007.jpg
678 0.01%29/Jun/05 22:53/journal/3-3/graphics/fiber.gif
675 0.03%29/Jun/05 22:18/chapters/san-francisco/adoptables.html
675 0.01%29/Jun/05 22:18/chapters/san-francisco/graphics/adoptables/SF_Nooman_2_Feb05.jpg
675 0.01%29/Jun/05 21:37/chapters/san-diego/diet/graphics/cecals.jpg
674 0.02%28/Jun/05 11:04/webmail/index.cgi
674 0.03%29/Jun/05 23:26/graphics/fun/netbunnies/zzzsprite-vegetarian1.jpg
673 0.01%29/Jun/05 23:23/rescue/
672 0.01%29/Jun/05 22:43/chapters/san-diego/behavior/graphics/medium_catpan.JPG
669 0.02%29/Jun/05 22:39/graphics/fun/netbunnies/little punk-sukiennik1.jpg
669 0.05%29/Jun/05 22:59/hrs-info/vet-conference/attendees-by-state.html
669 0.02%29/Jun/05 20:29/graphics/fun/netbunnies/Cbunny2-Easteregg1.jpg
668 0.01%29/Jun/05 22:33/journal/4-7/love-goes-on.html
667 0.02%29/Jun/05 22:37/graphics/fun/netbunnies/Dcp67101.jpg
664 0.02%29/Jun/05 21:30/graphics/fun/netbunnies/DSC00020A.jpg
663 0.01%29/Jun/05 23:35/chapters/san-diego/health/cool.html
663 0.03%29/Jun/05 20:54/links/sections/books.html
663 0.02%29/Jun/05 20:01/graphics/fun/netbunnies/DSC00002.jpg
663 0.01%29/Jun/05 20:32/graphics/fun/netbunnies/CaesarSleeping-Dawn1.jpg
661 0.01%29/Jun/05 23:06/journal/3-5/like-a-rabbit.html
660 0.02%29/Jun/05 22:43/chapters/san-diego/behavior/graphics/used_litterbox.JPG
660 0.01%29/Jun/05 22:43/chapters/san-diego/behavior/graphics/giant_catpan.JPG
658 0.02%29/Jun/05 20:02/graphics/fun/netbunnies/Dggler2-Wilkinson1.jpg
658 0.01%29/Jun/05 22:38/graphics/fun/netbunnies/Caesar-Curtis1.jpg
656 0.02%29/Jun/05 20:31/graphics/fun/netbunnies/LOVEBUNS-Coopers1.jpg
655 0.11%29/Jun/05 23:18/rabbit-center/hayward_rescue/hayward_graphics/Toby_day1.JPG
654 0.01%29/Jun/05 22:17/care/recipes.html
654 0.02%29/Jun/05 21:23/graphics/fun/netbunnies/bentley4-cummins1.jpg
653 0.02%29/Jun/05 21:17/graphics/fun/netbunnies/stewart_sylviaw1.jpg
652 0.01%29/Jun/05 22:47/journal/3-5/calcium.html
652 0.02%29/Jun/05 23:35/journal/2-6/tusks.html
652 29/Jun/05 20:57/graphics/books/stuparyk_small.jpg
650 0.06%29/Jun/05 23:19/graphics/fun/netbunnies/fifi-gray-lop-lying.jpg
650 0.01%29/Jun/05 23:18/journal/3-11/graphics/2by-crate-gate.gif
650 0.01%29/Jun/05 23:18/journal/3-11/graphics/one-in-one-out-crate.gif
647 0.01%29/Jun/05 23:18/journal/3-11/graphics/peering-above-crate.gif
645 0.03%29/Jun/05 23:19/graphics/fun/netbunnies/Pals-cooke1.jpg
645 0.03%29/Jun/05 19:57/graphics/fun/netbunnies/CHIP1-Rappold1.jpg
644 0.04%29/Jun/05 22:34/graphics/fun/netbunnies/Chippers-McConville1.jpg
643 0.01%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/SF_Sparky_2_Feb05.jpg
642 0.01%29/Jun/05 23:18/journal/3-11/graphics/looking-in-crate.gif
640 0.12%29/Jun/05 22:28/chapters/san-diego/behavior/graphics/p3130003.jpg
640 0.02%29/Jun/05 19:57/graphics/fun/netbunnies/bertha-hogue1.jpg
639 0.03%29/Jun/05 21:01/graphics/fun/netbunnies/chubbs-daisy2-esquivel1.jpg
638 0.02%29/Jun/05 22:28/chapters/san-diego/behavior/graphics/CF_hay.JPG
636 0.01%29/Jun/05 21:37/chapters/san-diego/diet/cecals.html
636 0.01%29/Jun/05 23:18/graphics/fun/netbunnies/Cal2-727-1.jpg
636 0.02%29/Jun/05 22:19/graphics/fun/netbunnies/barnie2-lee1.jpg
635 0.02%29/Jun/05 22:47/graphics/fun/netbunnies/baxter-snyder1.jpg
634 0.01%29/Jun/05 23:21/chapters/san-diego/products/office_store.html
633 0.01%29/Jun/05 21:54/journal/3-7/brandolino-poem.html
632 0.06%29/Jun/05 22:01/graphics/fun/netbunnies/DSC00011.jpg
630 0.07%29/Jun/05 22:28/chapters/san-diego/behavior/graphics/pa140024.jpg
628 0.02%29/Jun/05 17:05/graphics/fun/netbunnies/clover-conley1.jpg
628 0.01%29/Jun/05 14:56/graphics/fun/netbunnies/dusty-khan1.jpg
627 0.02%29/Jun/05 23:25/graphics/fun/netbunnies/Choco.jpg
627 0.02%29/Jun/05 20:05/graphics/fun/netbunnies/HoneyBunny-Lud1.jpg
625 0.02%29/Jun/05 23:48/graphics/fun/netbunnies/arwyn-brighten1.jpg
623 0.03%29/Jun/05 21:35/graphics/fun/netbunnies/Hermione-Desjeunes1.jpg
623 0.01%29/Jun/05 20:31/graphics/fun/netbunnies/knuffel-Hoyer1.jpg
622 0.02%29/Jun/05 22:38/graphics/fun/netbunnies/chkrspearl.jpg
621 0.02%29/Jun/05 22:13/graphics/fun/netbunnies/Clive&Fletch-Kleback1.jpg
621 0.01%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/feb02/molly1.jpg
621 0.02%29/Jun/05 20:04/graphics/fun/netbunnies/bambibeau-guidry1.jpg
620 0.02%29/Jun/05 23:52/graphics/fun/netbunnies/granger-wiener1.jpg
620 0.03%29/Jun/05 22:02/graphics/fun/netbunnies/ChuChu1-Choi1.jpg
619 0.06%29/Jun/05 19:43/rabbit-center/hayward_rescue/hayward_graphics/whiterabbit.jpg
618 29/Jun/05 22:18/chapters/san-francisco/banner-small.gif
618 0.01%29/Jun/05 22:36/chapters/san-diego/health/vetlist.html
618 0.01%30/Jun/05 00:03/chapters/san-diego/health/sex.html
617 0.02%29/Jun/05 23:52/graphics/fun/netbunnies/buster-macintosh1.jpg
617 0.02%29/Jun/05 22:01/graphics/fun/netbunnies/Chauncy2-Pop1.jpg
614 0.03%29/Jun/05 20:33/graphics/fun/netbunnies/Chuck&Reeses-Goldsmith1.jpg
611 0.01%29/Jun/05 22:28/adoption/finding-a-new-home.html
610 0.01%29/Jun/05 22:05/chapters/san-diego/products/graphics/Harmony_Kingomd_TJ.jpg
608 0.02%29/Jun/05 20:27/graphics/fun/netbunnies/armchair-wood1.jpg
608 0.03%29/Jun/05 19:42/graphics/fun/netbunnies/Snuggypants-Yoder1.jpg
607 0.04%29/Jun/05 19:43/rabbit-center/hayward_rescue/hayward_graphics/Sweet_wht_bunny_2.jpg
606 0.03%29/Jun/05 21:51/chapters/san-diego/health/dental_disease.html
605 0.01%29/Jun/05 18:17/graphics/fun/netbunnies/ruby1-strope1.jpg
604 0.08%29/Jun/05 21:33/chapters/san-diego/adoption/graphics/Gayon_Adoption.JPG
603 0.01%29/Jun/05 23:58/adoption/right-person.html
602 0.01%29/Jun/05 21:20/graphics/fun/netbunnies/spencer-pinecone.jpg
602 29/Jun/05 20:24/graphics/postcard/postmarked-stamp.jpg
602 0.02%29/Jun/05 21:18/graphics/fun/netbunnies/FoobarNoofFriend-Yoshioka1.jpg
602 0.03%29/Jun/05 19:55/graphics/fun/netbunnies/WallyZorro-Mack1.jpg
601 0.02%30/Jun/05 00:06/graphics/fun/netbunnies/Daisy5-Daniels1.jpg
601 0.01%29/Jun/05 22:31/journal/3-5/graphics/stone.gif
600 0.01%29/Jun/05 21:23/graphics/fun/netbunnies/ivan1-sierra1.jpg
600 0.03%29/Jun/05 20:25/graphics/fun/netbunnies/bentley-cunningham1.jpg
597 0.03%29/Jun/05 20:33/graphics/fun/netbunnies/Cj-mika1.jpg
597 0.01%29/Jun/05 22:05/chapters/san-diego/products/graphics/Prayer_box_1.jpg
596 0.01%29/Jun/05 17:32/care/declawing.html
596 0.05%29/Jun/05 22:05/graphics/fun/netbunnies/Mr. b-Barnette1.jpg
596 0.03%29/Jun/05 22:02/graphics/fun/netbunnies/Demolition+Rabbit-Tandem1.jpg
596 0.01%29/Jun/05 21:46/graphics/fun/netbunnies/KlemmyInTheBag.jpg
595 0.09%29/Jun/05 21:33/chapters/san-diego/adoption/graphics/Norm_BradyKids_10Nov01_1.JPG
595 0.02%29/Jun/05 19:54/graphics/fun/netbunnies/lily-cathey1.jpg
595 0.02%29/Jun/05 21:21/graphics/fun/netbunnies/Pl-sch10.jpg
594 0.03%29/Jun/05 21:40/graphics/fun/netbunnies/Chuck-Goldsmith1.jpg
592 0.02%29/Jun/05 23:45/chapters/san-diego/behavior/bunnyproofing.html
591 0.02%29/Jun/05 21:40/graphics/fun/netbunnies/b31997.jpg
586 0.02%29/Jun/05 21:04/graphics/fun/netbunnies/FIONA-Primrose1.jpg
586 0.02%29/Jun/05 23:18/graphics/fun/netbunnies/Loli1-lo1.jpg
583 0.04%29/Jun/05 20:40/graphics/fun/netbunnies/Flopsy-Pielady1.jpg
583 0.02%29/Jun/05 22:24/graphics/fun/netbunnies/Samson-Yong1.jpg
583 0.02%29/Jun/05 21:22/graphics/fun/netbunnies/Romeo-Mstnghthr1.jpg
582 0.01%29/Jun/05 22:37/graphics/fun/netbunnies/nibblet2-ward1.jpg
581 0.03%29/Jun/05 21:20/graphics/fun/netbunnies/sasha--shorty1.jpg
581 0.02%29/Jun/05 21:23/graphics/fun/netbunnies/chester-amylase1.jpg
581 0.02%29/Jun/05 19:36/graphics/fun/netbunnies/bighead1.jpg
581 0.02%29/Jun/05 20:05/graphics/fun/netbunnies/Heaven-Sent.jpg
581 0.01%29/Jun/05 21:50/graphics/fun/netbunnies/rudi-scherkamp.jpg
579 0.03%29/Jun/05 21:19/graphics/fun/netbunnies/zorro-hos1.jpg
579 0.01%29/Jun/05 20:10/graphics/fun/netbunnies/MAP0000.jpg
577 0.01%29/Jun/05 23:20/graphics/fun/netbunnies/ShadowToSend.jpg
577 0.03%29/Jun/05 21:22/graphics/fun/netbunnies/NIJNTJE-Alewin1.jpg
576 0.01%29/Jun/05 20:55/graphics/fun/netbunnies/duncan2-ciuffo1.jpg
575 0.01%29/Jun/05 18:07/graphics/fun/netbunnies/bunny3-wu1.jpg
575 0.04%29/Jun/05 20:32/graphics/fun/netbunnies/Diggler-Wilkinson1.jpg
574 0.02%29/Jun/05 22:04/graphics/fun/netbunnies/FloydMisty.jpg
574 0.02%29/Jun/05 23:18/graphics/fun/netbunnies/DSC00005.jpg
574 0.03%29/Jun/05 21:16/graphics/fun/netbunnies/Tim-Oathay1.jpg
573 0.01%29/Jun/05 22:04/graphics/fun/netbunnies/Georgariou.jpg
573 0.01%29/Jun/05 20:53/graphics/fun/netbunnies/Snickers-Watson1.jpg
573 0.02%29/Jun/05 22:25/chapters/san-diego/adoption/happy_adoptions.html
573 0.02%29/Jun/05 21:19/graphics/fun/netbunnies/EasterBenny-Scollo1.jpg
573 0.01%29/Jun/05 23:47/chapters/san-diego/health/vet-talk/eyes.html
573 0.04%29/Jun/05 20:55/graphics/fun/netbunnies/clover-smith1.jpg
571 0.01%29/Jun/05 22:26/help/advanced-search.html
570 0.01%29/Jun/05 23:56/chapters/san-diego/behavior/bonding-tips.html
569 0.04%29/Jun/05 21:48/graphics/fun/netbunnies/beachingbunnieshenriettahon.jpg
569 0.02%29/Jun/05 21:44/graphics/fun/netbunnies/annabelle-seitz1.jpg
569 0.03%29/Jun/05 21:23/graphics/fun/netbunnies/eeyore-guinn1.jpg
568 0.02%29/Jun/05 21:54/graphics/fun/netbunnies/GingerKiss-McConville1.jpg
567 0.05%29/Jun/05 23:01/graphics/fun/netbunnies/strawberry-white-baby.jpg
566 0.02%29/Jun/05 21:58/graphics/fun/netbunnies/Flip.jpg
565 0.01%29/Jun/05 21:40/graphics/fun/netbunnies/andrewsammy-prince1.jpg
565 0.01%29/Jun/05 20:11/graphics/fun/netbunnies/MaartyLoose-Altitude1.jpg
564 0.02%29/Jun/05 20:57/graphics/fun/netbunnies/Dot3-Neumann1.jpg
564 0.02%29/Jun/05 20:31/graphics/fun/netbunnies/beezle-cat.jpg
563 0.01%29/Jun/05 23:14/adoption/easter.html
562 0.02%29/Jun/05 20:30/graphics/fun/netbunnies/GIZMO.jpg
562 0.02%29/Jun/05 18:55/graphics/fun/netbunnies/harley-ko1.jpg
562 0.03%29/Jun/05 21:17/graphics/fun/netbunnies/Penelope 2-Jones1.jpg
561 0.01%29/Jun/05 20:03/graphics/fun/netbunnies/Feather-Pratt1.jpg
561 0.02%29/Jun/05 22:15/graphics/fun/netbunnies/moneybunny-anderson1.jpg
561 0.01%29/Jun/05 21:20/journal/3-12/litter-training-revisited.html
560 0.02%29/Jun/05 20:37/graphics/fun/netbunnies/RabbitsGarten-Henkel1.jpg
559 0.03%29/Jun/05 21:22/graphics/fun/netbunnies/yoshi-strope1.jpg
559 0.03%29/Jun/05 22:04/graphics/fun/netbunnies/bucky-schaffer1.jpg
559 0.01%29/Jun/05 20:27/graphics/fun/netbunnies/Jewel-Pratt1.jpg
558 0.01%29/Jun/05 23:33/journal/2-6/fear-into-play.html
558 0.03%29/Jun/05 21:18/graphics/fun/netbunnies/Gang.jpg
558 0.03%29/Jun/05 22:47/graphics/fun/netbunnies/bailey1-erin1.jpg
558 0.02%29/Jun/05 20:56/graphics/fun/netbunnies/EasterBennyScollo1.jpg
557 0.02%29/Jun/05 16:25/graphics/fun/netbunnies/sammy-lloyd1.jpg
557 0.01%30/Jun/05 00:00/journal/4-3/gizmo.html
557 0.01%29/Jun/05 22:11/journal/3-9/oral-health.html
557 0.02%29/Jun/05 21:39/graphics/fun/netbunnies/annabelle1-walker1.jpg
557 29/Jun/05 22:19/chapters/san-francisco/graphics/logo-footer.gif
556 0.03%29/Jun/05 20:59/graphics/fun/netbunnies/SmellyPiglet2-Lam1.jpg
555 0.03%29/Jun/05 21:21/graphics/fun/netbunnies/angel+cloudy-phelan1.jpg
554 0.01%29/Jun/05 20:18/journal/2-7/graphics/photo-page-1.gif
554 0.03%29/Jun/05 21:47/graphics/fun/netbunnies/lily2-rice1.jpg
554 0.02%29/Jun/05 21:45/graphics/fun/netbunnies/ailey _work1.jpg
553 0.01%29/Jun/05 21:41/graphics/fun/netbunnies/RyoOhki4-Burk1.jpg
552 0.01%29/Jun/05 23:53/graphics/fun/netbunnies/deliverance-avery1.jpg
549 0.04%29/Jun/05 21:17/graphics/fun/netbunnies/snuffles-quasebarth1.jpg
549 0.01%29/Jun/05 20:59/graphics/fun/netbunnies/Ted3.jpg
549 0.01%29/Jun/05 20:24/graphics/fun/netbunnies/ziggy2-Rebolj1.jpg
549 0.01%29/Jun/05 23:52/graphics/fun/netbunnies/usagi1-king1.jpg
549 0.02%29/Jun/05 23:49/graphics/fun/netbunnies/willie1-martin1.jpg
549 0.03%29/Jun/05 20:30/graphics/fun/netbunnies/HoneyBox-Melanson1.jpg
549 0.02%29/Jun/05 20:03/graphics/fun/netbunnies/rabbit-carpenter1.jpg
549 0.03%29/Jun/05 20:02/graphics/fun/netbunnies/Dscf0005copia.jpg
549 0.01%29/Jun/05 23:19/graphics/fun/netbunnies/vancouver-watch1.jpg
548 0.03%29/Jun/05 20:04/graphics/fun/netbunnies/Foster-Edge1.jpg
547 0.03%29/Jun/05 21:49/graphics/fun/netbunnies/schmoofriend-Gadsby1.jpg
547 0.01%29/Jun/05 21:33/chapters/san-diego/adoption/graphics/Skye_sofa.jpg
547 0.04%29/Jun/05 21:30/graphics/fun/netbunnies/Violets-cooke1.jpg
546 0.02%30/Jun/05 00:05/graphics/fun/netbunnies/Tiara-Trina1.jpg
544 0.01%29/Jun/05 21:45/graphics/fun/netbunnies/Sgt72-Jenney1.jpg
544 0.01%29/Jun/05 22:02/graphics/fun/netbunnies/Precious.jpg
542 0.01%21/Jun/05 19:56/chapters/san-diego/adoption/Adoption_Photos/HRS_Jonathan_Apr05.jpg
542 0.04%29/Jun/05 23:19/graphics/fun/netbunnies/brushbaby.jpg
541 0.02%29/Jun/05 23:53/graphics/fun/netbunnies/Spot2-JackB1.jpg
540 0.01%29/Jun/05 21:33/chapters/san-diego/adoption/uh-oh.jpg
540 0.01%29/Jun/05 19:15/graphics/fun/netbunnies/hugh.jpg
540 0.02%29/Jun/05 18:38/graphics/fun/netbunnies/hugo-gruneberg1.jpg
540 0.02%29/Jun/05 21:46/graphics/fun/netbunnies/Hera y demes-Maria1.jpg
540 0.01%29/Jun/05 21:04/faq/sections/disabled.html
539 0.01%29/Jun/05 22:00/graphics/fun/netbunnies/rocketpeaches5-sears1.jpg
539 0.01%29/Jun/05 21:45/graphics/fun/netbunnies/Twins-Singleton1.jpg
538 0.02%29/Jun/05 20:15/graphics/fun/netbunnies/Rabbit-Flanagan1.jpg
538 0.01%29/Jun/05 23:27/journal/1/critically-ill.html
537 0.01%29/Jun/05 21:34/graphics/fun/netbunnies/Hasi2.jpg
537 0.09%29/Jun/05 21:33/chapters/san-diego/adoption/Adoption_Photos/Misty_Winter_happyadoption.jpg
537 29/Jun/05 22:18/chapters/san-francisco/adoptables.gif
535 0.01%29/Jun/05 18:08/graphics/fun/netbunnies/Snoopy3.jpg
535 0.03%29/Jun/05 19:38/graphics/fun/netbunnies/bunnies-jamie1.jpg
535 0.01%29/Jun/05 21:49/graphics/fun/netbunnies/Grey-Pratt1.jpg
535 0.01%29/Jun/05 22:13/graphics/fun/netbunnies/tinker-heinsma1.jpg
534 0.02%29/Jun/05 21:22/graphics/fun/netbunnies/Izzy+Alley-habermehl1.jpg
534 0.02%29/Jun/05 20:33/graphics/fun/netbunnies/Paddington-Craddick1.jpg
534 0.02%29/Jun/05 23:58/faq/sections/travel.html
533 0.01%29/Jun/05 21:33/chapters/san-diego/adoption/Adoption_Photos/HRS_Molly_3_25Mar03.JPG
533 0.02%29/Jun/05 21:25/graphics/fun/netbunnies/brandi2-rhoda1.jpg
532 0.01%29/Jun/05 23:38/care/poinsettia.html
532 0.02%29/Jun/05 21:30/graphics/fun/netbunnies/P2140007.jpg
532 0.03%29/Jun/05 20:24/graphics/fun/netbunnies/hiphop-fischer1.jpg
532 0.02%29/Jun/05 21:18/graphics/fun/netbunnies/lilith-emaleth1.jpg
532 0.01%29/Jun/05 20:08/graphics/fun/netbunnies/Lau1.jpg
531 0.01%29/Jun/05 22:46/graphics/fun/netbunnies/IJOOR-Vandenberg1.jpg
531 0.02%29/Jun/05 21:23/graphics/fun/netbunnies/babyschmoo-Gadsby1.jpg
531 0.04%29/Jun/05 20:05/graphics/fun/netbunnies/Hughston-Jellison1.jpg
531 0.02%29/Jun/05 20:06/graphics/fun/netbunnies/SpotChance-Chanspan1.jpg
531 0.03%29/Jun/05 19:43/graphics/fun/netbunnies/herman-black-marks-gordon.jpg
531 0.02%29/Jun/05 21:18/graphics/fun/netbunnies/floppy-isabelle1.jpg
530 29/Jun/05 21:51/chapters/san-diego/health/graphics/good-teeth.jpg
530 0.02%29/Jun/05 23:37/graphics/fun/netbunnies/ziggy-rebolj1.jpg
530 0.01%29/Jun/05 21:39/graphics/fun/netbunnies/oatmeal-lyerly1.jpg
530 0.02%29/Jun/05 20:32/graphics/fun/netbunnies/snoopy-yonezawa1.jpg
530 29/Jun/05 23:25/cgi-bin/email-article.cgi
529 0.02%29/Jun/05 21:30/graphics/fun/netbunnies/Leinie-Chloe2.jpg
528 0.02%29/Jun/05 22:38/graphics/fun/netbunnies/Willow-sandy1.jpg
528 0.03%29/Jun/05 21:38/graphics/fun/netbunnies/whitelopandtoilet.jpg
528 0.01%29/Jun/05 21:17/graphics/fun/netbunnies/Hasi1.jpg
527 0.01%29/Jun/05 20:00/graphics/fun/netbunnies/baby1-jarrett1.jpg
527 29/Jun/05 22:58/translations/spanish/
527 0.03%29/Jun/05 20:38/graphics/fun/netbunnies/lopingrass.jpg
527 0.02%29/Jun/05 20:30/graphics/fun/netbunnies/Penelope-Jones1.jpg
527 0.01%29/Jun/05 21:02/graphics/fun/netbunnies/jasper-stein1.jpg
527 0.02%30/Jun/05 00:06/graphics/fun/netbunnies/RosinaCarmello-Alexander1.jpg
526 0.01%29/Jun/05 21:31/graphics/fun/netbunnies/gizmo-levesque1.jpg
526 0.02%29/Jun/05 20:30/graphics/fun/netbunnies/Lizzy13-Dale1.jpg
526 0.04%29/Jun/05 21:23/graphics/fun/netbunnies/suki-gray-strectched-out.jpg
526 0.02%29/Jun/05 13:23/graphics/fun/netbunnies/beatrix-snyder1.jpg
526 0.02%29/Jun/05 21:33/chapters/san-diego/adoption/Adoption_Photos/Mia_Jack_adoption_2_29Sept02.JPG
525 0.01%29/Jun/05 21:36/graphics/fun/netbunnies/parsley1.jpg
525 0.02%29/Jun/05 23:19/graphics/fun/netbunnies/auntdot-peterson1.jpg
525 0.03%29/Jun/05 21:23/graphics/fun/netbunnies/bunny-sentient1.jpg
525 0.02%29/Jun/05 22:45/graphics/fun/netbunnies/bunnies4-doerfler1.jpg
525 0.02%29/Jun/05 11:59/graphics/fun/netbunnies/Shelby+Sweetie-Benny1.jpg
524 0.02%29/Jun/05 21:21/graphics/fun/netbunnies/HelenPeeps-Jones1.jpg
524 0.02%29/Jun/05 20:06/graphics/fun/netbunnies/Jacob2-Sullivan1.jpg
524 0.01%29/Jun/05 20:09/graphics/fun/netbunnies/Lucek3-Anna1.jpg
524 0.03%29/Jun/05 21:03/graphics/fun/netbunnies/Image05.jpg
524 0.02%29/Jun/05 19:49/graphics/fun/netbunnies/Pepper+jack-sean1.jpg
524 0.03%29/Jun/05 21:19/graphics/fun/netbunnies/Lacey-Pierce1.jpg
524 0.01%29/Jun/05 22:00/graphics/fun/netbunnies/babies2-haase1.jpg
523 0.02%29/Jun/05 21:33/chapters/san-diego/adoption/Adoption_Photos/Violet_adoption_4Aug02.JPG
523 0.02%29/Jun/05 13:31/graphics/fun/netbunnies/becky-sugalski1.jpg
522 0.02%29/Jun/05 23:20/graphics/fun/netbunnies/skye-relaxing.jpg
521 0.01%29/Jun/05 20:07/graphics/fun/netbunnies/Kissin-Altitude1.jpg
521 0.03%29/Jun/05 21:29/graphics/fun/netbunnies/Maggiechristmas-sandy1.jpg
520 0.01%29/Jun/05 21:15/graphics/fun/netbunnies/piper-watson1.jpg
520 0.01%29/Jun/05 19:07/translations/spanish/criar-o-no-criar.html
520 0.07%29/Jun/05 13:52/chapters/san-diego/adoption/Adoption_Photos/HRS_Marjorie_1_17Sep04.JPG
520 0.02%29/Jun/05 19:40/graphics/fun/netbunnies/winston-phelan1.jpg
519 0.01%29/Jun/05 19:09/journal/1/amoxicillin-warning.html
518 0.01%29/Jun/05 20:32/graphics/fun/netbunnies/willow4-stardancer1.jpg
518 0.01%29/Jun/05 23:20/graphics/fun/netbunnies/buster-nad1.jpg
517 0.03%29/Jun/05 21:55/graphics/fun/netbunnies/Olivia-Trina1.jpg
517 29/Jun/05 21:51/chapters/san-diego/health/graphics/Bad_teeth_2.JPG
517 0.02%29/Jun/05 19:39/graphics/fun/netbunnies/zumi-peterson1.jpg
517 0.06%29/Jun/05 22:03/graphics/fun/netbunnies/blueberry-perillat1.jpg
517 0.01%29/Jun/05 23:06/journal/3-5/graphics/two-in-hole.gif
517 0.05%29/Jun/05 22:18/chapters/san-francisco/graphics/adoptables/SF_gino1.jpg
517 0.02%29/Jun/05 21:38/graphics/fun/netbunnies/zippy-story1.jpg
517 0.03%29/Jun/05 21:54/graphics/fun/netbunnies/inky1.jpg
517 0.01%29/Jun/05 20:04/graphics/fun/netbunnies/Grace4-Delloli1.jpg
516 0.01%29/Jun/05 23:20/graphics/fun/netbunnies/abby1.jpg
516 0.01%29/Jun/05 21:49/graphics/fun/netbunnies/hello.jpg
515 0.05%29/Jun/05 22:18/chapters/san-francisco/graphics/adoptables/SF_gino2.jpg
515 0.06%29/Jun/05 21:50/graphics/fun/netbunnies/aggie-hare-tortoise-hadawi.jpg
515 0.01%29/Jun/05 22:37/graphics/fun/netbunnies/Mvc-007f.jpg
515 0.02%29/Jun/05 21:17/graphics/fun/netbunnies/sherman_sylviaw1.jpg
513 0.02%29/Jun/05 22:45/graphics/fun/netbunnies/bunnies-hayse1.jpg
513 0.01%29/Jun/05 20:16/graphics/fun/netbunnies/bunnies1-Amit1.jpg
513 0.02%29/Jun/05 23:53/graphics/fun/netbunnies/willow-in-bed-with-teddy.jpg
513 0.01%29/Jun/05 22:35/graphics/fun/netbunnies/lubimysie3-Anna1.jpg
513 0.02%29/Jun/05 21:25/graphics/fun/netbunnies/thumper-Mason1.jpg
512 0.01%29/Jun/05 20:26/graphics/fun/netbunnies/Jake-Danner1.jpg
512 0.04%29/Jun/05 21:51/graphics/fun/netbunnies/Lyla-Stairs1.jpg
512 0.02%29/Jun/05 22:22/graphics/fun/netbunnies/Bonbon-Kayleigh.JPG
512 0.02%29/Jun/05 23:18/graphics/fun/netbunnies/WhoMe.jpg
511 0.01%29/Jun/05 21:48/graphics/fun/netbunnies/Pumpkin-Longview1.jpg
511 0.02%29/Jun/05 19:40/graphics/fun/netbunnies/chloe-odell1.jpg
510 0.01%29/Jun/05 23:20/graphics/fun/netbunnies/baby-sweetpea.jpg
510 0.05%29/Jun/05 22:18/chapters/san-francisco/graphics/adoptables/SF_nicolas2.jpg
510 0.01%29/Jun/05 16:34/graphics/fun/netbunnies/tilly-macintosh1.jpg
510 0.01%29/Jun/05 21:51/graphics/fun/netbunnies/uyy-holden1.jpg
509 0.02%29/Jun/05 21:30/graphics/fun/netbunnies/Mel-cook1.jpg
509 0.03%29/Jun/05 16:13/graphics/fun/netbunnies/SmellyPiglet-Lam1.jpg
509 29/Jun/05 21:37/chapters/oakland/ystripes.gif
509 0.02%29/Jun/05 21:23/graphics/fun/netbunnies/thumper3-chandler1.jpg
509 0.01%29/Jun/05 21:51/graphics/fun/netbunnies/chewie-linda1.jpg
509 0.03%29/Jun/05 22:53/graphics/fun/netbunnies/chloe-mann1.jpg
508 0.03%29/Jun/05 22:46/graphics/fun/netbunnies/bunny3-Blair1.jpg
508 0.01%29/Jun/05 13:35/graphics/fun/netbunnies/negao1-marcia1.jpg
508 0.01%29/Jun/05 21:18/graphics/fun/netbunnies/bunny0420.jpg
507 0.01%29/Jun/05 22:45/graphics/fun/netbunnies/ned-betts1.jpg
507 0.01%29/Jun/05 22:22/journal/3-7/stray.html
507 0.03%29/Jun/05 21:24/graphics/fun/netbunnies/PeterBowl-Melanson1.jpg
507 0.03%29/Jun/05 22:47/graphics/fun/netbunnies/ShelbySnickers-Watson1.jpg
507 0.01%29/Jun/05 20:23/graphics/fun/netbunnies/serena-pan1.jpg
506 0.01%29/Jun/05 21:46/graphics/fun/netbunnies/Errol-su1.jpg
506 0.02%29/Jun/05 23:49/graphics/fun/netbunnies/snugglebuns-intelligoth1.jpg
506 0.02%29/Jun/05 21:49/graphics/fun/netbunnies/garry-2-casteneda1.jpg
505 0.02%29/Jun/05 21:49/graphics/fun/netbunnies/winston-turner1.jpg
505 0.04%29/Jun/05 19:43/rabbit-center/hayward_rescue/hayward_graphics/hayward_bunnies_2.jpg
504 0.02%29/Jun/05 22:15/graphics/fun/netbunnies/babybunny-doe1.jpg
504 0.01%29/Jun/05 23:35/journal/1/history-of-easter.html
504 0.02%29/Jun/05 21:46/graphics/fun/netbunnies/Relaxing.jpg
504 29/Jun/05 23:08/fun/answer1.html
503 0.04%29/Jun/05 16:52/graphics/fun/netbunnies/alexander-7mon-lop-palmiere.jpg
502 0.03%29/Jun/05 22:00/graphics/fun/netbunnies/leo-herb1.jpg
502 0.02%29/Jun/05 21:28/graphics/fun/netbunnies/socks_sylviaw1.jpg
502 0.01%29/Jun/05 23:19/graphics/fun/netbunnies/rabbit-rackley1.jpg
502 0.01%29/Jun/05 22:04/graphics/fun/netbunnies/KOOS-Alewin1.jpg
502 0.02%30/Jun/05 00:03/graphics/fun/netbunnies/bobby-lomas1.jpg
502 0.01%29/Jun/05 21:50/graphics/fun/netbunnies/twix1-lanai1.jpg
501 0.02%29/Jun/05 18:28/graphics/fun/netbunnies/bunny-roy1.jpg
501 0.04%29/Jun/05 17:01/graphics/fun/netbunnies/santarabbitandpresentkarasi.jpg
501 0.02%29/Jun/05 21:30/graphics/fun/netbunnies/dopey-chen1.jpg
501 0.01%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/SF_Nooman_1_Feb05.jpg
500 29/Jun/05 23:35/journal/2-6/graphics/malocclusion.gif
500 0.01%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/0203_triston.jpg
500 0.05%29/Jun/05 22:14/graphics/fun/netbunnies/receptionist-rabbit-chen.jpg
500 0.02%29/Jun/05 15:23/graphics/fun/netbunnies/sugar-wendy1.jpg
499 0.02%29/Jun/05 21:31/graphics/fun/netbunnies/benjamin-donovan1.jpg
499 0.02%29/Jun/05 20:38/graphics/fun/netbunnies/jamie-perry1.jpg
499 0.02%29/Jun/05 21:24/graphics/fun/netbunnies/polly_card2.jpg
499 0.03%29/Jun/05 23:19/graphics/fun/netbunnies/krinkle-schroeder1.jpg
499 0.02%29/Jun/05 20:29/graphics/fun/netbunnies/buns-morgan1.jpg
499 0.01%29/Jun/05 19:28/graphics/fun/netbunnies/cinnamon-Cathy1.jpg
499 0.01%29/Jun/05 19:28/graphics/fun/netbunnies/dakota2-angelo1.jpg
498 0.01%29/Jun/05 22:21/graphics/fun/netbunnies/Bonbon.JPG
498 0.02%29/Jun/05 21:18/graphics/fun/netbunnies/bunnies-wittenkeller1.jpg
498 0.04%29/Jun/05 20:03/graphics/fun/netbunnies/kidschris1-Hunt1.jpg
497 0.02%29/Jun/05 20:31/graphics/fun/netbunnies/Thumper2-Hoffman1.jpg
497 0.01%29/Jun/05 22:18/chapters/san-francisco/graphics/adoptables/SF_Emily_1_FEb05.jpg
497 0.02%29/Jun/05 22:33/graphics/fun/netbunnies/bunny1-ramirez1.jpg
497 0.02%29/Jun/05 21:58/graphics/fun/netbunnies/casey&min-Cathy1.jpg
497 0.01%29/Jun/05 22:18/chapters/san-francisco/graphics/adoptables/SF_Emily_2_Feb05.jpg
497 0.02%29/Jun/05 15:51/graphics/fun/netbunnies/toby3-penney1.jpg
497 0.01%29/Jun/05 20:45/graphics/fun/netbunnies/totta3-tanaka1.jpg
496 0.01%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/feb02/molly2.jpg
496 0.02%29/Jun/05 19:29/graphics/fun/netbunnies/bones-Chuck1.jpg
496 0.02%29/Jun/05 23:52/graphics/fun/netbunnies/Lau3.jpg
496 0.02%29/Jun/05 19:58/graphics/fun/netbunnies/Sweet2-RustyBux1.jpg
495 0.01%29/Jun/05 22:18/chapters/san-francisco/graphics/adoptables/Chloe_Chelsea_1_Dec04.jpg
495 0.01%29/Jun/05 22:01/graphics/fun/netbunnies/gilligan-riso1.jpg
495 0.02%29/Jun/05 21:51/graphics/fun/netbunnies/bunny-zietlow1.jpg
495 0.03%29/Jun/05 21:23/graphics/fun/netbunnies/P8050001.jpg
495 0.02%29/Jun/05 21:36/graphics/fun/netbunnies/willby-cook1.jpg
494 0.01%29/Jun/05 22:18/chapters/san-francisco/graphics/adoptables/Harley_Jan05.jpg
494 0.01%29/Jun/05 22:05/graphics/fun/netbunnies/willie2-martin1.jpg
494 0.02%29/Jun/05 22:01/graphics/fun/netbunnies/bunny1-tuma1.jpg
494 0.03%29/Jun/05 22:09/graphics/fun/netbunnies/Rab1.jpg
494 0.02%29/Jun/05 17:09/graphics/fun/netbunnies/boomer-frolich1.jpg
494 0.01%29/Jun/05 21:20/graphics/fun/netbunnies/frenchyhall-lorian1.jpg
493 0.04%29/Jun/05 21:16/graphics/fun/netbunnies/tyler_sylviaw1.jpg
493 0.07%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/SF_Mo_2_Mar04.JPG
493 0.02%29/Jun/05 23:52/graphics/fun/netbunnies/amigos8-butcher1.jpg
493 0.03%29/Jun/05 21:15/graphics/fun/netbunnies/dustyandmirrordownes.jpg
493 0.01%29/Jun/05 22:18/chapters/san-francisco/graphics/adoptables/SF_Chloe_Chelsea_2_Feb05.jpg
493 0.02%29/Jun/05 23:52/graphics/fun/netbunnies/bunny-lee1.jpg
493 0.01%29/Jun/05 22:18/chapters/san-francisco/graphics/adoptables/SF_Chloe_Chelsea_1_Feb05.jpg
493 0.01%29/Jun/05 21:18/graphics/fun/netbunnies/midnight-pasquarello1.jpg
492 0.02%29/Jun/05 20:11/graphics/fun/netbunnies/Mvc-012s.jpg
492 0.02%29/Jun/05 22:46/graphics/fun/netbunnies/jojo-Georgiev1.jpg
492 0.02%29/Jun/05 20:55/graphics/fun/netbunnies/Thumper-Goff1.jpg
492 0.01%29/Jun/05 23:19/graphics/fun/netbunnies/REX-Griffin1.jpg
492 0.04%29/Jun/05 16:13/graphics/fun/netbunnies/Sammioutondecknorth.jpg
492 0.01%29/Jun/05 23:52/graphics/fun/netbunnies/pixie-chiu1.jpg
492 0.02%29/Jun/05 23:40/graphics/fun/netbunnies/barney-bunny2.jpg
492 0.02%29/Jun/05 21:16/graphics/fun/netbunnies/rabbits1-szmoon1.jpg
492 0.01%29/Jun/05 21:02/graphics/fun/netbunnies/thumper-miller1.jpg
492 0.01%29/Jun/05 22:06/graphics/fun/netbunnies/bunny3-pearson1.jpg
491 0.02%29/Jun/05 20:33/graphics/fun/netbunnies/Lau5.jpg
491 0.07%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/SF_Mo_1_Mar04.JPG
491 0.02%29/Jun/05 21:54/graphics/fun/netbunnies/baby3.jpg
491 0.02%29/Jun/05 16:53/graphics/fun/netbunnies/amelia1-shay1.jpg
491 0.03%30/Jun/05 00:06/graphics/fun/netbunnies/shooshoo-snar1.jpg
491 29/Jun/05 21:37/chapters/oakland/smevents.gif
490 0.06%29/Jun/05 21:44/graphics/fun/netbunnies/brown-rabbit-bricks.jpg
490 29/Jun/05 21:37/chapters/oakland/smresour.gif
490 0.01%29/Jun/05 23:53/graphics/fun/netbunnies/bunpic-aird1.jpg
490 0.02%29/Jun/05 19:53/graphics/fun/netbunnies/rabbits2-ceftakhar1.jpg
490 29/Jun/05 21:37/chapters/oakland/smadopt.gif
490 0.02%29/Jun/05 23:20/graphics/fun/netbunnies/punkin-dujardin1.jpg
489 0.02%29/Jun/05 16:35/graphics/fun/netbunnies/gwen-waters1.jpg
489 0.02%29/Jun/05 22:14/graphics/fun/netbunnies/bunnums.jpg
489 0.02%30/Jun/05 00:05/graphics/fun/netbunnies/Royalty-Ttandem1.jpg
489 0.02%29/Jun/05 22:33/graphics/fun/netbunnies/piglet-philipson1.jpg
489 29/Jun/05 21:37/chapters/oakland/smarticl.gif
489 0.02%29/Jun/05 21:31/graphics/fun/netbunnies/Starbunny-Quatre1.jpg
489 0.02%29/Jun/05 22:28/graphics/fun/netbunnies/hernandobunny-joanna1.jpg
488 0.01%29/Jun/05 21:20/graphics/fun/netbunnies/tofu-kessler1.jpg
488 0.01%29/Jun/05 21:55/graphics/fun/netbunnies/minik-sahinalp1.jpg
488 0.02%29/Jun/05 22:02/graphics/fun/netbunnies/oscar-sigler1.jpg
488 0.01%29/Jun/05 23:18/graphics/fun/netbunnies/bunny-fischer1.jpg
488 0.02%29/Jun/05 15:48/graphics/fun/netbunnies/rabbits3-reeves1.jpg
488 0.02%29/Jun/05 16:51/graphics/fun/netbunnies/chester1-Tree1.jpg
488 0.01%29/Jun/05 22:21/chapters/san-diego/behavior/quiz/quiz_graphic.jpg
488 0.04%29/Jun/05 22:52/graphics/fun/netbunnies/frosty-santoro1.jpg
487 0.02%29/Jun/05 20:29/graphics/fun/netbunnies/babyandjangles2.jpg
487 0.02%29/Jun/05 22:24/graphics/fun/netbunnies/blackberry2-leen1.jpg
487 29/Jun/05 21:37/chapters/oakland/bunnybak.gif
487 0.05%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/11/AUT_3094.JPG
487 0.04%29/Jun/05 21:31/graphics/fun/netbunnies/buddy-story1.jpg
487 29/Jun/05 20:47/rabbit-center/retail/ani_bun.gif
487 0.04%29/Jun/05 20:33/graphics/fun/netbunnies/funnybunny2-Willcocks1.jpg
486 0.01%29/Jun/05 22:29/graphics/fun/netbunnies/bunny-karra1.jpg
486 0.01%29/Jun/05 18:36/graphics/fun/netbunnies/bess-smith1.jpg
486 0.03%29/Jun/05 23:18/graphics/fun/netbunnies/angel-stottlemyer1.jpg
486 0.02%29/Jun/05 21:51/graphics/fun/netbunnies/turbo1-tam1.jpg
485 0.02%29/Jun/05 18:14/graphics/fun/netbunnies/floyd1-medel1.jpg
485 0.01%29/Jun/05 20:03/graphics/fun/netbunnies/floyd-ugval1.jpg
485 0.01%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/SF_Merry_Pippen_2_Dec04.jpg
485 0.02%29/Jun/05 21:22/graphics/fun/netbunnies/tusse2-Persson1.jpg
485 0.01%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/SF_Merry_Pippen_1_Dec04.jpg
485 0.01%29/Jun/05 23:58/graphics/fun/netbunnies/emmett-erin1.jpg
485 0.02%29/Jun/05 21:17/graphics/fun/netbunnies/wabbitthewefugee.jpg
485 0.05%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/11/AUT_3100.JPG
483 0.01%29/Jun/05 17:09/graphics/fun/netbunnies/thor-vanessa1.jpg
483 0.01%29/Jun/05 22:45/graphics/fun/netbunnies/StrepPeanutButter.jpg
483 0.01%29/Jun/05 23:02/graphics/fun/netbunnies/cute-diva1.jpg
483 0.02%29/Jun/05 20:28/graphics/fun/netbunnies/punky-brianna1.jpg
483 0.01%29/Jun/05 21:30/graphics/fun/netbunnies/flopsie.jpg
483 0.01%29/Jun/05 21:51/graphics/fun/netbunnies/pete-guzman1.jpg
483 0.01%29/Jun/05 20:31/graphics/fun/netbunnies/TakingaPowder.jpg
483 0.03%29/Jun/05 14:46/graphics/fun/netbunnies/TrixieGourmet-Oathay1.jpg
483 0.02%29/Jun/05 21:42/graphics/fun/netbunnies/nicke-igen1.jpg
482 0.02%29/Jun/05 22:32/graphics/fun/netbunnies/Scottie-Mark1.jpg
482 0.01%29/Jun/05 21:28/journal/3-11/scuts.html
482 0.02%29/Jun/05 21:48/graphics/fun/netbunnies/cherrios-miller1.jpg
482 0.02%29/Jun/05 21:24/graphics/fun/netbunnies/Scooter.jpg
482 0.03%29/Jun/05 23:53/graphics/fun/netbunnies/Zack-Gannon1.jpg
482 0.01%29/Jun/05 20:55/graphics/fun/netbunnies/biscuit.jpg
482 0.01%29/Jun/05 23:19/graphics/fun/netbunnies/otto-ninespike1.jpg
481 0.01%29/Jun/05 21:30/graphics/fun/netbunnies/p_mlou.jpg
481 0.01%29/Jun/05 21:30/graphics/fun/netbunnies/ruby2-renee1.jpg
481 0.01%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/SF_Lucy-2_Feb05.jpg
481 0.02%29/Jun/05 21:24/graphics/fun/netbunnies/peanut+duke-Bud1.jpg
480 0.01%29/Jun/05 23:49/chapters/san-francisco/
480 0.02%29/Jun/05 23:18/graphics/fun/netbunnies/Rascal-Ryska1.jpg
480 0.01%29/Jun/05 21:19/graphics/fun/netbunnies/Myrabbit.jpg
480 0.01%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/SF_Lucy_1_Feb05.jpg
480 0.03%29/Jun/05 20:29/graphics/fun/netbunnies/hazel-digicult1.jpg
480 0.03%29/Jun/05 21:22/graphics/fun/netbunnies/rabbits2-sargeant1.jpg
480 0.03%29/Jun/05 20:53/graphics/fun/netbunnies/Stndprty-RustyBux1.jpg
479 0.03%29/Jun/05 13:43/graphics/fun/netbunnies/bugs2-Ingham1.jpg
479 0.01%29/Jun/05 19:36/graphics/fun/netbunnies/muffin-matacia1.jpg
479 0.02%29/Jun/05 20:23/graphics/fun/netbunnies/merlin-manning1.jpg
479 0.02%29/Jun/05 22:01/graphics/fun/netbunnies/esmeralda-langseth1.jpg
479 0.01%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/SF_Higgins_2_Feb05.jpg
479 0.02%29/Jun/05 20:03/graphics/fun/netbunnies/akira-king.jpg
478 0.01%29/Jun/05 23:36/graphics/fun/netbunnies/dust-Caines1.jpg
478 29/Jun/05 21:37/chapters/oakland/smabout.gif
478 0.02%29/Jun/05 20:32/graphics/fun/netbunnies/bunnies1-doerfler1.jpg
478 0.02%29/Jun/05 20:43/graphics/fun/netbunnies/saule-kat1.jpg
478 0.01%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/SF_Higgins_1_Feb05.jpg
477 0.01%29/Jun/05 23:20/graphics/fun/netbunnies/shag-tammy1.jpg
477 0.02%29/Jun/05 21:22/graphics/fun/netbunnies/amos-martin1.jpg
477 0.01%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/Aug02/SF_Milo_Corey_Jul02.JPG
476 0.01%29/Jun/05 23:22/chapters/san-diego/aboutus/
476 0.03%29/Jun/05 21:19/graphics/fun/netbunnies/baby-limes1.jpg
475 0.01%29/Jun/05 21:18/graphics/fun/netbunnies/rocco-boland1.jpg
475 0.01%29/Jun/05 21:48/graphics/fun/netbunnies/jessica-Guthrie1.jpg
475 0.03%29/Jun/05 22:46/graphics/fun/netbunnies/jb+ollie1-ozab1.jpg
475 0.02%29/Jun/05 21:23/graphics/fun/netbunnies/xpp3-huang1.jpg
475 0.01%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/SF_Albert_1_Feb05.jpg
475 0.06%29/Jun/05 21:39/graphics/fun/netbunnies/brown-rabbit-bricks3.jpg
475 0.02%29/Jun/05 22:16/graphics/fun/netbunnies/mackenzie-cunningham1.jpg
475 0.01%29/Jun/05 20:32/graphics/fun/netbunnies/georgie-lake1.jpg
475 0.02%29/Jun/05 21:19/graphics/fun/netbunnies/nine2-merkus1.jpg
475 0.01%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/SF_Albert_2_FEb05.jpg
475 0.02%29/Jun/05 19:25/graphics/fun/netbunnies/spikebruiser1-hounsell1.jpg
475 0.01%29/Jun/05 20:07/graphics/fun/netbunnies/Kobe-Sumner1.jpg
474 0.02%29/Jun/05 23:21/chapters/san-diego/products/graphics/HRS_Office_Cages_Jan04.JPG
474 0.01%29/Jun/05 22:55/journal/3-10/classroom.html
474 0.02%29/Jun/05 21:51/graphics/fun/netbunnies/doodles-monas1.jpg
474 0.01%29/Jun/05 13:45/graphics/fun/netbunnies/daisywaisy-rmccl1.jpg
474 0.01%29/Jun/05 23:52/graphics/fun/netbunnies/sammie+tigger-choy1.jpg
474 0.02%29/Jun/05 21:51/graphics/fun/netbunnies/francois-hebble1.jpg
474 0.01%29/Jun/05 23:21/graphics/fun/netbunnies/cam.jpg
474 0.01%29/Jun/05 21:37/graphics/fun/netbunnies/bunny4.jpg
473 29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/SF_Sparky_1_Feb05.jpg
473 0.01%29/Jun/05 21:45/graphics/fun/netbunnies/bubbles-Ng1.jpg
473 0.04%29/Jun/05 23:19/graphics/fun/netbunnies/SweetyBunny-Taylor1.jpg
473 0.01%29/Jun/05 20:39/graphics/fun/netbunnies/riley-santoro1.jpg
473 0.01%29/Jun/05 21:31/graphics/fun/netbunnies/snowball-gitter1.jpg
473 0.02%29/Jun/05 19:39/graphics/fun/netbunnies/zippy-williams1.jpg
473 0.01%29/Jun/05 15:51/graphics/fun/netbunnies/bunny-brown1.jpg
472 0.01%29/Jun/05 22:35/graphics/fun/netbunnies/a1.jpg
472 0.02%29/Jun/05 22:38/graphics/fun/netbunnies/rabbit5-nycx1.jpg
472 0.02%29/Jun/05 20:07/graphics/fun/netbunnies/KUSTI1-Saisa1.jpg
472 0.01%29/Jun/05 21:16/chapters/san-francisco/graphics/adoptables/feb02/jeremy.jpg
472 0.01%29/Jun/05 21:10/adoption/overpopulation.html
472 0.01%29/Jun/05 23:21/chapters/san-diego/products/graphics/HRS_Office_4_Jan04.JPG
472 0.02%29/Jun/05 21:47/graphics/fun/netbunnies/zoidburg+leela-mellor1.jpg
472 0.02%29/Jun/05 20:38/graphics/fun/netbunnies/bob+parsley-hill1.jpg
471 0.01%29/Jun/05 21:17/graphics/fun/netbunnies/floppy-boleyn1.jpg
471 0.01%29/Jun/05 16:59/graphics/fun/netbunnies/mel2-shay1.jpg
471 0.01%29/Jun/05 22:13/graphics/fun/netbunnies/rabbit1-klarman1.jpg
471 0.02%29/Jun/05 21:06/graphics/fun/netbunnies/Rabbit1-Hogue1.jpg
471 0.02%29/Jun/05 23:52/graphics/fun/netbunnies/PeterAmalthia-Batchelar1.jpg
471 0.01%29/Jun/05 23:21/chapters/san-diego/products/graphics/HRS_Office_boxed_hay_Jan04.JPG
470 0.01%29/Jun/05 21:58/graphics/fun/netbunnies/coco-Whitehead1.jpg
470 0.01%29/Jun/05 20:02/chapters/san-diego/health/vet-talk/coccidia.html
470 0.06%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/SF_Maurice_2_Feb05.jpg
470 0.01%29/Jun/05 21:47/graphics/easter/gold-egg.gif
470 0.02%29/Jun/05 22:02/graphics/fun/netbunnies/SuperbeHermione-Buton1.jpg
469 0.02%29/Jun/05 21:37/graphics/fun/netbunnies/buster-liu1.jpg
469 0.01%29/Jun/05 18:46/graphics/fun/netbunnies/muffy5.jpg
469 0.01%29/Jun/05 20:32/graphics/fun/netbunnies/stitch-aki1.jpg
469 0.02%29/Jun/05 21:51/graphics/fun/netbunnies/rishcage-sandy1.jpg
468 0.03%29/Jun/05 19:40/graphics/fun/netbunnies/yoki-elyn1.jpg
468 0.02%29/Jun/05 21:41/graphics/fun/netbunnies/max+ basil1-haley1.jpg
468 0.02%29/Jun/05 21:21/graphics/fun/netbunnies/aberelagrupp-asa1.jpg
468 0.08%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/SF_Maurice_1_Feb05.jpg
468 0.01%29/Jun/05 23:21/chapters/san-diego/products/graphics/HRS_Office_5_Jan04.JPG
468 0.01%29/Jun/05 22:03/graphics/fun/netbunnies/alfred.jpg
468 0.01%29/Jun/05 14:37/chapters/san-francisco/graphics/adoptables/Aug02/SF_Heidi_Molly_Jul02.JPG
467 0.02%29/Jun/05 20:32/graphics/fun/netbunnies/baso+stinky-wangchuk1.jpg
467 0.01%29/Jun/05 21:27/graphics/fun/netbunnies/bubba3.jpg
467 0.01%29/Jun/05 20:33/graphics/fun/netbunnies/Toto-Sun1.jpg
467 0.02%29/Jun/05 21:51/graphics/fun/netbunnies/bunny-martinez1.jpg
467 0.01%29/Jun/05 15:49/graphics/fun/netbunnies/angus-before-a-shave.jpg
467 0.01%29/Jun/05 15:07/chapters/san-francisco/graphics/adoptables/Aug02/SF_Heidi_Molly_3_Jul02.JPG
467 0.01%29/Jun/05 22:46/graphics/fun/netbunnies/george-orell1.jpg
467 0.01%29/Jun/05 15:07/chapters/san-francisco/graphics/adoptables/Aug02/SF_Heidi_Molly_2_Jul02.JPG
466 0.03%29/Jun/05 19:34/graphics/fun/netbunnies/sweetie-toillon1.jpg
466 0.01%29/Jun/05 13:48/graphics/fun/netbunnies/frenchy1-lorian1.jpg
466 0.02%29/Jun/05 20:26/graphics/fun/netbunnies/peaches-blanchard1.jpg
466 0.01%29/Jun/05 16:03/graphics/fun/netbunnies/ding1-kujawa1.jpg
466 0.01%29/Jun/05 22:16/graphics/fun/netbunnies/babybunnies3-Phillips1.jpg
466 0.02%29/Jun/05 21:16/graphics/fun/netbunnies/victo-slemp1.jpg
466 0.02%29/Jun/05 20:31/graphics/fun/netbunnies/RyoOhki2-Burk1.jpg
465 0.01%29/Jun/05 22:38/graphics/fun/netbunnies/rabbit-jcp1.jpg
465 0.02%29/Jun/05 18:15/graphics/fun/netbunnies/onemore-yong1.jpg
465 0.02%29/Jun/05 21:47/graphics/fun/netbunnies/taco-needler1.jpg
465 0.01%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/SF_Corky_2_Feb05.jpg
465 0.01%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/SF_Corky_1_Feb05.jpg
465 0.01%29/Jun/05 20:59/graphics/fun/netbunnies/attila+thumper1-schindl1.jpg
465 29/Jun/05 22:21/chapters/san-diego/behavior/quiz/quiz-numbers.gif
465 0.01%29/Jun/05 18:11/graphics/fun/netbunnies/maeve-ellis1.jpg
464 0.02%29/Jun/05 23:53/graphics/fun/netbunnies/SylviaXmas.jpg
464 0.03%29/Jun/05 21:47/graphics/fun/netbunnies/bundles-denicourt1.jpg
464 0.02%29/Jun/05 21:23/graphics/fun/netbunnies/max2-hanna1.jpg
464 0.01%29/Jun/05 13:37/graphics/fun/netbunnies/spencer-collins1.jpg
464 0.01%29/Jun/05 21:23/graphics/fun/netbunnies/Willy.jpg
463 0.02%29/Jun/05 20:56/graphics/fun/netbunnies/rudy-cooke1.jpg
463 0.03%29/Jun/05 21:24/graphics/fun/netbunnies/frankie-phelan1.jpg
463 0.01%29/Jun/05 22:48/graphics/fun/netbunnies/chewy-teada1.jpg
463 0.01%29/Jun/05 20:31/graphics/fun/netbunnies/QueenPetricia.jpg
463 0.03%29/Jun/05 22:04/graphics/fun/netbunnies/Sassy-Kirsch1.jpg
463 0.01%29/Jun/05 21:50/graphics/fun/netbunnies/molly-cathey1.jpg
463 0.03%29/Jun/05 23:21/chapters/san-diego/products/graphics/HRS_Office_toys_supplies_Jan04.JPG
463 0.01%29/Jun/05 22:46/graphics/fun/netbunnies/bullet-gannon1.jpg
463 0.01%29/Jun/05 15:47/graphics/fun/netbunnies/buntoungue-wendy1.jpg
463 0.01%29/Jun/05 19:57/graphics/fun/netbunnies/tabitha-leung1.jpg
462 0.01%29/Jun/05 22:05/graphics/fun/netbunnies/boanddoja.jpg
462 0.03%29/Jun/05 21:06/graphics/fun/netbunnies/Trixie-Robinson1.jpg
462 0.01%29/Jun/05 19:42/graphics/fun/netbunnies/Sackedout.jpg
462 0.01%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/SF_Bennet_1_Feb05.jpg
461 0.02%29/Jun/05 22:24/graphics/fun/netbunnies/bunny1-applini1.jpg
461 0.03%29/Jun/05 22:10/graphics/fun/netbunnies/arthur2-holden1.jpg
461 0.03%29/Jun/05 21:21/graphics/fun/netbunnies/millicent-steve2-ha1.jpg
461 0.02%29/Jun/05 20:15/graphics/fun/netbunnies/Rabbit1-Matson1.jpg
461 0.01%29/Jun/05 19:32/graphics/fun/netbunnies/angel1-moskalik1.jpg
461 0.01%29/Jun/05 21:30/graphics/fun/netbunnies/Spots.jpg
461 0.02%29/Jun/05 20:49/graphics/fun/netbunnies/abby2-geekie1.jpg
461 0.05%29/Jun/05 22:38/graphics/fun/netbunnies/brown-lop-christmas.jpg
461 0.02%29/Jun/05 21:20/graphics/fun/netbunnies/kiwi-weigert1.jpg
460 0.02%29/Jun/05 22:00/graphics/fun/netbunnies/badbadbunny-Intelligoth1.jpg
460 0.01%29/Jun/05 22:19/faq/sections/loss.html
460 0.03%29/Jun/05 20:36/graphics/fun/netbunnies/pebbles3-cliff1.jpg
460 0.01%29/Jun/05 22:38/graphics/fun/netbunnies/RyoOhki3-Burk1.jpg
460 0.03%29/Jun/05 20:06/graphics/fun/netbunnies/SmokeyPepper-Fuzzy1.jpg
460 0.01%29/Jun/05 21:19/graphics/fun/netbunnies/nuala10.jpg
460 0.02%29/Jun/05 22:37/graphics/fun/netbunnies/snow1-nscean1.jpg
460 0.02%29/Jun/05 21:30/graphics/fun/netbunnies/babies-Kramer1.jpg
459 0.01%29/Jun/05 21:56/graphics/fun/netbunnies/tob-hopfei1.jpg
459 0.01%29/Jun/05 21:19/graphics/fun/netbunnies/annie.jpg
459 0.01%29/Jun/05 15:55/graphics/fun/netbunnies/oreo-samantha1.jpg
458 0.01%29/Jun/05 21:48/graphics/fun/netbunnies/charlie-gluck1.jpg
458 0.02%29/Jun/05 17:53/graphics/fun/netbunnies/monty-poh1.jpg
458 0.01%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/SF_Bennet_2_Feb05.jpg
458 0.01%29/Jun/05 21:42/graphics/fun/netbunnies/buns-zen1.jpg
458 0.02%29/Jun/05 21:21/graphics/fun/netbunnies/pidder-howard1.jpg
458 0.02%29/Jun/05 22:04/graphics/fun/netbunnies/Silver-Hiler1.jpg
457 0.01%29/Jun/05 13:10/chapters/san-francisco/graphics/adoptables/feb02/sabrina.jpg
457 0.09%29/Jun/05 23:05/chapters/san-diego/behavior/graphics/Corrugated_cord_cover.jpg
457 0.01%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/SF_Amelia_1_Feb05.jpg
457 0.01%29/Jun/05 21:47/graphics/fun/netbunnies/bunny1-vegton1.jpg
457 0.02%29/Jun/05 18:57/graphics/fun/netbunnies/baylee-copple1.jpg
457 0.02%29/Jun/05 19:34/graphics/fun/netbunnies/leo+gisele2-peach1.jpg
457 0.02%29/Jun/05 23:21/chapters/san-diego/products/graphics/HRS_Office_Books_1_Jan04.JPG
456 0.01%29/Jun/05 20:33/graphics/fun/netbunnies/lightning-sagartz1.jpg
456 0.02%29/Jun/05 20:33/graphics/fun/netbunnies/arthur-lees1.jpg
456 0.04%29/Jun/05 19:40/graphics/fun/netbunnies/black-marks-rabbit-gray-lop.jpg
456 0.02%29/Jun/05 22:14/graphics/fun/netbunnies/nestle-avery1.jpg
456 0.02%29/Jun/05 21:14/graphics/fun/netbunnies/yogi2-mondragon1.jpg
456 0.01%29/Jun/05 21:30/graphics/fun/netbunnies/hershey-bella-brandt1.jpg
456 0.01%29/Jun/05 19:35/graphics/fun/netbunnies/XmasAngel1-Williamson1.jpg
456 0.02%29/Jun/05 22:01/graphics/fun/netbunnies/billy-sharwell1.jpg
456 0.02%29/Jun/05 21:05/graphics/fun/netbunnies/bunny-bonniebee1.jpg
456 0.04%29/Jun/05 19:44/graphics/fun/netbunnies/dark-babies.jpg
455 0.01%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/SF_Chubby_Feb05.jpg
455 0.01%29/Jun/05 22:19/chapters/san-francisco/graphics/adoptables/SF_Amelia_2_Feb05.jpg
455 0.03%29/Jun/05 19:58/graphics/fun/netbunnies/moose-daus1.jpg
455 0.02%29/Jun/05 20:40/graphics/fun/netbunnies/oreo-riefle1.jpg
455 0.02%29/Jun/05 23:21/chapters/san-diego/products/graphics/HRS_Office_crocks_1_Jan04.JPG
455 0.02%29/Jun/05 22:17/graphics/fun/netbunnies/winnie-curtin1.jpg
454 0.04%29/Jun/05 21:22/graphics/fun/netbunnies/snoopy-gurpz1.jpg
454 0.01%29/Jun/05 22:45/graphics/fun/netbunnies/snowflake-Destiny1.jpg
454 0.02%29/Jun/05 21:23/graphics/fun/netbunnies/zappa1-taylor1.jpg
454 0.01%29/Jun/05 23:21/chapters/san-diego/products/graphics/HRS_Office_CF_Jan04.JPG
453 0.01%29/Jun/05 22:36/graphics/fun/netbunnies/S001i001.jpg
453 0.03%29/Jun/05 20:50/graphics/fun/netbunnies/Vicky-LilSweet1.jpg
453 0.02%29/Jun/05 21:31/graphics/fun/netbunnies/amigos1-butcher1.jpg
453 0.01%29/Jun/05 22:45/graphics/fun/netbunnies/blaze5-heldt1.jpg
453 0.03%29/Jun/05 21:21/graphics/fun/netbunnies/wyatt-watson1.jpg
453 0.01%29/Jun/05 19:36/graphics/fun/netbunnies/Smokey-Rogers1.jpg
453 0.02%29/Jun/05 21:22/graphics/fun/netbunnies/butterbean2-vegton1.jpg
453 0.01%29/Jun/05 20:03/graphics/fun/netbunnies/r937erin58tiny.jpg
453 29/Jun/05 21:37/chapters/oakland/smhall.gif
453 0.01%29/Jun/05 23:20/graphics/fun/netbunnies/babygirl-buker1.jpg
453 0.02%29/Jun/05 16:17/graphics/fun/netbunnies/tinkerbell-habel1.jpg
453 29/Jun/05 21:12/opinion/fur.html
452 0.03%29/Jun/05 20:27/graphics/fun/netbunnies/arthur1-holden1.jpg
452 0.01%29/Jun/05 13:11/chapters/san-francisco/graphics/adoptables/feb02/jeremy2.jpg
452 0.04%29/Jun/05 20:26/graphics/fun/netbunnies/white-baby-garden.jpg
452 0.01%29/Jun/05 23:21/chapters/san-diego/products/graphics/HRS_Office_pens_Jan04.JPG
451 0.02%29/Jun/05 20:30/graphics/fun/netbunnies/max-harkrader1.jpg
451 0.01%29/Jun/05 23:24/chapters/san-diego/health/vet-talk/frontline.html
451 0.01%29/Jun/05 22:01/graphics/fun/netbunnies/cedy-holden1.jpg
451 0.01%29/Jun/05 22:24/graphics/fun/netbunnies/noodles-ford1.jpg
450 0.01%29/Jun/05 15:51/graphics/fun/netbunnies/bobo-gabriella1.jpg
450 0.01%29/Jun/05 21:28/graphics/fun/netbunnies/kanit1-makela1.jpg
450 0.02%29/Jun/05 21:30/graphics/fun/netbunnies/Mvc-017s.jpg
450 0.02%29/Jun/05 20:38/graphics/fun/netbunnies/laraotoole2-swieconek1.jpg
450 0.01%29/Jun/05 21:53/graphics/fun/netbunnies/huggies-Caulders1.jpg
450 0.01%29/Jun/05 20:28/graphics/fun/netbunnies/toto-siu1.jpg
450 0.01%29/Jun/05 22:33/graphics/fun/netbunnies/Shadow.jpg
450 0.01%29/Jun/05 20:58/graphics/fun/netbunnies/Tommy2.jpg
450 0.02%29/Jun/05 20:04/graphics/fun/netbunnies/abbott-myers1.jpg
449 0.02%29/Jun/05 21:22/graphics/fun/netbunnies/alfie1-finn1.jpg
449 0.02%29/Jun/05 22:13/graphics/fun/netbunnies/bunnies6-doerfler1.jpg
449 0.01%29/Jun/05 22:45/journal/2-5/mr-b.html
449 0.02%29/Jun/05 22:13/graphics/fun/netbunnies/cumi +cheeky-lia1.jpg
449 0.02%29/Jun/05 16:09/graphics/fun/netbunnies/bunnylove-walker1.jpg
449 0.01%29/Jun/05 22:55/journal/3-10/graphics/rabbit-class.gif
449 0.02%29/Jun/05 21:26/graphics/fun/netbunnies/willow3-stardancer1.jpg
449 0.01%29/Jun/05 12:25/chapters/san-francisco/graphics/adoptables/SF_Frankie_1_FEb05.jpg
448 0.01%29/Jun/05 12:25/chapters/san-francisco/graphics/adoptables/SF_Frankie_2_Feb05.jpg
448 0.02%29/Jun/05 21:49/graphics/fun/netbunnies/bunnies2-doerfler1.jpg
448 0.03%29/Jun/05 21:46/graphics/fun/netbunnies/tinker+alexa-chen1.jpg
448 0.01%29/Jun/05 21:10/care/abuse.html
448 0.01%29/Jun/05 20:25/graphics/fun/netbunnies/peterbenben-eng1.jpg
448 0.01%29/Jun/05 21:50/graphics/fun/netbunnies/blackie.jpg
447 0.02%29/Jun/05 21:22/graphics/fun/netbunnies/maroon-lin1.jpg
447 0.02%29/Jun/05 23:20/graphics/fun/netbunnies/lapinface.jpg
447 0.02%29/Jun/05 20:03/graphics/fun/netbunnies/oreo-marroney1.jpg
447 0.01%29/Jun/05 20:36/graphics/fun/netbunnies/ding-Kujawa1.jpg
447 0.02%29/Jun/05 21:49/graphics/fun/netbunnies/victor-woods1.jpg
447 0.02%29/Jun/05 18:06/graphics/fun/netbunnies/abbey3-swordams1.jpg
447 0.01%29/Jun/05 21:51/graphics/fun/netbunnies/baxtersmall1.jpg
446 0.03%29/Jun/05 22:38/graphics/fun/netbunnies/daisy2-schnellbach1.jpg
446 0.01%29/Jun/05 15:57/graphics/fun/netbunnies/black-ho1.jpg
446 0.02%29/Jun/05 22:45/graphics/fun/netbunnies/thegirls.jpg
446 0.02%29/Jun/05 22:45/graphics/fun/netbunnies/bunny3-basmayer1.jpg
446 0.01%29/Jun/05 21:06/graphics/fun/netbunnies/a2.jpg
446 0.02%29/Jun/05 20:33/graphics/fun/netbunnies/basketofbuns-sharwell1.jpg
446 0.02%29/Jun/05 21:20/graphics/fun/netbunnies/Toffee-Batchelar1.jpg
446 0.01%29/Jun/05 21:32/graphics/fun/netbunnies/thumper-roxy3-bailey1.jpg
445 0.02%29/Jun/05 22:05/graphics/fun/netbunnies/josper-metsavir1.jpg
445 0.02%29/Jun/05 22:10/graphics/fun/netbunnies/birdie-Saisa1.jpg
445 0.06%29/Jun/05 19:37/graphics/fun/netbunnies/barney-long-lop-chair.jpg
445 0.01%29/Jun/05 22:36/graphics/fun/netbunnies/carnie-wright1.jpg
445 0.02%29/Jun/05 22:14/graphics/fun/netbunnies/wabbit1-luumi1.jpg
444 0.02%29/Jun/05 23:21/chapters/san-diego/products/graphics/HRS_Office_tshirts_2_Jan04.JPG
444 0.02%29/Jun/05 21:19/graphics/fun/netbunnies/pepper+sweetpea-wickerson1.jpg
444 0.04%29/Jun/05 21:30/graphics/fun/netbunnies/stormy-skyquest1.jpg
444 0.02%29/Jun/05 22:46/graphics/fun/netbunnies/ziggy-hansberry1.jpg
444 0.02%29/Jun/05 21:40/graphics/fun/netbunnies/floppy-walko1.jpg
443 0.01%29/Jun/05 20:32/graphics/fun/netbunnies/oreo-oei1.jpg
443 0.02%29/Jun/05 22:28/graphics/fun/netbunnies/bunnybutts3-spence1.jpg
443 0.02%29/Jun/05 19:45/graphics/fun/netbunnies/freckles-mullins1.jpg
443 0.01%29/Jun/05 21:22/graphics/fun/netbunnies/waabooz1-erin1.jpg
443 0.01%29/Jun/05 22:43/journal/1/kingdoms.html
443 0.02%29/Jun/05 20:36/graphics/fun/netbunnies/boo-wal1.jpg
443 0.01%29/Jun/05 21:49/graphics/fun/netbunnies/bandit-wachowiak1.jpg
443 0.03%29/Jun/05 23:53/graphics/fun/netbunnies/buddy2-elliott1.jpg
442 0.01%29/Jun/05 22:35/graphics/fun/netbunnies/barnie3-lee1.jpg
442 0.01%29/Jun/05 23:15/graphics/fun/netbunnies/enki-Lucy1.jpg
442 0.01%29/Jun/05 20:36/graphics/fun/netbunnies/beezle-hayworth1.jpg
441 0.01%29/Jun/05 23:22/graphics/fun/netbunnies/asher-underwood1.jpg
441 0.02%29/Jun/05 21:34/graphics/fun/netbunnies/cooper-graham1.jpg
441 0.01%29/Jun/05 22:37/graphics/fun/netbunnies/bunbun-Caines1.jpg
441 0.01%29/Jun/05 20:46/graphics/fun/netbunnies/willie1-melton1.jpg
441 0.01%29/Jun/05 22:00/graphics/fun/netbunnies/bambi-winter1.jpg
441 0.03%29/Jun/05 22:05/graphics/fun/netbunnies/owen-anderson1.jpg
440 0.02%29/Jun/05 21:50/graphics/fun/netbunnies/manny-anderson1.jpg
440 0.02%29/Jun/05 21:45/graphics/fun/netbunnies/hawaiibest-caulders1.jpg
440 0.01%29/Jun/05 21:31/graphics/fun/netbunnies/milo1-mack1.jpg
440 0.01%29/Jun/05 23:21/chapters/san-diego/products/graphics/HRS_Office_donated_toys_Jan04.JPG
439 0.02%29/Jun/05 22:04/graphics/fun/netbunnies/amigos2-butcher1.jpg
439 0.01%29/Jun/05 16:35/graphics/fun/netbunnies/She-Zdila1.jpg
439 0.02%29/Jun/05 21:21/graphics/fun/netbunnies/winniefred-morris1.jpg
439 0.01%29/Jun/05 19:42/graphics/fun/netbunnies/buttons1-martin1.jpg
439 0.01%29/Jun/05 21:36/graphics/fun/netbunnies/rabbit-ellen1.jpg
439 0.01%29/Jun/05 19:34/graphics/fun/netbunnies/amos.jpg
439 0.01%29/Jun/05 23:06/chapters/san-diego/aboutus/bunnyfest/bfest_photos/CCLaceyBeau55.jpg
439 0.03%29/Jun/05 21:23/graphics/fun/netbunnies/montythumper1-carpenter1.jpg
439 0.01%29/Jun/05 22:45/graphics/fun/netbunnies/r2-1-lin1.jpg
439 0.02%29/Jun/05 21:15/graphics/fun/netbunnies/bailie-micci1.jpg
438 0.02%29/Jun/05 20:36/graphics/fun/netbunnies/rusty-forsythe1.jpg
438 0.01%29/Jun/05 20:49/graphics/fun/netbunnies/luna5-kateri1.jpg
438 0.01%29/Jun/05 23:05/chapters/san-diego/behavior/graphics/bunnyproofing_supplies.JPG
438 0.02%29/Jun/05 22:15/graphics/fun/netbunnies/chip2-smith1.jpg
438 0.02%29/Jun/05 21:25/graphics/fun/netbunnies/amelia1-mcsherry1.jpg
438 29/Jun/05 19:29/rabbit-center/lucky/luckyphotos.htm
438 0.02%29/Jun/05 22:01/graphics/fun/netbunnies/killer-dodge1.jpg
438 0.02%29/Jun/05 22:24/graphics/fun/netbunnies/tubby-tima1.jpg
438 0.01%29/Jun/05 21:40/graphics/fun/netbunnies/toby3-carolyn1.jpg
438 0.02%29/Jun/05 21:30/graphics/fun/netbunnies/chubbs-daisy1-esquivel1.jpg
437 0.02%29/Jun/05 20:27/graphics/fun/netbunnies/snugglesnoodles-Yoder1.jpg
437 0.01%29/Jun/05 20:32/graphics/fun/netbunnies/benjy3-louise1.jpg
437 0.02%29/Jun/05 20:59/graphics/fun/netbunnies/bun4-Breese1.jpg
437 0.01%29/Jun/05 21:33/graphics/fun/netbunnies/mabel-anderson1.jpg
437 0.04%29/Jun/05 18:45/graphics/fun/netbunnies/cookie-lovell1.jpg
437 0.02%29/Jun/05 23:20/graphics/fun/netbunnies/bun-barnett1.jpg
436 0.02%29/Jun/05 15:55/graphics/fun/netbunnies/Snugglesspagetti-Yoder1.jpg
436 0.01%29/Jun/05 21:48/graphics/fun/netbunnies/bunny-yee1.jpg
436 0.01%29/Jun/05 21:47/graphics/fun/netbunnies/shaz-seay1.jpg
436 0.03%29/Jun/05 21:19/graphics/fun/netbunnies/theo1-smith1.jpg
436 0.03%29/Jun/05 23:19/graphics/fun/netbunnies/bunnies2-schroeder1.jpg
436 0.02%29/Jun/05 20:26/graphics/fun/netbunnies/willie-martin1.jpg
436 0.03%29/Jun/05 21:46/graphics/fun/netbunnies/herdoc-gerdoc-9wks-on-backs.jpg
436 0.01%29/Jun/05 21:48/graphics/fun/netbunnies/jellybean1-ozab1.jpg
436 0.02%29/Jun/05 21:17/graphics/fun/netbunnies/baileybunny-Chaplin1.jpg
436 0.02%29/Jun/05 23:52/graphics/fun/netbunnies/spikebruiser5-hounsell1.jpg
436 0.01%29/Jun/05 21:51/chapters/san-diego/health/graphics/morebadteeth.jpg
436 0.01%29/Jun/05 23:07/chapters/san-diego/behavior/graphics/Toss_toys.JPG
436 0.02%29/Jun/05 14:03/graphics/fun/netbunnies/hazel-majane1.jpg
436 0.03%29/Jun/05 21:47/graphics/fun/netbunnies/bunny20-Kaldal1.jpg
435 0.01%29/Jun/05 20:38/graphics/fun/netbunnies/angel-jan1.jpg
435 0.01%29/Jun/05 20:33/graphics/fun/netbunnies/calvin1-pope1.jpg
435 0.01%29/Jun/05 20:58/graphics/fun/netbunnies/kizzy1-hughes1.jpg
435 0.01%29/Jun/05 21:16/graphics/fun/netbunnies/both-blue1.jpg
435 0.01%29/Jun/05 21:30/graphics/fun/netbunnies/leia-sh1.jpg
435 0.02%29/Jun/05 19:33/graphics/fun/netbunnies/babybunny-Shinelun1.jpg
435 0.03%29/Jun/05 19:54/graphics/fun/netbunnies/buckland-steven1.jpg
435 0.01%29/Jun/05 22:47/graphics/fun/netbunnies/chopper-Raymond1.jpg
435 0.02%29/Jun/05 21:46/graphics/fun/netbunnies/muffy4.jpg
435 0.02%29/Jun/05 22:24/graphics/fun/netbunnies/rabbits-sargeant1.jpg
435 0.01%29/Jun/05 16:15/graphics/fun/netbunnies/amelia-mel-shay1.jpg
434 0.01%29/Jun/05 19:25/graphics/fun/netbunnies/daphne-chen1.jpg
434 0.02%29/Jun/05 22:24/graphics/fun/netbunnies/rabbit-hurley1.jpg
434 0.01%29/Jun/05 20:53/graphics/fun/netbunnies/myranda rose-odell1.jpg
434 0.02%29/Jun/05 20:32/graphics/fun/netbunnies/superbunny-hiebert1.jpg
434 0.02%29/Jun/05 21:49/graphics/fun/netbunnies/bigbun-Hardai1.jpg
434 0.01%30/Jun/05 00:05/graphics/fun/netbunnies/austin1-rhonda1.jpg
433 29/Jun/05 22:01/cgi-bin/suid/~rabbit2/san-diego/search
433 0.01%29/Jun/05 22:13/graphics/fun/netbunnies/pixie04c.jpg
433 0.02%29/Jun/05 16:11/graphics/fun/netbunnies/Siu-Choi1.jpg
433 0.01%29/Jun/05 21:38/graphics/fun/netbunnies/kuzya-katz1.jpg
433 0.01%29/Jun/05 21:17/graphics/fun/netbunnies/clooney-curtin1.jpg
433 0.01%29/Jun/05 16:14/graphics/fun/netbunnies/flopsy-lane1.jpg
433 29/Jun/05 11:06/chapters/san-diego/adoption/Adoption_Photos/vito3.jpg
433 0.02%29/Jun/05 21:18/graphics/fun/netbunnies/xmasrab-Rtocups1.jpg
433 0.02%29/Jun/05 21:16/graphics/fun/netbunnies/bailey4-erin1.jpg
433 0.04%29/Jun/05 23:53/graphics/fun/netbunnies/milizard3-joy1.jpg
432 0.04%29/Jun/05 19:32/graphics/fun/netbunnies/bartside.jpg
432 0.02%29/Jun/05 22:14/graphics/fun/netbunnies/eric15.jpg
432 0.01%30/Jun/05 00:05/graphics/fun/netbunnies/pandora-heidi1.jpg
432 0.01%29/Jun/05 21:19/graphics/fun/netbunnies/arcanist2-bun1.jpg
432 0.01%29/Jun/05 19:40/graphics/fun/netbunnies/yuri-Lawson1.jpg
432 0.04%30/Jun/05 00:06/graphics/fun/netbunnies/bill.jpg
432 0.01%29/Jun/05 22:47/graphics/fun/netbunnies/clover-pavhol1.jpg
432 0.02%29/Jun/05 21:50/graphics/fun/netbunnies/bunny2-dibunny1.jpg
432 0.02%29/Jun/05 21:47/graphics/fun/netbunnies/bunny2-spence1.jpg
432 0.02%29/Jun/05 22:01/graphics/fun/netbunnies/crissinina-santos1.jpg
432 0.01%29/Jun/05 21:20/graphics/fun/netbunnies/Toby3-Wingfield1.jpg
432 29/Jun/05 20:54/hrs-info/philosophy.html
432 0.03%29/Jun/05 21:48/graphics/fun/netbunnies/rabbitwithcataroundcorner.jpg
431 0.04%29/Jun/05 20:32/graphics/fun/netbunnies/basil-cook1.jpg
431 0.04%29/Jun/05 20:31/graphics/fun/netbunnies/kiwi3-kaczmarski1.jpg
431 0.03%29/Jun/05 20:37/graphics/fun/netbunnies/cuddles2-koza1.jpg
431 0.01%29/Jun/05 18:23/journal/3-10/pain.html
431 0.01%29/Jun/05 19:58/graphics/fun/netbunnies/bloop-rockel1.jpg
431 0.01%29/Jun/05 21:48/graphics/fun/netbunnies/cammie-thiene1.jpg
431 29/Jun/05 23:53/graphics/fun/netbunnies/r956amber42tiny.jpg
431 0.04%29/Jun/05 22:48/graphics/fun/netbunnies/cadbury-martin1.jpg
431 0.01%29/Jun/05 14:14/graphics/fun/netbunnies/achog-elamk2c1.jpg
430 0.03%29/Jun/05 21:30/graphics/fun/netbunnies/rabbit2-Blair1.jpg
430 0.02%29/Jun/05 21:53/graphics/fun/netbunnies/bun1-cabin1.jpg
430 0.01%29/Jun/05 21:22/graphics/fun/netbunnies/fiona1-broley1.jpg
430 0.02%29/Jun/05 21:31/graphics/fun/netbunnies/cinnamon3-carisbug1.jpg
430 0.01%29/Jun/05 13:13/graphics/fun/netbunnies/bart-williams1.jpg
430 0.03%29/Jun/05 16:17/graphics/fun/netbunnies/paige-hester1.jpg
430 0.02%29/Jun/05 21:49/graphics/fun/netbunnies/doe+panda-howo1.jpg
430 0.02%29/Jun/05 22:02/graphics/fun/netbunnies/bigwig+sugaree-bielawski1.jpg
430 0.02%29/Jun/05 15:23/graphics/fun/netbunnies/nyuszo-zsuzsanna1.jpg
430 0.01%29/Jun/05 19:30/graphics/fun/netbunnies/SCHMOO.jpg
430 0.01%29/Jun/05 22:33/graphics/fun/netbunnies/arbutus.jpg
430 0.01%29/Jun/05 22:00/graphics/fun/netbunnies/cadbury-budesa1.jpg
430 0.02%29/Jun/05 20:31/graphics/fun/netbunnies/bed.jpg
430 0.02%29/Jun/05 21:49/graphics/fun/netbunnies/frodo-oberley1.jpg
430 0.01%29/Jun/05 20:29/graphics/fun/netbunnies/vegan2-christina1.jpg
429 0.01%29/Jun/05 22:25/chapters/san-diego/adoption/Adoption_Photos/Jonathon_adoption_21May05.jpg
429 0.02%29/Jun/05 21:17/graphics/fun/netbunnies/ginger1-herrington1.jpg
429 0.02%30/Jun/05 00:05/graphics/fun/netbunnies/sesarog-hos1.jpg
429 0.03%29/Jun/05 19:43/graphics/fun/netbunnies/beachingbunnieshenriettaho.jpg
429 0.02%29/Jun/05 22:24/graphics/fun/netbunnies/willow1-stardancer1.jpg
429 0.03%29/Jun/05 21:00/graphics/fun/netbunnies/henrybumble-smith1.jpg
429 0.02%29/Jun/05 22:48/graphics/fun/netbunnies/alfie3-finn1.jpg
429 0.02%29/Jun/05 23:52/graphics/fun/netbunnies/conejo4-Collado1.jpg
429 29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Sable_Jun05.jpg
428 0.02%29/Jun/05 23:53/graphics/fun/netbunnies/snow2-nscean1.jpg
428 0.01%29/Jun/05 21:30/graphics/fun/netbunnies/oeddie-henry1.jpg
428 0.02%29/Jun/05 21:18/graphics/fun/netbunnies/belle-torgomama1.jpg
428 0.01%29/Jun/05 23:05/chapters/san-diego/behavior/graphics/Cord_keeper.JPG
428 0.02%29/Jun/05 20:26/graphics/fun/netbunnies/peter-barrett1.jpg
428 0.02%29/Jun/05 15:26/graphics/fun/netbunnies/marble-haviva1.jpg
428 0.01%29/Jun/05 13:42/graphics/fun/netbunnies/gilligan-douglas1.jpg
428 0.01%29/Jun/05 22:04/graphics/fun/netbunnies/hobo1-candelmo1.jpg
428 0.03%29/Jun/05 22:15/graphics/fun/netbunnies/bunnies.gif
428 0.02%29/Jun/05 20:56/graphics/fun/netbunnies/floppy-taylor1.jpg
428 0.02%29/Jun/05 21:47/graphics/fun/netbunnies/garden-fischer1.jpg
428 0.01%29/Jun/05 23:18/graphics/fun/netbunnies/toots1-grecco1.jpg
428 0.01%29/Jun/05 19:36/graphics/fun/netbunnies/wasabi-yee1.jpg
428 0.02%29/Jun/05 15:51/graphics/fun/netbunnies/brewster-chiang1.jpg
428 0.02%29/Jun/05 19:57/graphics/fun/netbunnies/boozie-dewhurst1.jpg
428 0.02%29/Jun/05 20:53/graphics/fun/netbunnies/amusematte-herrington1.jpg
428 0.01%29/Jun/05 23:05/chapters/san-diego/behavior/graphics/Corner_guards.jpg
428 0.06%29/Jun/05 23:09/chapters/san-diego/behavior/graphics/Bitter_preparations.JPG
427 0.02%30/Jun/05 00:05/graphics/fun/netbunnies/jasper-silvery1.jpg
427 0.04%29/Jun/05 19:33/graphics/fun/netbunnies/truffles-white-lop-drinking.jpg
427 0.01%29/Jun/05 22:37/graphics/fun/netbunnies/Todd2-Lonergan1.jpg
427 0.01%29/Jun/05 21:40/graphics/fun/netbunnies/dandy-jenny1.jpg
427 0.02%29/Jun/05 21:42/graphics/fun/netbunnies/sunny1-hansen1.jpg
427 0.02%29/Jun/05 21:48/graphics/fun/netbunnies/becky-semler1.jpg
427 0.01%29/Jun/05 22:25/chapters/san-diego/adoption/Adoption_Photos/AG_HA_Buster_Vito__May05.jpg
427 0.01%29/Jun/05 21:06/graphics/fun/netbunnies/willow3-coder1.jpg
427 0.01%29/Jun/05 19:22/graphics/fun/netbunnies/princess-pendergast1.jpg
427 0.02%29/Jun/05 21:57/graphics/fun/netbunnies/wiggles-giles1.jpg
427 0.02%29/Jun/05 21:20/graphics/fun/netbunnies/jack-mixich1.jpg
427 0.01%29/Jun/05 23:05/chapters/san-diego/behavior/graphics/Cord_clips.JPG
427 0.02%29/Jun/05 23:40/graphics/fun/netbunnies/puput-merikanto1.jpg
427 0.02%29/Jun/05 21:21/graphics/fun/netbunnies/elvira-odell1.jpg
427 0.01%29/Jun/05 22:38/graphics/fun/netbunnies/cookie-mazurek1.jpg
426 0.01%29/Jun/05 21:18/graphics/fun/netbunnies/luna1-spotty1.jpg
426 0.01%29/Jun/05 21:39/graphics/fun/netbunnies/bramwell-nelson1.jpg
426 0.01%29/Jun/05 20:34/graphics/fun/netbunnies/herby-wright1jpg.jpg
426 0.02%29/Jun/05 22:01/graphics/fun/netbunnies/tashi-mypetsrule1.jpg
426 0.01%29/Jun/05 22:28/graphics/fun/netbunnies/weenie-smith1.jpg
426 0.01%29/Jun/05 23:05/chapters/san-diego/behavior/graphics/Lamp_cord.JPG
426 0.02%29/Jun/05 22:34/graphics/fun/netbunnies/daisy1-schnellbach1.jpg
426 0.01%29/Jun/05 23:19/graphics/fun/netbunnies/fuzz1.jpg
426 0.02%29/Jun/05 21:00/graphics/fun/netbunnies/natasha-anderson1.jpg
426 0.02%29/Jun/05 22:04/graphics/fun/netbunnies/tepp2-noa1.jpg
426 0.02%29/Jun/05 20:51/graphics/fun/netbunnies/buggzy-pinto1.jpg
425 0.02%29/Jun/05 22:14/graphics/fun/netbunnies/sootysweep-small1.jpg
425 0.01%29/Jun/05 22:47/graphics/fun/netbunnies/SuzyBetty-Harris1.jpg
425 0.01%29/Jun/05 20:27/graphics/fun/netbunnies/bunny-gasparick1.jpg
425 0.02%29/Jun/05 21:15/graphics/fun/netbunnies/melizard1-joy1.jpg
425 0.02%29/Jun/05 19:44/graphics/fun/netbunnies/chompy+zebedee-thompson1.jpg
425 0.01%29/Jun/05 22:29/chapters/san-diego/behavior/expect.html
425 0.02%29/Jun/05 19:23/graphics/fun/netbunnies/whiterabbitbymirrorlasko.jpg
425 0.01%29/Jun/05 21:42/care/sick.html
424 0.01%29/Jun/05 22:13/graphics/fun/netbunnies/litlu-hos1.jpg
424 0.01%29/Jun/05 22:01/graphics/fun/netbunnies/melanie-rath1.jpg
424 0.01%29/Jun/05 22:05/graphics/fun/netbunnies/batuffolo1-massimo1.jpg
424 0.02%29/Jun/05 21:22/graphics/fun/netbunnies/binkyaustin3-rhonda1.jpg
424 0.01%29/Jun/05 21:22/graphics/fun/netbunnies/waabooz-erin1.jpg
424 0.02%29/Jun/05 22:46/graphics/fun/netbunnies/bb-lea1.jpg
424 0.01%29/Jun/05 21:01/graphics/fun/netbunnies/fudge2-leigh1.jpg
424 0.01%29/Jun/05 23:05/chapters/san-diego/behavior/graphics/Entertainment_center1.JPG
424 0.02%29/Jun/05 20:23/graphics/fun/netbunnies/thumper-gynn1.jpg
424 0.01%29/Jun/05 16:25/graphics/fun/netbunnies/basil1-bivona1.jpg
424 0.02%29/Jun/05 15:48/graphics/fun/netbunnies/lily3-schroeder1.jpg
423 0.02%29/Jun/05 22:14/graphics/fun/netbunnies/bunny in garden-winden1.jpg
423 0.05%30/Jun/05 00:05/graphics/fun/netbunnies/minnie-doe-3yr-outside.jpg
423 0.02%29/Jun/05 22:00/graphics/fun/netbunnies/candy1-asa1.jpg
423 0.01%29/Jun/05 21:02/graphics/fun/netbunnies/moby1-odell1.jpg
423 0.01%29/Jun/05 23:25/graphics/fun/netbunnies/Bunny.gif
423 0.03%29/Jun/05 20:56/graphics/fun/netbunnies/pepper-lop-leikers.jpg
423 0.02%29/Jun/05 22:38/graphics/fun/netbunnies/nibbles-floyd1.jpg
423 0.02%29/Jun/05 15:44/graphics/fun/netbunnies/jasper-walker1.jpg
422 0.04%29/Jun/05 22:24/graphics/fun/netbunnies/buddha1-nolan1.jpg
422 0.01%29/Jun/05 20:26/graphics/fun/netbunnies/daphne-tck1.jpg
422 0.01%29/Jun/05 17:35/graphics/fun/netbunnies/belle1-capps1.jpg
422 0.02%29/Jun/05 20:54/graphics/fun/netbunnies/moose-katievic1.jpg
422 0.02%29/Jun/05 21:51/graphics/fun/netbunnies/max1-hanna1.jpg
422 0.01%29/Jun/05 20:58/graphics/fun/netbunnies/elwood1-cook1.jpg
422 0.02%29/Jun/05 23:19/graphics/fun/netbunnies/higgins-Dwyer1.jpg
422 0.04%29/Jun/05 22:37/graphics/fun/netbunnies/bartback.jpg
422 0.01%29/Jun/05 21:21/graphics/fun/netbunnies/fluffy-mauler1.jpg
422 0.02%29/Jun/05 19:37/graphics/fun/netbunnies/fuzzy-ko1.jpg
422 0.02%29/Jun/05 21:38/graphics/fun/netbunnies/ben-trent1.jpg
422 0.01%29/Jun/05 19:59/graphics/fun/netbunnies/dickens-bon1.jpg
422 0.02%29/Jun/05 21:24/graphics/fun/netbunnies/benny-appilini1.jpg
422 0.01%29/Jun/05 22:25/chapters/san-diego/adoption/Adoption_Photos/Ned_adoption_1May05.jpg
422 0.01%29/Jun/05 22:47/graphics/fun/netbunnies/bongo2_sylviaw1.jpg
422 0.01%29/Jun/05 21:40/graphics/fun/netbunnies/artie-forsythe1.jpg
422 0.02%29/Jun/05 22:24/graphics/fun/netbunnies/misha-tarling1.jpg
421 0.01%29/Jun/05 23:21/graphics/fun/netbunnies/music-yoshimura1.jpg
421 0.01%29/Jun/05 18:08/graphics/fun/netbunnies/samantha2-sousa1.jpg
421 0.01%29/Jun/05 23:18/graphics/fun/netbunnies/bunbun-young1.jpg
421 0.01%29/Jun/05 21:47/graphics/fun/netbunnies/babyhat-gavrilovich1.jpg
421 0.02%29/Jun/05 23:20/graphics/fun/netbunnies/chocolate1-ko1.jpg
421 0.02%29/Jun/05 23:29/journal/4-7/hay.html
421 0.01%29/Jun/05 22:13/graphics/fun/netbunnies/thumper-vaga1.jpg
421 0.02%29/Jun/05 22:24/graphics/fun/netbunnies/ralph_lunn1.jpg
421 0.02%29/Jun/05 20:55/graphics/fun/netbunnies/rabbit-kissoon1.jpg
421 0.02%29/Jun/05 20:57/graphics/fun/netbunnies/owen-slessor1.jpg
421 0.01%29/Jun/05 21:42/graphics/fun/netbunnies/bunnyflower-sepesy1.jpg
421 0.01%29/Jun/05 22:04/graphics/fun/netbunnies/toto-charonnet1.jpg
420 0.01%29/Jun/05 23:38/graphics/fun/netbunnies/babies-chickermane1.jpg
420 0.03%29/Jun/05 21:30/graphics/fun/netbunnies/pippin2-casteneda1.jpg
420 0.01%29/Jun/05 21:05/graphics/fun/netbunnies/kaopectate-dales1.jpg
420 0.01%29/Jun/05 23:19/graphics/fun/netbunnies/bubba-capps1.jpg
420 0.05%29/Jun/05 22:25/chapters/san-diego/adoption/Adoption_Photos/Stewart_Cherokee_2_Apr05.jpg
420 0.01%29/Jun/05 23:53/graphics/fun/netbunnies/cal.jpg
420 0.02%29/Jun/05 19:22/graphics/fun/netbunnies/fluffy-Wong1.jpg
420 0.02%29/Jun/05 21:39/graphics/fun/netbunnies/feebie-cooke1.jpg
420 0.02%29/Jun/05 21:26/graphics/fun/netbunnies/teriyaki-tima1.jpg
420 0.02%29/Jun/05 23:18/graphics/fun/netbunnies/buckyshadow-jackson1.jpg
420 0.02%29/Jun/05 21:20/graphics/fun/netbunnies/bailey2-smith1.jpg
420 0.01%29/Jun/05 17:54/graphics/fun/netbunnies/bubbles-ng1.jpg
420 0.02%29/Jun/05 18:38/graphics/fun/netbunnies/crissinina-correa1.jpg
420 0.01%29/Jun/05 21:23/graphics/fun/netbunnies/milo-magyar1.jpg
420 0.01%29/Jun/05 20:32/graphics/fun/netbunnies/colonel-carlshausen1.jpg
420 0.02%29/Jun/05 21:31/graphics/fun/netbunnies/rusty-hanson1.jpg
420 0.03%29/Jun/05 20:33/graphics/fun/netbunnies/bunnies-borealis1.jpg
420 0.01%29/Jun/05 22:25/chapters/san-diego/adoption/Adoption_Photos/Misty_adoption_1May05.jpg
419 0.02%29/Jun/05 22:45/graphics/fun/netbunnies/chang-dixon1.jpg
419 0.03%29/Jun/05 21:16/graphics/fun/netbunnies/untitled1-salas1.jpg
419 0.02%29/Jun/05 22:37/graphics/fun/netbunnies/bunnies1-prairie1.jpg
419 0.02%29/Jun/05 21:59/graphics/fun/netbunnies/bunny1-suarez1.jpg
419 0.01%29/Jun/05 23:22/chapters/san-diego/faq/graphics/faq_headergraphic_v2.jpg
419 0.02%29/Jun/05 20:53/graphics/fun/netbunnies/mybunny-parker1.jpg
419 29/Jun/05 21:57/graphics/mine/foo/
10 28/Jun/05 02:44  /graphics/mine/foo/?D=A
10 29/Jun/05 19:29  /graphics/mine/foo/?N=D
419 0.02%29/Jun/05 21:37/graphics/fun/netbunnies/mudslide-rhoades1.jpg
419 0.01%29/Jun/05 19:23/graphics/fun/netbunnies/thumper-prince1.jpg
419 0.06%29/Jun/05 21:57/graphics/fun/netbunnies/brown-rabbit-bricks2.jpg
419 0.01%29/Jun/05 21:20/graphics/fun/netbunnies/bugs-danaher1.jpg
418 0.04%29/Jun/05 21:22/graphics/fun/netbunnies/wabbits-holden1.jpg
418 0.01%29/Jun/05 21:30/graphics/fun/netbunnies/rabbit-makuh1.jpg
418 0.02%29/Jun/05 17:43/graphics/fun/netbunnies/rabbit6-oehler1.jpg
418 0.01%29/Jun/05 19:41/graphics/fun/netbunnies/sylvester-Hadjigeorgiou1.jpg
418 0.02%29/Jun/05 22:05/graphics/fun/netbunnies/commander-hanford1.jpg
418 0.01%29/Jun/05 20:28/graphics/fun/netbunnies/bunny2-chica1.jpg
418 0.01%30/Jun/05 00:06/graphics/fun/netbunnies/bunnie2-hatton1.jpg
418 0.04%29/Jun/05 23:20/graphics/fun/netbunnies/buns_family.jpg
418 0.02%29/Jun/05 22:47/graphics/fun/netbunnies/reggie-odell1.jpg
418 0.02%29/Jun/05 20:39/graphics/fun/netbunnies/lulabelle.jpg
418 0.01%29/Jun/05 15:39/graphics/fun/netbunnies/stravinsky2-taylor1.jpg
418 0.02%29/Jun/05 21:17/graphics/fun/netbunnies/busterwithlowerteeth.jpg
417 29/Jun/05 22:13/hrs-info/donation.html
417 0.02%29/Jun/05 23:18/graphics/fun/netbunnies/pru3-ha1.jpg
417 0.01%29/Jun/05 21:47/graphics/fun/netbunnies/buninpot4.jpg
417 0.01%29/Jun/05 20:29/graphics/fun/netbunnies/weblio1-aki1.jpg
417 0.12%29/Jun/05 16:41/chapters/san-diego/diet/Food_Chart.pdf
417 0.01%29/Jun/05 22:36/graphics/fun/netbunnies/peanut-Daniels1.jpg
417 0.03%29/Jun/05 21:46/graphics/fun/netbunnies/bew-asa1.jpg
417 0.02%29/Jun/05 22:04/graphics/fun/netbunnies/puppy-brian1.jpg
417 0.03%29/Jun/05 23:20/graphics/fun/netbunnies/jesse+moby-odell1.jpg
417 0.03%29/Jun/05 23:53/graphics/fun/netbunnies/bunbun-allbriggidy1.jpg
417 0.01%29/Jun/05 22:02/graphics/fun/netbunnies/pearl+spiro-anderson1.jpg
417 0.01%29/Jun/05 23:53/graphics/fun/netbunnies/janks1-kelly1.jpg
417 0.01%29/Jun/05 21:29/graphics/fun/netbunnies/spike-doubleday1.jpg
417 0.01%29/Jun/05 22:38/graphics/fun/netbunnies/baileymason-Chaplin1.jpg
417 0.01%29/Jun/05 21:23/graphics/fun/netbunnies/boncuk1-sahinalp1.jpg
417 0.01%29/Jun/05 23:19/graphics/fun/netbunnies/booboo1-strohmeyer1.jpg
417 0.02%29/Jun/05 22:39/graphics/fun/netbunnies/wiggles2-moore1.jpg
417 0.02%29/Jun/05 20:38/graphics/fun/netbunnies/p_minc.jpg
417 0.01%29/Jun/05 18:37/graphics/fun/netbunnies/hermione2-tourret1.jpg
417 0.01%29/Jun/05 15:53/graphics/fun/netbunnies/hops5.jpg
417 0.02%29/Jun/05 16:23/graphics/fun/netbunnies/luna-lyerly1.jpg
417 0.01%29/Jun/05 22:04/graphics/fun/netbunnies/att2-hotstuff1.jpg
417 0.03%29/Jun/05 20:03/graphics/fun/netbunnies/thumper-knorr1.jpg
416 0.01%29/Jun/05 18:07/graphics/fun/netbunnies/lilly-peterson1.jpg
416 0.02%29/Jun/05 21:25/graphics/fun/netbunnies/kobalt-ugarenko1.jpg
416 0.01%29/Jun/05 22:38/graphics/fun/netbunnies/leiniegoof.jpg
416 0.02%29/Jun/05 21:30/graphics/fun/netbunnies/violet-seitz1.jpg
416 0.01%29/Jun/05 18:07/graphics/fun/netbunnies/licorice-gluck1.jpg
416 0.02%29/Jun/05 20:26/graphics/fun/netbunnies/thumper.jpg
416 0.03%29/Jun/05 20:54/graphics/fun/netbunnies/cuddles-ingram1.jpg
416 0.01%29/Jun/05 21:51/graphics/fun/netbunnies/tups-oasisfreak1.jpg
416 0.02%29/Jun/05 21:32/graphics/fun/netbunnies/bunnybasket-uijen1.jpg
416 0.01%29/Jun/05 22:57/graphics/fun/netbunnies/floortje-swuggers1.jpg
416 0.02%29/Jun/05 20:04/graphics/fun/netbunnies/scoobydoo-wilkinson1.jpg
416 0.02%29/Jun/05 12:44/graphics/fun/netbunnies/meandl-dlud1.jpg
416 0.01%29/Jun/05 19:41/graphics/fun/netbunnies/buddy1-elliott1.jpg
416 0.01%29/Jun/05 20:28/graphics/fun/netbunnies/fatlady1-piglet1.jpg
416 0.01%29/Jun/05 19:44/graphics/fun/netbunnies/georgie_lake1.jpg
416 0.02%29/Jun/05 21:24/graphics/fun/netbunnies/starsky-carrington1.jpg
416 0.02%29/Jun/05 23:20/graphics/fun/netbunnies/missey-rogers1.jpg
416 0.01%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Penelope_June05.jpg
416 0.03%30/Jun/05 00:05/graphics/fun/netbunnies/whats-up.jpg
416 0.01%29/Jun/05 13:40/graphics/fun/netbunnies/cheyenne-anderson1.jpg
415 0.04%29/Jun/05 21:16/graphics/fun/netbunnies/bartup.jpg
415 0.01%29/Jun/05 20:58/graphics/fun/netbunnies/fall-anderson1.jpg
415 0.01%29/Jun/05 22:03/graphics/fun/netbunnies/daisy4-schnellbach1.jpg
415 0.02%29/Jun/05 21:18/graphics/fun/netbunnies/bunny2-baker1.jpg
415 29/Jun/05 20:47/rabbit-center/graphics/icon_retail.gif
415 0.01%29/Jun/05 22:00/graphics/fun/netbunnies/daisy-ho1.jpg
415 0.02%29/Jun/05 20:39/graphics/fun/netbunnies/speckles+yoshi-strope1.jpg
415 0.02%29/Jun/05 21:20/graphics/fun/netbunnies/stinky-wangchuk1.jpg
415 0.02%29/Jun/05 21:40/graphics/fun/netbunnies/bunnies1-clements1.jpg
415 0.01%29/Jun/05 20:29/graphics/fun/netbunnies/tabitha2-leung1.jpg
415 0.01%29/Jun/05 19:59/graphics/fun/netbunnies/bunster-kerry1.jpg
415 0.02%29/Jun/05 21:50/graphics/fun/netbunnies/max3-hamilton1.jpg
415 0.02%29/Jun/05 21:25/graphics/fun/netbunnies/smidgen-morris1.jpg
415 0.01%29/Jun/05 21:40/graphics/fun/netbunnies/pashmina-garbos1.jpg
415 0.01%29/Jun/05 21:46/graphics/fun/netbunnies/bently2-shi1.jpg
415 0.02%29/Jun/05 22:05/graphics/fun/netbunnies/dalebunny-crisnjay1.jpg
415 0.01%29/Jun/05 20:42/graphics/fun/netbunnies/einstein-kristen1.jpg
415 0.01%29/Jun/05 21:18/graphics/fun/netbunnies/bunandmoose.jpg
415 0.02%29/Jun/05 22:38/graphics/fun/netbunnies/fluff-kraina1.jpg
415 0.01%29/Jun/05 22:00/graphics/fun/netbunnies/smokey-donovan1.jpg
415 0.02%29/Jun/05 18:45/graphics/fun/netbunnies/chester-jones1.jpg
415 0.02%29/Jun/05 23:53/graphics/fun/netbunnies/dakota1-angelo1.jpg
415 0.02%29/Jun/05 19:34/graphics/fun/netbunnies/bumble-kinnard1.jpg
415 0.02%29/Jun/05 22:00/graphics/fun/netbunnies/bunny-nelson1.jpg
415 0.03%29/Jun/05 21:18/graphics/fun/netbunnies/roy-ford1.jpg
414 0.01%29/Jun/05 19:15/graphics/fun/netbunnies/dcp.jpg
414 0.02%29/Jun/05 21:45/graphics/fun/netbunnies/toby-penney1.jpg
414 0.02%29/Jun/05 23:19/graphics/fun/netbunnies/bianca-dudette1.jpg
414 0.01%29/Jun/05 21:53/graphics/fun/netbunnies/tink+ollie-habel1.jpg
414 0.03%29/Jun/05 15:37/hrs-info/vet-conference/attendees-alpha.html
414 0.01%29/Jun/05 22:47/graphics/fun/netbunnies/rory-jnr1.jpg
414 0.02%29/Jun/05 21:22/graphics/fun/netbunnies/bunny2.jpg
414 0.02%29/Jun/05 23:18/graphics/fun/netbunnies/frank-myers1.jpg
414 0.02%29/Jun/05 22:47/graphics/fun/netbunnies/snowball-Veres1.jpg
414 0.02%29/Jun/05 22:48/graphics/fun/netbunnies/bunny-brry1.jpg
414 0.02%29/Jun/05 21:47/graphics/fun/netbunnies/bubbles-wilkinson1.jpg
414 0.02%29/Jun/05 21:31/graphics/fun/netbunnies/fluff2-lee1.jpg
414 0.02%29/Jun/05 19:33/graphics/fun/netbunnies/bunbun7-lo1.jpg
414 0.01%29/Jun/05 19:38/graphics/fun/netbunnies/rex-hanson1.jpg
414 0.01%29/Jun/05 22:25/journal/3-1/learning-to-love-again.html
414 0.01%29/Jun/05 23:06/chapters/san-diego/behavior/graphics/mats.jpg
414 0.01%29/Jun/05 23:06/chapters/san-diego/behavior/graphics/Chair_protection2.JPG
414 0.02%29/Jun/05 15:31/graphics/fun/tinytim.jpg
414 0.01%29/Jun/05 16:26/graphics/fun/netbunnies/bugsy1-meier1.jpg
414 0.01%29/Jun/05 22:03/graphics/fun/netbunnies/dennis-turner1.jpg
414 0.01%29/Jun/05 20:58/graphics/fun/netbunnies/bunzone2.jpg
414 0.02%29/Jun/05 20:32/graphics/fun/netbunnies/peppermint-Walzer1.jpg
414 0.02%29/Jun/05 21:21/graphics/fun/netbunnies/benny-foofoo-rick1.jpg
414 0.01%29/Jun/05 22:25/chapters/san-diego/adoption/Adoption_Photos/CodiHalfpint_adoption_Apr05.jpg
414 0.01%29/Jun/05 19:58/graphics/fun/netbunnies/ginger2-herrington1.jpg
414 29/Jun/05 20:47/rabbit-center/retail/pixel.gif
414 0.02%29/Jun/05 22:10/graphics/fun/netbunnies/willow3-bowser1.jpg
414 0.03%29/Jun/05 16:35/graphics/fun/netbunnies/bunbun-apaluch1.jpg
413 0.02%29/Jun/05 22:02/graphics/fun/netbunnies/small.jpg
413 0.01%29/Jun/05 22:25/chapters/san-diego/adoption/Adoption_Photos/Neil_adoption_Apr05.jpg
413 0.01%29/Jun/05 21:25/graphics/fun/netbunnies/emily2-marroney1.jpg
413 0.01%29/Jun/05 16:23/graphics/fun/netbunnies/bunny-posey1.jpg
413 0.03%29/Jun/05 23:19/graphics/mine/toby-izzy/toby-best.jpg
413 0.03%29/Jun/05 22:47/graphics/fun/netbunnies/lavender.jpg
413 0.01%29/Jun/05 19:29/graphics/fun/netbunnies/peanutpuff-gluck1.jpg
413 0.01%29/Jun/05 21:47/graphics/fun/netbunnies/rabbit-a-spence1.jpg
413 0.01%29/Jun/05 22:24/graphics/fun/netbunnies/bosco-belle-graham1.jpg
413 0.03%29/Jun/05 21:16/graphics/fun/netbunnies/betabrownrabbitbybookcase.jpg
413 0.02%29/Jun/05 23:52/graphics/fun/netbunnies/bunny5-baker1.jpg
413 0.01%29/Jun/05 20:29/graphics/fun/netbunnies/bunhead-Wiles1.jpg
413 0.01%29/Jun/05 21:50/graphics/fun/netbunnies/smokey-jack1.jpg
413 0.02%29/Jun/05 20:54/graphics/fun/netbunnies/moon2-dana1.jpg
413 0.02%30/Jun/05 00:05/graphics/fun/netbunnies/cloverbun-Mulholland1.jpg
412 0.02%29/Jun/05 21:45/graphics/fun/netbunnies/starr1-pangia1.jpg
412 0.01%30/Jun/05 00:05/graphics/fun/netbunnies/sassy-campbell1.jpg
412 0.02%29/Jun/05 21:21/graphics/fun/netbunnies/georgethumper-wesorick1.jpg
412 0.02%29/Jun/05 17:09/graphics/fun/netbunnies/bunny2-suarez1.jpg
412 0.02%29/Jun/05 15:46/graphics/fun/netbunnies/stewit-Clifford1.jpg
412 0.01%29/Jun/05 20:36/graphics/fun/netbunnies/elle-gonzalez1.jpg
412 0.02%29/Jun/05 22:03/graphics/fun/netbunnies/blueberry2-perillat1.jpg
412 0.02%29/Jun/05 21:59/graphics/fun/netbunnies/buns2-martinez1.jpg
412 0.02%29/Jun/05 20:39/graphics/fun/netbunnies/varmint-dunn1.jpg
412 0.02%29/Jun/05 22:47/graphics/fun/netbunnies/baxter.jpg
412 0.02%29/Jun/05 16:12/graphics/fun/netbunnies/kiss2-Kirkham1.jpg
412 0.03%29/Jun/05 23:53/graphics/fun/netbunnies/daughters-brewster1.jpg
412 0.02%29/Jun/05 22:00/graphics/fun/netbunnies/daisy-dixon-ho1.jpg
412 0.02%29/Jun/05 17:04/graphics/fun/netbunnies/lester1-bowser1.jpg
412 0.02%29/Jun/05 19:27/graphics/fun/netbunnies/rabbits-millikin1.jpg
412 0.02%29/Jun/05 21:29/graphics/fun/netbunnies/nora-ford1.jpg
412 0.03%30/Jun/05 00:06/graphics/fun/netbunnies/reese-engler1.jpg
412 0.01%29/Jun/05 21:44/graphics/fun/netbunnies/punkin-harmon1.jpg
411 0.01%29/Jun/05 19:33/graphics/fun/netbunnies/callie-caple1.jpg
411 0.01%29/Jun/05 22:25/chapters/san-diego/adoption/Adoption_Photos/Molly_Rory_adoption_26Mar05.jpg
411 0.01%29/Jun/05 23:06/chapters/san-diego/behavior/graphics/Chair_protection1.JPG
411 0.02%29/Jun/05 22:13/graphics/fun/netbunnies/midnite-barnett1.jpg
411 0.01%29/Jun/05 23:53/graphics/fun/netbunnies/chloe-rhonda1.jpg
411 0.01%29/Jun/05 21:30/graphics/fun/netbunnies/annie-jacquard1.jpg
411 0.01%29/Jun/05 21:29/graphics/fun/netbunnies/bugsy+chloe-greene1.jpg
411 0.03%29/Jun/05 19:57/graphics/fun/netbunnies/bun3-Hodgett1.jpg
411 0.01%29/Jun/05 20:28/graphics/fun/netbunnies/sleepbu-ndren1.jpg
411 0.01%29/Jun/05 19:34/graphics/fun/netbunnies/dewfie-Ho1.jpg
411 0.02%29/Jun/05 21:49/graphics/fun/netbunnies/patch_backturn-berthereau1.jpg
411 0.02%29/Jun/05 21:30/graphics/fun/netbunnies/bunbun-szafranski1.jpg
411 0.01%29/Jun/05 21:24/graphics/fun/netbunnies/lennard2-McSweeney1.jpg
411 0.02%29/Jun/05 19:31/graphics/fun/netbunnies/boba4-shi1.jpg
411 0.02%29/Jun/05 22:14/graphics/fun/netbunnies/bunnies7-doerfler1.jpg
411 0.03%29/Jun/05 22:37/graphics/fun/netbunnies/rabbit-Kylensarah1.jpg
411 0.09%29/Jun/05 23:20/graphics/fun/netbunnies/pitfou-reinhart1.jpg
410 0.02%29/Jun/05 22:00/graphics/fun/netbunnies/haylee-imboden1.jpg
410 0.01%29/Jun/05 22:24/graphics/fun/netbunnies/fidge1.jpg
410 0.02%29/Jun/05 22:29/graphics/fun/netbunnies/bunny10.jpg
410 0.01%29/Jun/05 20:32/graphics/fun/netbunnies/chelsee-gordon1.jpg
410 0.01%29/Jun/05 20:07/graphics/fun/netbunnies/snowflake.jpg
410 0.01%29/Jun/05 22:25/chapters/san-diego/adoption/Adoption_Photos/Cookie_adoption_1_Mar05.jpg
410 0.01%29/Jun/05 22:37/graphics/fun/netbunnies/ralphie-garver1.jpg
410 0.01%29/Jun/05 15:51/graphics/fun/netbunnies/fidge2.jpg
410 0.01%29/Jun/05 21:30/graphics/fun/netbunnies/bagelbun1-attila1.jpg
410 0.02%29/Jun/05 23:53/graphics/fun/netbunnies/boys3-martin1.jpg
410 0.02%29/Jun/05 20:25/graphics/fun/netbunnies/espresso-stuart1.jpg
410 0.01%29/Jun/05 22:37/graphics/fun/netbunnies/busterbabs-schneckloth1.jpg
410 0.01%29/Jun/05 21:09/graphics/fun/netbunnies/bunners-lloyd1.jpg
410 0.02%29/Jun/05 22:34/graphics/fun/netbunnies/lollie-harris1.jpg
409 0.02%29/Jun/05 23:19/graphics/fun/netbunnies/floppy-brandon1.jpg
409 0.01%29/Jun/05 21:38/graphics/fun/netbunnies/cb4-fraleigh1.jpg
409 0.01%29/Jun/05 23:52/graphics/fun/netbunnies/cilantro-linares1.jpg
409 0.02%29/Jun/05 21:57/graphics/fun/netbunnies/bunflowers-flaherty1.jpg
409 0.02%29/Jun/05 23:20/graphics/fun/netbunnies/bella1-beth1.jpg
409 0.01%29/Jun/05 21:41/graphics/fun/netbunnies/betty-Harris1.jpg
409 0.02%29/Jun/05 15:51/graphics/fun/netbunnies/tcereal-lamay1.jpg
409 0.01%29/Jun/05 14:45/graphics/fun/netbunnies/ichy1-spallone1.jpg
409 0.02%29/Jun/05 19:45/graphics/fun/netbunnies/miska-funcic1.jpg
409 0.02%29/Jun/05 23:06/chapters/san-diego/behavior/graphics/chew_toys.JPG
409 0.01%29/Jun/05 21:01/graphics/fun/netbunnies/fruitloop-debbie1.jpg
409 0.02%29/Jun/05 20:01/graphics/fun/netbunnies/tywla-lummels1.jpg
409 0.03%29/Jun/05 22:15/graphics/fun/netbunnies/bunny2-wu1.jpg
409 0.03%29/Jun/05 20:25/graphics/fun/netbunnies/stormy-whelchel1.jpg
409 0.02%29/Jun/05 21:30/graphics/fun/netbunnies/miles-grubin1.jpg
409 0.02%29/Jun/05 23:19/graphics/fun/netbunnies/gangFour-Zdila1.jpg
409 0.01%29/Jun/05 22:01/graphics/fun/netbunnies/ben2-mack1.jpg
409 0.01%29/Jun/05 21:46/graphics/fun/netbunnies/kiwi_sylviaw1.jpg
409 0.01%29/Jun/05 20:28/graphics/fun/netbunnies/kuro2-arai1.jpg
409 0.02%29/Jun/05 20:33/graphics/fun/netbunnies/jaz1-fraleigh1.jpg
409 0.01%29/Jun/05 22:47/graphics/fun/netbunnies/bunbun6-wendy1.jpg
409 29/Jun/05 20:15/graphics/banners/care.gif
409 0.01%30/Jun/05 00:06/graphics/fun/netbunnies/dusty-castro1.jpg
409 0.02%29/Jun/05 21:50/graphics/fun/netbunnies/bunbun-crijo1.jpg
409 0.01%29/Jun/05 22:48/graphics/fun/netbunnies/jess2.jpg
409 29/Jun/05 23:06/chapters/san-diego/behavior/graphics/haytube.JPG
409 0.01%29/Jun/05 21:48/graphics/fun/netbunnies/bunnyday-bastian1.jpg
409 0.01%29/Jun/05 20:03/graphics/fun/netbunnies/hops3-attila1.jpg
408 0.02%29/Jun/05 22:15/graphics/fun/netbunnies/arwen1-pritchard1.jpg
408 0.02%29/Jun/05 21:52/graphics/fun/netbunnies/eric1.jpg
408 0.01%29/Jun/05 22:25/chapters/san-diego/adoption/Adoption_Photos/HA_Alex_Mar05.jpg
408 0.02%29/Jun/05 19:37/graphics/fun/netbunnies/umichum2-lapitan1.jpg
408 0.02%29/Jun/05 23:19/graphics/fun/netbunnies/flopster-francisco1.jpg
408 0.01%29/Jun/05 19:45/graphics/fun/netbunnies/snix-fields1.jpg
408 0.01%29/Jun/05 22:25/chapters/san-diego/adoption/Adoption_Photos/Donnie_Leilani_adoption_3_Mar05.jpg
408 0.02%29/Jun/05 21:19/graphics/fun/netbunnies/bugsi2-greene1.jpg
408 0.02%29/Jun/05 20:26/graphics/fun/netbunnies/werls-arobinson1.jpg
408 0.01%29/Jun/05 20:33/graphics/fun/netbunnies/bunnies1-broley1.jpg
408 0.02%29/Jun/05 19:58/graphics/fun/netbunnies/scampers-fahlman1.jpg
408 0.03%29/Jun/05 21:59/graphics/fun/netbunnies/lopornotbarber.jpg
408 0.01%29/Jun/05 22:01/graphics/fun/netbunnies/george-julie1.jpg
407 0.03%29/Jun/05 21:52/graphics/fun/netbunnies/kids-wittenkeller1.jpg
407 0.01%29/Jun/05 21:30/graphics/fun/netbunnies/julius-hurley1.jpg
407 0.01%29/Jun/05 20:33/graphics/fun/netbunnies/bunny.jpg
407 29/Jun/05 19:30/graphics/books/126X32-b-logo.gif
407 0.01%29/Jun/05 22:13/graphics/fun/netbunnies/dexterothers-santos1.jpg
407 0.02%29/Jun/05 21:52/graphics/fun/netbunnies/wabbit2-luumi1.jpg
407 0.01%29/Jun/05 21:51/graphics/fun/netbunnies/mollie1-galer1.jpg
407 0.01%29/Jun/05 21:40/graphics/fun/netbunnies/molly-caulders1.jpg
407 0.01%29/Jun/05 20:33/graphics/fun/netbunnies/catbunny.jpg
407 0.03%29/Jun/05 20:29/graphics/fun/netbunnies/bunnybonding-Darren1.jpg
407 0.02%29/Jun/05 21:21/graphics/fun/netbunnies/bunny4-lee1.jpg
407 0.01%29/Jun/05 20:32/graphics/fun/netbunnies/bally-dellis1.jpg
407 0.02%29/Jun/05 19:41/graphics/fun/netbunnies/rasberry-perillat1.jpg
407 0.04%29/Jun/05 21:01/graphics/fun/netbunnies/perry-black-baby-box.jpg
407 0.03%29/Jun/05 21:45/graphics/fun/netbunnies/bunny1-blair1.jpg
407 0.01%29/Jun/05 22:25/chapters/san-diego/adoption/Adoption_Photos/Watson_adoption.jpg
407 0.02%29/Jun/05 23:38/graphics/fun/netbunnies/kili-sandkamp1.jpg
407 0.02%29/Jun/05 20:51/graphics/fun/netbunnies/lily1-gobler1.jpg
407 0.02%29/Jun/05 16:29/graphics/fun/netbunnies/cadbury-gilbert1.jpg
407 29/Jun/05 20:47/rabbit-center/retail/bunnyR.gif
407 0.01%29/Jun/05 20:06/graphics/fun/netbunnies/ponpon-herrera1.jpg
407 0.02%29/Jun/05 23:07/chapters/san-diego/behavior/graphics/Choices.JPG
407 0.01%29/Jun/05 21:21/graphics/fun/netbunnies/sophia.jpg
407 0.01%29/Jun/05 21:45/graphics/fun/netbunnies/magee-melesurgo1.jpg
406 0.02%29/Jun/05 19:56/graphics/fun/netbunnies/firstLitter-Stack1.jpg
406 0.03%29/Jun/05 22:38/graphics/fun/netbunnies/robbie1-oneal1.jpg
406 29/Jun/05 21:10/rabbit-center/retail/
406 0.02%29/Jun/05 20:38/graphics/fun/netbunnies/bunnybag3-rott1.jpg
406 0.01%29/Jun/05 19:24/graphics/fun/netbunnies/bubzy-sydney1.jpg
406 0.01%29/Jun/05 23:53/graphics/fun/netbunnies/bunna-jca1.jpg
406 0.03%29/Jun/05 20:08/graphics/fun/netbunnies/petunia-wittenkeller1.jpg
406 0.03%29/Jun/05 21:21/graphics/fun/netbunnies/ninus-andersen1.jpg
406 0.01%29/Jun/05 21:34/graphics/fun/netbunnies/cleanfoot.jpg
406 0.02%29/Jun/05 17:05/graphics/fun/netbunnies/nibbler-jia1.jpg
406 0.01%29/Jun/05 20:59/graphics/fun/netbunnies/buns2-schnellbach1.jpg
406 0.01%29/Jun/05 22:47/graphics/fun/netbunnies/rabbit-rodriguez1.jpg
406 0.01%29/Jun/05 21:17/graphics/fun/netbunnies/snowwhite_kiki_sylviaw1.jpg
406 0.01%29/Jun/05 20:33/graphics/fun/netbunnies/cora-winarchick1.jpg
406 0.01%29/Jun/05 20:33/graphics/fun/netbunnies/mitchcharlie2-thompson1.jpg
406 0.02%29/Jun/05 22:46/graphics/fun/netbunnies/trevor+others-kiviat1.jpg
406 0.01%29/Jun/05 23:20/graphics/fun/netbunnies/nutmeg-Nilgesda1.jpg
406 0.01%29/Jun/05 20:52/graphics/fun/netbunnies/cadbury-mustang1.jpg
406 0.01%29/Jun/05 16:14/graphics/fun/netbunnies/biscus-schtomp-davidson1.jpg
406 0.02%29/Jun/05 21:15/graphics/fun/netbunnies/rabbits-sukiennik1.jpg
406 0.02%29/Jun/05 20:26/graphics/fun/netbunnies/bunbun-auken1.jpg
406 0.01%29/Jun/05 19:43/graphics/fun/netbunnies/bunnies-marroney1.jpg
405 0.01%29/Jun/05 21:09/journal/3-12/graphics/litter-training1.gif
405 0.02%29/Jun/05 20:36/graphics/fun/netbunnies/mister-kaoricat1.jpg
405 0.02%29/Jun/05 21:40/graphics/fun/netbunnies/poppy.jpg
405 0.01%29/Jun/05 20:38/graphics/fun/netbunnies/cassidy.jpg
405 0.01%29/Jun/05 21:52/chapters/san-diego/behavior/litter_train.html
405 0.02%29/Jun/05 21:06/graphics/fun/netbunnies/rabbit4-birgit1.jpg
405 0.01%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Mimi_Jun05.jpg
405 0.01%29/Jun/05 21:30/graphics/fun/netbunnies/sungar-asa1.jpg
405 0.02%29/Jun/05 21:47/graphics/fun/netbunnies/usagi-king1.jpg
405 0.01%30/Jun/05 00:05/graphics/fun/netbunnies/chaos-brammer1.jpg
405 0.01%29/Jun/05 22:45/graphics/fun/netbunnies/betsy2-byrne1.jpg
405 0.01%29/Jun/05 16:14/graphics/fun/netbunnies/fluffy-hosein1.jpg
405 0.03%29/Jun/05 21:26/graphics/fun/netbunnies/magic-sanders1.jpg
405 0.02%29/Jun/05 22:03/graphics/fun/netbunnies/cinnamon-maddyx1.jpg
405 0.01%29/Jun/05 17:52/graphics/fun/netbunnies/fufus23.jpg
405 0.02%29/Jun/05 23:53/graphics/fun/netbunnies/reggie+chloe-odell1.jpg
405 0.02%29/Jun/05 23:19/graphics/fun/netbunnies/picasso2-autumn1.jpg
405 0.04%29/Jun/05 21:16/graphics/fun/netbunnies/bunny-barry1.jpg
405 0.01%29/Jun/05 20:08/graphics/fun/netbunnies/cc30.jpg
405 0.02%29/Jun/05 23:20/graphics/fun/netbunnies/lucky-katievic1.jpg
405 0.02%30/Jun/05 00:05/graphics/fun/netbunnies/jb2-cho1.jpg
405 0.01%29/Jun/05 21:24/graphics/fun/netbunnies/trixie-traylor1.jpg
405 0.02%29/Jun/05 19:32/graphics/fun/netbunnies/munches-gilreath1.jpg
405 29/Jun/05 19:29/graphics/books/go-button.gif
404 0.01%29/Jun/05 23:21/graphics/fun/netbunnies/hsbox-thomas1.jpg
404 0.03%29/Jun/05 21:22/graphics/fun/netbunnies/nero-daker1.jpg
404 0.01%29/Jun/05 21:19/graphics/fun/netbunnies/dottie-tao1.jpg
404 0.01%29/Jun/05 21:31/graphics/fun/netbunnies/sassy-william1.jpg
404 0.02%29/Jun/05 19:35/graphics/fun/netbunnies/scotty-kuryuzawa1.jpg
404 0.01%29/Jun/05 21:20/graphics/fun/netbunnies/destino4-shullaw1.jpg
404 0.01%29/Jun/05 21:19/graphics/fun/netbunnies/pooper1-chakraverty1.jpg
404 0.01%29/Jun/05 21:44/graphics/fun/netbunnies/rabbit1-johnson1.jpg
404 0.02%29/Jun/05 23:07/chapters/san-diego/behavior/graphics/mischief.jpg
404 29/Jun/05 20:47/rabbit-center/retail/bunnyL.gif
404 0.02%29/Jun/05 21:23/graphics/fun/netbunnies/benny-applin1.jpg
404 0.01%29/Jun/05 16:33/graphics/fun/netbunnies/littlebunbook.jpg
404 0.02%29/Jun/05 19:21/graphics/fun/netbunnies/poppy-howard1.jpg
404 0.02%29/Jun/05 21:54/graphics/fun/netbunnies/fancy1-fraleigh1.jpg
404 0.01%29/Jun/05 20:28/graphics/fun/netbunnies/bunny4-heinsma1.jpg
404 0.03%29/Jun/05 22:46/graphics/fun/netbunnies/ruby2-strope1.jpg
404 0.01%29/Jun/05 20:07/graphics/fun/netbunnies/dixie-ryder1.jpg
404 0.01%29/Jun/05 22:38/graphics/fun/netbunnies/cuddles1-porter1.jpg
404 0.01%29/Jun/05 22:39/graphics/fun/netbunnies/soleil-racicot1.jpg
404 0.02%29/Jun/05 23:20/graphics/fun/netbunnies/luna-lynne1.jpg
403 0.02%29/Jun/05 17:09/graphics/fun/netbunnies/dulcy-storms1.jpg
403 0.01%29/Jun/05 14:45/graphics/fun/netbunnies/bunduck1-davison1.jpg
403 0.01%29/Jun/05 22:02/graphics/fun/netbunnies/oscar-sigler1 .jpg
403 0.02%29/Jun/05 13:53/graphics/fun/netbunnies/earth2-toong1.jpg
403 0.02%29/Jun/05 16:24/graphics/fun/netbunnies/bunny1-Zisser1.jpg
403 0.02%29/Jun/05 20:04/graphics/fun/netbunnies/rabbit1-ergun1.jpg
403 0.02%29/Jun/05 21:18/graphics/fun/netbunnies/moon5-dana1.jpg
403 0.03%29/Jun/05 20:03/graphics/fun/netbunnies/nimbus-kmk1.jpg
403 0.01%29/Jun/05 21:09/journal/3-12/graphics/litter-training2.gif
403 0.01%29/Jun/05 13:53/graphics/fun/netbunnies/fripouille-having-a-nap.jpg
403 0.02%29/Jun/05 22:37/graphics/fun/netbunnies/jasper-cartwright1.jpg
403 0.02%29/Jun/05 22:35/graphics/fun/netbunnies/raisins-clarke1.jpg
403 0.01%29/Jun/05 21:22/graphics/fun/netbunnies/phoebe-gumpel1.jpg
403 0.02%29/Jun/05 20:36/graphics/fun/netbunnies/thumperandpaul-Mason1.jpg
403 0.03%29/Jun/05 19:45/graphics/fun/netbunnies/cinderella-spotty1.jpg
403 0.01%29/Jun/05 21:48/graphics/fun/netbunnies/peetie1-chaney1.jpg
403 0.01%29/Jun/05 19:38/graphics/fun/netbunnies/blaze2-heldt1.jpg
403 0.01%29/Jun/05 20:58/graphics/fun/netbunnies/kissmeliss-ndren1.jpg
403 0.01%29/Jun/05 22:28/graphics/fun/netbunnies/poppy8-marcia1.jpg
403 0.02%29/Jun/05 21:41/graphics/fun/netbunnies/pebbles8-cliff1.jpg
403 0.02%29/Jun/05 20:38/graphics/fun/netbunnies/brulee+hudson-beeline1.jpg
403 0.01%29/Jun/05 19:46/graphics/fun/netbunnies/bunny1-oneill1.jpg
402 0.01%29/Jun/05 21:17/graphics/fun/netbunnies/wally-relaxing.jpg
402 0.01%29/Jun/05 22:46/graphics/fun/netbunnies/scooter-edelmuller1.jpg
402 0.02%29/Jun/05 14:05/graphics/fun/netbunnies/oreo-hunnie1.jpg
402 0.02%29/Jun/05 23:19/graphics/fun/netbunnies/dave-hamilton1.jpg
402 0.01%29/Jun/05 21:23/graphics/fun/netbunnies/rabbit-Timcoe1.jpg
402 0.01%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/Marjorie4.jpg
402 0.01%30/Jun/05 00:05/graphics/fun/netbunnies/bunny22.jpg
402 0.01%29/Jun/05 18:07/graphics/fun/netbunnies/lucky-woofenden1.jpg
402 0.02%29/Jun/05 20:30/graphics/fun/netbunnies/buns1-oberley1.jpg
402 0.01%29/Jun/05 21:18/graphics/fun/netbunnies/benny-scollo1.jpg
402 0.02%29/Jun/05 23:36/graphics/fun/netbunnies/emma-manning1.jpg
402 0.02%29/Jun/05 23:52/graphics/fun/netbunnies/sophie1-noakes1.jpg
402 0.03%29/Jun/05 17:47/graphics/fun/netbunnies/molson-martin1.jpg
402 0.01%29/Jun/05 20:55/graphics/fun/netbunnies/cookie-smt1.jpg
402 0.01%29/Jun/05 23:06/chapters/san-diego/behavior/graphics/Basket_toys.JPG
401 0.01%29/Jun/05 22:35/graphics/fun/netbunnies/fosterbun-cvetan1.jpg
401 0.01%29/Jun/05 21:22/graphics/fun/netbunnies/ginger-george1.jpg
401 0.02%29/Jun/05 23:19/graphics/fun/netbunnies/thumper1-gitter1.jpg
401 0.01%29/Jun/05 16:44/graphics/fun/netbunnies/dusty-venlou1.jpg
401 0.02%29/Jun/05 20:56/graphics/fun/netbunnies/chubbs-daisy3-esquivel1.jpg
401 0.01%29/Jun/05 16:30/graphics/fun/netbunnies/farmer-canade1.jpg
401 0.01%29/Jun/05 22:29/graphics/fun/netbunnies/wilshire-bugsi-dslextreme1.jpg
401 29/Jun/05 22:46/graphics/fun/netbunnies/r957cadbury50tiny.jpg
401 0.02%29/Jun/05 21:57/graphics/fun/netbunnies/henry1-may1.jpg
401 0.02%29/Jun/05 21:02/graphics/fun/netbunnies/happyfeet-Daniels1.jpg
401 0.02%29/Jun/05 19:43/rabbit-center/hayward_rescue/hayward_graphics/syphilis_nose.jpg
401 0.02%29/Jun/05 20:33/graphics/fun/netbunnies/kits-rowan1.jpg
401 0.01%29/Jun/05 20:31/graphics/fun/netbunnies/rags-standen1.jpg
401 0.01%29/Jun/05 23:53/graphics/fun/netbunnies/flopser1-andiko1.jpg
400 0.02%29/Jun/05 23:36/graphics/fun/netbunnies/cinnabun-haviva1.jpg
400 0.01%29/Jun/05 21:46/graphics/fun/netbunnies/harry3-mayers1.jpg
400 0.01%29/Jun/05 21:59/graphics/fun/netbunnies/foofoo-mattos1.jpg
400 0.02%30/Jun/05 00:06/graphics/fun/netbunnies/rabbits1-deb1.jpg
400 0.02%29/Jun/05 20:31/graphics/fun/netbunnies/padittle_prisbrey1.jpg
400 0.02%29/Jun/05 21:27/graphics/fun/netbunnies/sweetie2-toillon1.jpg
400 0.01%29/Jun/05 16:54/graphics/fun/netbunnies/pearl-espinosa1.jpg
400 0.01%29/Jun/05 21:19/graphics/fun/netbunnies/flopsys-harem.jpg
400 0.02%29/Jun/05 20:36/graphics/fun/netbunnies/bunnies2-Linares1.jpg
400 0.01%29/Jun/05 19:41/graphics/fun/netbunnies/peanut-montgomery1.jpg
400 0.02%29/Jun/05 20:04/graphics/fun/netbunnies/bunny-morton1.jpg
400 0.01%29/Jun/05 19:33/graphics/fun/netbunnies/guy1-bokhart1.jpg
400 0.01%29/Jun/05 22:03/graphics/fun/netbunnies/rab7-overett1.jpg
400 0.01%29/Jun/05 20:37/graphics/fun/netbunnies/bunkie-needler1.jpg
400 0.01%29/Jun/05 21:15/graphics/fun/netbunnies/smokey3h.jpg
400 0.02%29/Jun/05 21:47/graphics/fun/netbunnies/lily-noir1.jpg
400 0.01%29/Jun/05 20:37/graphics/fun/netbunnies/bunbun-whoknows1.jpg
400 0.02%29/Jun/05 14:52/graphics/fun/netbunnies/marley-phelan1.jpg
400 0.02%29/Jun/05 19:56/graphics/fun/netbunnies/stew-morgans1.jpg
400 0.01%29/Jun/05 22:05/graphics/fun/netbunnies/sable2.jpg
399 0.02%29/Jun/05 23:18/graphics/fun/netbunnies/radarears-walker1.jpg
399 0.03%29/Jun/05 21:30/graphics/fun/netbunnies/kiwi1-kaczmarski1.jpg
399 0.01%29/Jun/05 16:18/graphics/fun/netbunnies/trio-nye1.jpg
399 0.01%29/Jun/05 21:49/graphics/fun/netbunnies/freckles-Cathy1.jpg
399 0.01%29/Jun/05 21:31/graphics/fun/netbunnies/pyawns.jpg
399 0.02%29/Jun/05 20:29/graphics/fun/netbunnies/ruby-renee1.jpg
399 0.01%29/Jun/05 22:14/graphics/fun/netbunnies/bunny-anderson1.jpg
399 0.01%29/Jun/05 21:15/graphics/fun/netbunnies/bigwig2.jpg
399 0.01%29/Jun/05 21:25/graphics/fun/netbunnies/skywalker-wachowiak1.jpg
399 0.01%29/Jun/05 22:47/graphics/fun/netbunnies/ginger3-herrington1.jpg
399 0.02%29/Jun/05 23:53/graphics/fun/netbunnies/deckland-steven1.jpg
399 0.02%29/Jun/05 21:19/graphics/fun/netbunnies/sumi-lynne1.jpg
399 0.01%29/Jun/05 23:53/graphics/fun/netbunnies/javajoe-forsythe1.jpg
399 0.01%29/Jun/05 21:47/graphics/fun/netbunnies/beastd-Hawkins1.jpg
399 0.01%29/Jun/05 20:03/graphics/fun/netbunnies/bbyjack.jpg
399 0.02%29/Jun/05 18:07/graphics/fun/netbunnies/owen3-victoria1.jpg
399 0.02%29/Jun/05 21:39/graphics/fun/netbunnies/chocolate-ko1.jpg
399 0.03%29/Jun/05 22:13/graphics/fun/netbunnies/ike-jpward1.jpg
399 0.01%29/Jun/05 20:52/graphics/fun/netbunnies/lolococo-dy1.jpg
399 0.01%29/Jun/05 21:48/graphics/fun/netbunnies/pepper1-stalker1.jpg
399 0.03%29/Jun/05 19:59/graphics/fun/netbunnies/rabbitssnow-Gerritsen1.jpg
398 0.03%29/Jun/05 20:28/graphics/fun/netbunnies/bunny07-Kaldal1.jpg
398 0.01%29/Jun/05 20:59/graphics/fun/netbunnies/buns3-schnellbach1.jpg
398 0.01%29/Jun/05 19:47/graphics/fun/netbunnies/dixon-davis1.jpg
398 0.01%29/Jun/05 22:14/graphics/fun/netbunnies/ek-ashwroth1.jpg
398 0.01%29/Jun/05 22:09/graphics/fun/netbunnies/bugzie3-ashby1.jpg
398 0.02%29/Jun/05 21:15/graphics/fun/netbunnies/maplecocoa-cook1.jpg
398 0.02%29/Jun/05 22:02/graphics/fun/netbunnies/bunny1-braun1.jpg
398 0.01%29/Jun/05 20:31/graphics/fun/netbunnies/dotdot_van1.jpg
398 0.02%29/Jun/05 21:23/graphics/fun/netbunnies/fuzzy2-ko1.jpg
398 0.02%29/Jun/05 17:42/graphics/fun/netbunnies/fufu2-crownover1.jpg
398 0.01%29/Jun/05 22:10/graphics/fun/netbunnies/hoppy-wood1.jpg
398 29/Jun/05 22:34/chapters/socal/vets.html
398 0.02%29/Jun/05 21:18/graphics/fun/netbunnies/blade-Ian1.jpg
398 0.04%29/Jun/05 20:59/graphics/fun/netbunnies/sylvia-spade-easter-basket.jpg
398 0.01%29/Jun/05 16:14/graphics/fun/netbunnies/caramel-flannery1.jpg
398 0.02%29/Jun/05 23:01/graphics/fun/netbunnies/sammy-richard1.jpg
398 0.02%29/Jun/05 20:30/graphics/fun/netbunnies/cashew-qtip-ona1.jpg
398 0.01%29/Jun/05 22:00/graphics/fun/netbunnies/layla-tori-oster1.jpg
398 0.02%29/Jun/05 21:17/graphics/fun/netbunnies/maggie-underwood1.jpg
398 0.02%29/Jun/05 22:46/graphics/fun/netbunnies/little bob-odell1.jpg
398 0.02%29/Jun/05 22:46/graphics/fun/netbunnies/peanut-poole1.jpg
398 0.01%29/Jun/05 21:47/graphics/fun/netbunnies/trudyposa-pierguiseppe1.jpg
398 0.01%29/Jun/05 21:27/graphics/fun/netbunnies/bunnybutts2-spence1.jpg
398 0.01%29/Jun/05 20:37/graphics/fun/netbunnies/merlin+panda2-holly1.jpg
397 0.01%29/Jun/05 22:24/graphics/fun/netbunnies/cotton-renee1.jpg
397 0.01%30/Jun/05 00:05/graphics/fun/netbunnies/chloe2-cote1.jpg
397 0.01%29/Jun/05 22:01/graphics/fun/netbunnies/bunny1-potts1.jpg
397 0.01%29/Jun/05 21:48/graphics/fun/netbunnies/jo-m.jpg
397 0.03%29/Jun/05 21:45/graphics/fun/netbunnies/bunjie-Obsenica1.jpg
397 0.01%29/Jun/05 21:51/graphics/fun/netbunnies/franklin1-harris1.jpg
397 0.02%29/Jun/05 19:47/graphics/fun/netbunnies/nelly2-salter1.jpg
397 0.02%29/Jun/05 22:37/graphics/fun/netbunnies/nelly3-salter1.jpg
397 0.01%29/Jun/05 22:38/graphics/fun/netbunnies/mel1-shay1.jpg
397 0.02%29/Jun/05 23:18/graphics/fun/netbunnies/riley1-charisemaria1.jpg
397 0.02%29/Jun/05 23:19/graphics/fun/netbunnies/nibbles-parrington1.jpg
397 0.02%29/Jun/05 21:23/graphics/fun/netbunnies/pasha-story1.jpg
397 0.03%29/Jun/05 18:09/graphics/fun/netbunnies/rabbit-b-spence1.jpg
397 0.03%29/Jun/05 21:21/graphics/fun/netbunnies/noble-schaaf1.jpg
397 0.02%29/Jun/05 22:48/graphics/fun/netbunnies/unshin2-nilgesl1.jpg
397 0.02%29/Jun/05 19:46/graphics/fun/netbunnies/sophie-noakes1.jpg
397 0.01%29/Jun/05 22:39/graphics/fun/netbunnies/dillon-fairhurst1.jpg
397 0.01%29/Jun/05 21:21/graphics/fun/netbunnies/murphy-intelligoth1.jpg
397 0.01%29/Jun/05 21:48/graphics/fun/netbunnies/shgizzo-massimo1.jpg
397 0.01%29/Jun/05 22:13/graphics/fun/netbunnies/im-not-ready.jpg
397 0.02%29/Jun/05 20:54/graphics/fun/netbunnies/crystal2-haske1.jpg
396 0.02%29/Jun/05 15:55/graphics/fun/netbunnies/websterlopwabbit.jpg
396 0.01%29/Jun/05 21:47/graphics/fun/netbunnies/hare-harebrain1.jpg
396 0.01%29/Jun/05 20:54/graphics/fun/netbunnies/hoppy-chetnik1.jpg
396 0.02%29/Jun/05 22:45/graphics/fun/netbunnies/benny-vanauken1.jpg
396 0.01%29/Jun/05 16:25/graphics/fun/netbunnies/basket-linares1.jpg
396 0.02%29/Jun/05 20:35/graphics/fun/netbunnies/lulu+inez-moore1.jpg
396 0.01%29/Jun/05 21:49/graphics/fun/netbunnies/duke1-hop1.jpg
396 0.01%29/Jun/05 20:35/graphics/fun/netbunnies/thumper-roxy2-bailey1.jpg
396 0.01%29/Jun/05 21:50/graphics/fun/netbunnies/oatmeal-heather1.jpg
396 29/Jun/05 22:04/graphics/fun/netbunnies/beauty2.jpg
396 0.01%29/Jun/05 20:33/graphics/fun/netbunnies/chashuroar-tani1.jpg
395 0.01%29/Jun/05 23:18/graphics/fun/netbunnies/lucy+stinky-wangchuk1.jpg
395 0.03%29/Jun/05 20:08/graphics/fun/netbunnies/foosasha-Miller1.jpg
395 0.01%29/Jun/05 23:19/graphics/fun/netbunnies/four-Zdila1.jpg
395 0.01%29/Jun/05 22:00/graphics/fun/netbunnies/m2.jpg
395 0.01%29/Jun/05 23:53/graphics/fun/netbunnies/nona-barrett1.jpg
395 0.01%29/Jun/05 20:38/graphics/fun/netbunnies/meme-Bridenbaugh1.jpg
395 0.02%29/Jun/05 21:56/graphics/fun/netbunnies/vlekkie-rose1.jpg
395 0.02%29/Jun/05 21:20/graphics/fun/netbunnies/buster-saikaley1.jpg
395 0.01%29/Jun/05 20:33/graphics/fun/netbunnies/patch-gillespie1.jpg
395 0.02%29/Jun/05 20:59/graphics/fun/netbunnies/pic00018.jpg
395 0.01%29/Jun/05 20:50/graphics/fun/netbunnies/muffin-miller1.jpg
395 0.01%29/Jun/05 22:29/graphics/fun/netbunnies/marshmellow1-corbelli1.jpg
395 0.02%29/Jun/05 21:46/graphics/fun/netbunnies/sully-paige1.jpg
395 0.02%29/Jun/05 13:34/graphics/fun/netbunnies/coolrabbit.jpg
395 0.02%29/Jun/05 19:47/graphics/fun/netbunnies/binky-macgregor1.jpg
395 0.01%29/Jun/05 21:17/graphics/fun/netbunnies/smokey4-morris1.jpg
395 0.01%29/Jun/05 21:28/graphics/fun/netbunnies/rabbit-kogan1.jpg
394 0.01%29/Jun/05 22:03/graphics/fun/netbunnies/bungalo-salisbury1.jpg
394 0.01%29/Jun/05 18:46/graphics/fun/netbunnies/timmy5-robinson1.jpg
394 0.01%29/Jun/05 23:53/graphics/fun/netbunnies/matty+regina-freidel1.jpg
394 0.01%29/Jun/05 21:05/graphics/fun/netbunnies/roger-harris1.jpg
394 0.01%29/Jun/05 21:18/chapters/san-diego/adoption/indoors.html
394 0.02%29/Jun/05 21:48/graphics/fun/netbunnies/rabbit2-johnson1.jpg
394 0.02%29/Jun/05 21:55/graphics/fun/netbunnies/furball3-lim1.jpg
394 0.02%29/Jun/05 20:41/graphics/fun/netbunnies/jed6-forrai1.jpg
394 0.02%29/Jun/05 21:39/graphics/fun/netbunnies/rabbits-tonge1.jpg
394 0.02%29/Jun/05 21:45/graphics/fun/netbunnies/rabbit-christenson1.jpg
394 0.02%29/Jun/05 19:46/graphics/fun/netbunnies/thumper1-knorr1.jpg
394 0.02%29/Jun/05 21:53/graphics/fun/netbunnies/rabbit1-lau1.jpg
394 0.01%29/Jun/05 19:37/graphics/fun/netbunnies/melbacheckers-tolle1.jpg
394 0.01%29/Jun/05 19:59/graphics/fun/netbunnies/jewel-pratt1.jpg
394 29/Jun/05 20:03/graphics/fun/netbunnies/scooter-hawthorne1.jpg
393 0.03%29/Jun/05 21:30/graphics/fun/netbunnies/bunnies2-grimes1.jpg
393 0.01%29/Jun/05 23:18/graphics/fun/netbunnies/flurrymax-french1.jpg
393 0.02%29/Jun/05 21:16/graphics/fun/netbunnies/kassidy-rich1.jpg
393 0.02%29/Jun/05 20:27/graphics/fun/netbunnies/trin-fischer1.jpg
393 0.04%29/Jun/05 21:31/graphics/fun/netbunnies/eliott-9mon-hopp-bag.jpg
393 29/Jun/05 21:33/journal/2-5/enteritis.html
393 0.01%29/Jun/05 13:25/graphics/fun/netbunnies/simone3.jpg
393 0.03%29/Jun/05 22:13/graphics/fun/netbunnies/bunnies3-schroeder1.jpg
393 0.02%29/Jun/05 15:20/graphics/fun/netbunnies/whospilled-copple1.jpg
393 0.01%29/Jun/05 21:23/graphics/fun/netbunnies/olycloseup-melin1.jpg
393 0.01%29/Jun/05 21:09/graphics/fun/netbunnies/jonathan-meimei1.jpg
393 0.01%29/Jun/05 22:45/graphics/fun/netbunnies/dusty-sitsiuq1.jpg
393 0.01%29/Jun/05 21:22/graphics/fun/netbunnies/missbuffy-showalter1.jpg
393 0.01%29/Jun/05 22:38/graphics/fun/netbunnies/bunny4-spence1.jpg
393 0.02%29/Jun/05 22:28/graphics/fun/netbunnies/george-wesirucj1.jpg
393 0.02%29/Jun/05 19:36/graphics/fun/netbunnies/closecompanionsthumpersara.jpg
392 0.01%29/Jun/05 21:30/graphics/fun/netbunnies/ginger1-leen1.jpg
392 0.03%29/Jun/05 21:30/graphics/fun/netbunnies/buns1-schnellbach1.jpg
392 0.02%29/Jun/05 22:14/graphics/fun/netbunnies/brownie2.jpg
392 0.01%29/Jun/05 20:31/graphics/fun/netbunnies/harvey-zorro1.jpg
392 0.02%29/Jun/05 20:32/graphics/fun/netbunnies/kralina-springerova1.jpg
392 0.01%29/Jun/05 21:47/graphics/fun/netbunnies/sylvie4-robinson1.jpg
392 0.01%29/Jun/05 21:20/graphics/fun/netbunnies/dusty.jpg
392 0.01%30/Jun/05 00:05/graphics/fun/netbunnies/pete-sexton1.jpg
392 0.03%29/Jun/05 22:34/graphics/fun/netbunnies/patch-gallandrian1.jpg
392 0.01%29/Jun/05 21:29/graphics/fun/netbunnies/bunny-gonzalez1.jpg
392 0.01%29/Jun/05 21:19/graphics/fun/netbunnies/thunder2-jacqueline1.jpg
392 0.01%29/Jun/05 22:02/graphics/fun/netbunnies/dandylion1-jessica1.jpg
392 0.01%29/Jun/05 21:59/graphics/fun/netbunnies/bunboy-smith1.jpg
392 0.01%29/Jun/05 19:37/graphics/fun/netbunnies/mvc.jpg
392 0.02%29/Jun/05 15:46/graphics/fun/netbunnies/jackieabigail-johnsen1.jpg
392 0.01%29/Jun/05 21:23/graphics/fun/netbunnies/charlie2-louise1.jpg
392 0.01%29/Jun/05 22:28/graphics/fun/netbunnies/hailey-politzer1.jpg
392 0.02%29/Jun/05 20:02/graphics/fun/netbunnies/dexter-correa1.jpg
392 0.02%29/Jun/05 23:19/graphics/fun/netbunnies/maybe-kat1.jpg
391 0.02%29/Jun/05 19:43/rabbit-center/hayward_rescue/hayward_graphics/abscess_exam.jpg
391 0.02%29/Jun/05 21:23/graphics/fun/netbunnies/mushielopincorner.jpg
391 0.02%29/Jun/05 20:07/graphics/fun/netbunnies/rabbit-chercat1.jpg
391 0.01%29/Jun/05 20:34/graphics/fun/netbunnies/oatmeal3-heather1.jpg
391 0.02%29/Jun/05 22:13/graphics/fun/netbunnies/bunny4-ButlerClarke1.jpg
391 0.02%29/Jun/05 19:33/graphics/fun/netbunnies/isidore-wright1.jpg
391 0.02%29/Jun/05 21:03/graphics/fun/netbunnies/snuggles-stacy1.jpg
391 0.01%29/Jun/05 23:19/graphics/fun/netbunnies/rabbit2-young1.jpg
391 0.01%29/Jun/05 20:03/graphics/fun/netbunnies/baxtersmall2.jpg
391 0.01%29/Jun/05 21:51/graphics/fun/netbunnies/rabbits-chang1.jpg
391 0.01%29/Jun/05 21:27/graphics/fun/netbunnies/custard-connor1.jpg
391 0.01%29/Jun/05 19:29/graphics/books/soup.gif
391 0.01%29/Jun/05 22:14/graphics/fun/netbunnies/missamila-herrington1.jpg
391 0.02%29/Jun/05 20:36/graphics/fun/netbunnies/midnight1-mue1.jpg
391 0.02%29/Jun/05 21:50/graphics/fun/netbunnies/billy2-sharwell1.jpg
391 0.02%29/Jun/05 20:25/graphics/fun/netbunnies/bunnibun-jones1.jpg
391 0.01%29/Jun/05 12:35/graphics/fun/netbunnies/powder-Daniels1.jpg
390 0.02%29/Jun/05 21:24/graphics/fun/netbunnies/cuddles+lillian-porter1.jpg
390 0.02%29/Jun/05 22:47/graphics/fun/netbunnies/edith-Jurasinski1.jpg
390 0.01%29/Jun/05 17:09/graphics/fun/netbunnies/bunky2-needler1.jpg
390 0.02%29/Jun/05 21:13/chapters/san-diego/behavior/travel.html
390 0.01%29/Jun/05 21:21/graphics/fun/netbunnies/bunny1-Baker1.jpg
390 0.01%29/Jun/05 13:38/graphics/fun/netbunnies/wiener1-sposato1.jpg
390 0.01%29/Jun/05 13:37/graphics/fun/netbunnies/willow-in-pool.jpg
390 0.01%30/Jun/05 00:06/graphics/fun/netbunnies/sammy-lea1.jpg
390 0.01%29/Jun/05 20:59/graphics/fun/netbunnies/snoop-robson1.jpg
390 0.01%29/Jun/05 20:06/graphics/fun/netbunnies/mopsey-feely1.jpg
390 0.01%29/Jun/05 21:37/graphics/fun/netbunnies/minirex-lane1.jpg
390 0.02%29/Jun/05 21:20/graphics/fun/netbunnies/garry1-castaneda1.jpg
390 0.02%29/Jun/05 22:46/graphics/fun/netbunnies/marjoram1-ginger1.jpg
390 0.02%29/Jun/05 21:38/graphics/fun/netbunnies/bungee-maclellan1.jpg
390 0.02%29/Jun/05 22:13/graphics/fun/netbunnies/copper-rsaqglong1.jpg
390 0.01%29/Jun/05 20:28/graphics/fun/netbunnies/vitblaogd-asa1.jpg
390 0.01%29/Jun/05 21:45/graphics/fun/netbunnies/peetie-chaney1.jpg
390 0.02%29/Jun/05 21:20/graphics/fun/netbunnies/jb+ollie3-ozab1.jpg
390 0.01%29/Jun/05 21:51/graphics/fun/netbunnies/conejo3-Collado1.jpg
390 0.01%29/Jun/05 12:21/graphics/fun/netbunnies/ivy1-scarfone1.jpg
390 0.01%29/Jun/05 21:46/graphics/fun/netbunnies/threebunny-winarchick1.jpg
390 0.01%29/Jun/05 21:25/graphics/fun/netbunnies/wonton2-nadeau1.jpg
390 0.01%29/Jun/05 23:20/graphics/fun/netbunnies/rura1-Anna1.jpg
390 0.01%29/Jun/05 22:37/graphics/fun/netbunnies/georgia-janes1.jpg
390 0.02%29/Jun/05 23:19/graphics/fun/netbunnies/jazzie-fraleigh1.jpg
390 0.02%29/Jun/05 20:54/graphics/fun/netbunnies/slopers-mcconville1.jpg
389 0.01%29/Jun/05 22:38/graphics/fun/netbunnies/hayeaters4-rainey1.jpg
389 0.02%29/Jun/05 20:29/graphics/fun/netbunnies/penelope1-longacre1.jpg
389 0.01%30/Jun/05 00:05/graphics/fun/netbunnies/sophie-marroney1.jpg
389 0.02%29/Jun/05 21:04/graphics/fun/netbunnies/monica2-feldman1.jpg
389 0.01%29/Jun/05 21:31/graphics/fun/netbunnies/fripouille-eating-sandals.jpg
389 0.01%29/Jun/05 22:14/graphics/fun/netbunnies/bunniesgroup-darcey1.jpg
389 0.01%29/Jun/05 21:24/graphics/fun/netbunnies/thumber-corkery1.jpg
389 0.01%29/Jun/05 22:02/chapters/san-diego/behavior/rabbit_digs.html
389 0.01%29/Jun/05 21:22/graphics/fun/netbunnies/mrogantaylor-winarchick1.jpg
389 0.02%30/Jun/05 00:05/graphics/fun/netbunnies/cooper-bailor1.jpg
389 0.02%29/Jun/05 22:00/graphics/fun/netbunnies/josey-kwmsp1.jpg
389 0.01%29/Jun/05 23:20/graphics/fun/netbunnies/rabbits2-yu1.jpg
389 0.01%29/Jun/05 16:19/graphics/fun/netbunnies/ebonyandrosita.jpg
389 0.01%29/Jun/05 21:02/graphics/fun/netbunnies/gimmel1-feitelberg1.jpg
389 0.02%29/Jun/05 13:45/graphics/fun/netbunnies/christmaskids-sandy1.jpg
389 0.02%29/Jun/05 20:26/graphics/fun/netbunnies/daisy5-schnellbach1.jpg
389 0.01%29/Jun/05 17:45/graphics/fun/netbunnies/mojo-Georgiev1.jpg
388 0.03%29/Jun/05 21:19/graphics/fun/netbunnies/rishchris-Hunt1.jpg
388 0.01%29/Jun/05 21:49/graphics/fun/netbunnies/kaysi-fairhurst1.jpg
388 0.03%29/Jun/05 21:19/graphics/fun/netbunnies/harold-drake1.jpg
388 0.02%29/Jun/05 20:33/graphics/fun/netbunnies/chercat-camelot1.jpg
388 0.01%29/Jun/05 22:09/graphics/fun/netbunnies/sleepingbabies-napieralski1.jpg
388 29/Jun/05 19:45/hrs-info/background.html
388 0.02%29/Jun/05 23:53/graphics/fun/netbunnies/mokie1-lin1.jpg
388 0.04%29/Jun/05 20:08/graphics/fun/netbunnies/crystal-11mon-palmier.jpg
388 0.01%30/Jun/05 00:05/graphics/fun/netbunnies/rabbit-elamk1.jpg
388 0.02%29/Jun/05 20:32/graphics/fun/netbunnies/isaac-barbara1.jpg
388 0.01%29/Jun/05 22:23/chapters/san-diego/aboutus/feedback.html
388 0.01%29/Jun/05 16:51/graphics/fun/netbunnies/carolron-balch1.jpg
388 0.02%29/Jun/05 21:39/graphics/fun/netbunnies/benbun-sadoway1.jpg
388 0.01%29/Jun/05 21:52/graphics/fun/netbunnies/elwood4-cook1.jpg
388 0.02%29/Jun/05 22:47/graphics/fun/netbunnies/simmie1-ang1.jpg
388 0.03%29/Jun/05 21:30/graphics/fun/netbunnies/lily1-rice1.jpg
388 0.01%29/Jun/05 21:56/graphics/fun/netbunnies/bunny2-osborne1.jpg
388 0.01%29/Jun/05 21:22/graphics/fun/netbunnies/dixon-ho1.jpg
387 0.01%29/Jun/05 18:37/graphics/fun/netbunnies/job1-saar1.jpg
387 0.01%29/Jun/05 21:18/graphics/fun/netbunnies/dopey_daphne-chen1.jpg
387 0.02%29/Jun/05 22:24/graphics/fun/netbunnies/musashi-king1.jpg
387 0.01%29/Jun/05 22:19/chapters/san-diego/adoption/beforeadopt.html
387 0.02%29/Jun/05 21:47/graphics/fun/netbunnies/oreo-corbelli1.jpg
387 0.01%29/Jun/05 22:36/graphics/fun/netbunnies/penelope-Plourde1.jpg
387 0.01%29/Jun/05 20:32/graphics/fun/netbunnies/george-Ivy1.jpg
387 0.05%29/Jun/05 19:43/rabbit-center/hayward_rescue/hayward_graphics/corpse2.jpg
387 0.01%29/Jun/05 22:13/graphics/fun/netbunnies/emma1-robinson1.jpg
387 0.02%29/Jun/05 21:33/graphics/fun/netbunnies/pepperout2-beautylies1.jpg
387 0.01%29/Jun/05 15:49/graphics/fun/netbunnies/aspen+pandora3-millikin1.jpg
387 0.01%29/Jun/05 21:40/graphics/fun/netbunnies/hops2-attila1.jpg
387 0.03%29/Jun/05 21:23/graphics/fun/netbunnies/roy1-bunnylvr1.jpg
386 0.01%29/Jun/05 21:21/graphics/fun/netbunnies/ruby1-vogel1.jpg
386 0.02%29/Jun/05 21:59/graphics/fun/netbunnies/poppy1-hawes1.jpg
386 0.02%29/Jun/05 22:37/graphics/fun/netbunnies/bunnies4-broley1.jpg
386 0.02%29/Jun/05 21:45/graphics/fun/netbunnies/floppy-lim1.jpg
386 0.01%29/Jun/05 20:39/graphics/fun/netbunnies/rabbit1-sheetz1.jpg
386 0.01%29/Jun/05 16:52/graphics/fun/netbunnies/rex-joe1.jpg
386 0.02%29/Jun/05 20:34/graphics/fun/netbunnies/magic-christina1.jpg
386 0.01%29/Jun/05 21:20/graphics/fun/netbunnies/rab4-vinkaz1.jpg
386 0.01%29/Jun/05 21:18/graphics/fun/netbunnies/muggs-casey1.jpg
386 0.02%29/Jun/05 21:00/graphics/fun/netbunnies/kate-haviva1.jpg
386 0.02%29/Jun/05 21:20/graphics/fun/netbunnies/oreo-donovan1.jpg
386 0.02%29/Jun/05 16:25/graphics/fun/netbunnies/niblet-muto1.jpg
386 0.02%29/Jun/05 21:45/graphics/fun/netbunnies/frog-mypetsrule1.jpg
386 0.01%29/Jun/05 22:29/graphics/fun/netbunnies/r955ashley38tiny.jpg
386 0.03%29/Jun/05 19:34/graphics/fun/netbunnies/nigel-hickman1.jpg
386 0.01%29/Jun/05 20:38/graphics/fun/netbunnies/fred-bubble1.jpg
385 0.01%29/Jun/05 22:37/graphics/fun/netbunnies/thumper-roxy4-bailey1.jpg
385 0.01%29/Jun/05 21:24/graphics/fun/netbunnies/bunbun1-chelsey1.jpg
385 0.02%29/Jun/05 21:46/graphics/fun/netbunnies/chloe-priscilla1.jpg
385 0.02%29/Jun/05 21:28/graphics/fun/netbunnies/haemish-erin1.jpg
385 0.01%29/Jun/05 20:03/graphics/fun/netbunnies/cocobunny1-goodman1.jpg
385 0.01%29/Jun/05 23:52/graphics/fun/netbunnies/f1.jpg
385 0.01%29/Jun/05 21:15/graphics/fun/netbunnies/rabbits4-reeves1.jpg
385 0.02%29/Jun/05 21:44/graphics/fun/netbunnies/daisy-davis1.jpg
385 0.01%29/Jun/05 22:02/graphics/fun/netbunnies/joey1-cook1.jpg
385 0.01%29/Jun/05 20:31/graphics/fun/netbunnies/oliver-4.jpg
385 0.01%29/Jun/05 21:21/graphics/fun/netbunnies/rocky-Cathy1.jpg
385 0.01%29/Jun/05 22:24/graphics/fun/netbunnies/turbo2-tam1.jpg
385 0.01%29/Jun/05 14:14/graphics/fun/netbunnies/peter1-prichard1.jpg
385 0.02%29/Jun/05 22:46/graphics/fun/netbunnies/ginger-Cathy1.jpg
385 0.02%29/Jun/05 20:27/graphics/fun/netbunnies/marzncopper-ng1.jpg
385 0.02%29/Jun/05 21:47/graphics/fun/netbunnies/lenie-jalasco1.jpg
385 0.01%29/Jun/05 23:52/graphics/fun/netbunnies/bunny3-karra1.jpg
384 0.01%29/Jun/05 22:03/graphics/fun/netbunnies/clover2-sumanski1.jpg
384 0.02%29/Jun/05 21:28/graphics/fun/netbunnies/dande1-smigo1.jpg
384 0.02%29/Jun/05 19:57/graphics/fun/netbunnies/mbi-moore1.jpg
384 0.03%29/Jun/05 21:21/graphics/fun/netbunnies/rabbit-Castillo1.jpg
384 0.01%29/Jun/05 23:53/graphics/fun/netbunnies/daisydixon-davis1.jpg
384 0.01%29/Jun/05 21:20/graphics/fun/netbunnies/rocky-rayvon1.jpg
384 0.03%29/Jun/05 21:16/graphics/fun/netbunnies/pandora2-chiquita1.jpg
384 0.02%29/Jun/05 21:22/graphics/fun/netbunnies/patches-lemke1.jpg
384 0.01%29/Jun/05 21:51/graphics/fun/netbunnies/pg1.jpg
384 0.01%29/Jun/05 21:50/graphics/fun/netbunnies/jack2-Hir1.jpg
384 0.01%29/Jun/05 16:32/graphics/fun/netbunnies/ippie-sewps1.jpg
383 0.01%29/Jun/05 12:16/graphics/fun/netbunnies/bunnybegging-eng1.jpg
383 0.01%29/Jun/05 22:03/graphics/fun/netbunnies/basil1.jpg
383 0.02%29/Jun/05 21:52/graphics/fun/netbunnies/kili-kamp1.jpg
383 0.02%29/Jun/05 23:20/graphics/fun/netbunnies/nicke1-Olsson1.jpg
383 0.02%29/Jun/05 22:02/graphics/fun/netbunnies/penny1-lake1.jpg
383 0.01%30/Jun/05 00:06/graphics/fun/netbunnies/george1.jpg
383 0.01%29/Jun/05 21:17/graphics/fun/netbunnies/benjamin-Noir1.jpg
383 0.01%29/Jun/05 23:18/graphics/fun/netbunnies/hank-Caine1.jpg
383 0.01%29/Jun/05 22:47/graphics/fun/netbunnies/rabbit3-rybizek1.jpg
383 0.01%29/Jun/05 21:24/graphics/fun/netbunnies/penny1_lake1.jpg
383 0.02%29/Jun/05 21:49/graphics/fun/netbunnies/barley-caligiuri1.jpg
383 0.02%29/Jun/05 20:33/graphics/fun/netbunnies/lulu2-giordano1.jpg
382 0.01%29/Jun/05 22:01/graphics/fun/netbunnies/ryok3.jpg
382 0.01%29/Jun/05 21:21/graphics/fun/netbunnies/petey-caulders1.jpg
382 0.01%29/Jun/05 21:37/graphics/fun/netbunnies/ollie-cherry1.jpg
382 0.02%29/Jun/05 21:24/graphics/fun/netbunnies/eve-Walzer1.jpg
382 0.01%29/Jun/05 21:23/graphics/fun/netbunnies/selleck-allen1.jpg
382 0.02%29/Jun/05 21:48/graphics/fun/netbunnies/peter2-pritchard1.jpg
382 0.01%29/Jun/05 23:21/graphics/fun/netbunnies/sam-penelope3-stellato1.jpg
382 29/Jun/05 21:53/graphics/fun/netbunnies/spencer-bianca.jpg
382 0.01%29/Jun/05 21:01/graphics/fun/netbunnies/makandaun.jpg
382 0.02%29/Jun/05 22:02/graphics/fun/netbunnies/bambam-hearn1.jpg
382 0.03%29/Jun/05 21:22/graphics/fun/netbunnies/maverick2-kirk1.jpg
382 28/Jun/05 11:04/webmail/images/addaddress.gif
382 0.01%29/Jun/05 20:39/graphics/fun/netbunnies/jack-clasby1.jpg
381 0.01%29/Jun/05 21:32/graphics/fun/netbunnies/oreo-froggy1.jpg
381 0.01%29/Jun/05 19:47/graphics/fun/netbunnies/casey&min-Cathy2.jpg
381 0.01%29/Jun/05 17:17/graphics/fun/netbunnies/bunnies2-kimberley1.jpg
381 29/Jun/05 22:03/graphics/fun/netbunnies/spencer-profile.jpg
381 0.01%29/Jun/05 21:38/graphics/fun/netbunnies/foozle-singleton1.jpg
381 0.01%29/Jun/05 20:31/graphics/fun/netbunnies/new-2yourabbitsresized.jpg
381 0.01%29/Jun/05 19:05/graphics/mine/foo/3-under-bed.jpg
381 0.01%29/Jun/05 19:41/graphics/fun/netbunnies/ozzy3-jodi1.jpg
381 0.02%29/Jun/05 21:20/graphics/fun/netbunnies/garth-robinson1.jpg
381 0.01%29/Jun/05 21:24/graphics/fun/netbunnies/oreo-angela1.jpg
381 0.01%29/Jun/05 23:18/graphics/fun/netbunnies/trinityhiphop-fischer1.jpg
381 0.02%29/Jun/05 23:36/graphics/fun/netbunnies/bonnie-gazan1.jpg
381 0.01%29/Jun/05 20:13/graphics/fun/netbunnies/snuffie-SheilaS1.jpg
381 0.01%29/Jun/05 21:46/graphics/fun/netbunnies/kurosawa-king1.jpg
381 0.01%29/Jun/05 13:37/graphics/fun/netbunnies/bengong.jpg
381 0.01%29/Jun/05 19:46/graphics/fun/netbunnies/merlinmatilda2-robeson1.jpg
380 0.02%29/Jun/05 22:28/graphics/fun/netbunnies/bunnyinbox-Leatherdale1.jpg
380 0.01%29/Jun/05 22:03/graphics/fun/netbunnies/harvey2-newstead1.jpg
380 0.01%29/Jun/05 17:46/graphics/fun/netbunnies/scone2-brown1.jpg
380 0.01%29/Jun/05 21:40/graphics/fun/netbunnies/shela-morales1.jpg
380 0.01%29/Jun/05 19:56/graphics/fun/netbunnies/mrsbunny-beebe1.jpg
380 0.01%29/Jun/05 21:45/graphics/fun/netbunnies/muppet-warwick1.jpg
380 0.01%29/Jun/05 20:04/graphics/fun/netbunnies/thumper+louis-desio1.jpg
380 0.03%29/Jun/05 21:21/graphics/fun/netbunnies/kobe2-segers1.jpg
380 0.01%29/Jun/05 21:46/graphics/fun/netbunnies/rabbit-adam1.jpg
380 0.02%29/Jun/05 19:24/graphics/fun/netbunnies/sofee-friedmann1.jpg
380 0.03%29/Jun/05 21:45/graphics/fun/netbunnies/khaki-fischer1.jpg
380 0.01%29/Jun/05 21:19/graphics/fun/netbunnies/conejo2-Collado1.jpg
380 0.01%29/Jun/05 20:29/graphics/fun/netbunnies/pintobow.jpg
380 0.01%29/Jun/05 21:42/graphics/fun/netbunnies/peanutpeaches-potuzak1.jpg
379 0.01%29/Jun/05 21:17/graphics/fun/netbunnies/paul24-Tini1.jpg
379 28/Jun/05 11:04/webmail/images/up.gif
379 0.01%29/Jun/05 20:37/graphics/fun/netbunnies/sage2.jpg
379 0.01%29/Jun/05 13:39/graphics/fun/netbunnies/relaxing.jpg
379 0.02%29/Jun/05 21:50/graphics/fun/netbunnies/sonora-hanson1.jpg
379 0.01%29/Jun/05 21:27/graphics/fun/netbunnies/BunnySniff.JPG
379 0.01%29/Jun/05 21:47/graphics/fun/netbunnies/reflection-Zdila1.jpg
379 0.01%29/Jun/05 20:53/graphics/fun/netbunnies/hopalong-ho1.jpg
379 0.01%29/Jun/05 22:46/graphics/fun/netbunnies/munchkin-singer1.jpg
379 0.02%29/Jun/05 21:30/graphics/fun/netbunnies/timmysitting-Anderson1.jpg
379 0.02%29/Jun/05 20:28/graphics/fun/netbunnies/snowflake3-smopar1.jpg
379 0.01%29/Jun/05 20:45/graphics/fun/netbunnies/sadie-mia1.jpg
379 0.02%29/Jun/05 21:59/graphics/fun/netbunnies/dip1-tagliamonte1.jpg
379 0.02%29/Jun/05 21:16/graphics/fun/netbunnies/bobby-Chuck1.jpg
379 0.03%29/Jun/05 18:09/graphics/fun/netbunnies/sagechris1-Hunt1.jpg
378 0.01%29/Jun/05 20:27/graphics/fun/netbunnies/nut2-makuh1.jpg
378 0.02%29/Jun/05 16:03/graphics/fun/netbunnies/harvey-birch1.jpg
378 0.01%29/Jun/05 21:18/graphics/fun/netbunnies/hazel-garver1.jpg
378 0.03%29/Jun/05 20:27/graphics/fun/netbunnies/paige+theo-brusk1.jpg
378 0.01%29/Jun/05 22:03/graphics/fun/netbunnies/sleep.jpg
378 0.01%29/Jun/05 20:55/graphics/fun/netbunnies/campion2-ginger1.jpg
378 0.01%29/Jun/05 21:48/graphics/fun/netbunnies/luna6-oui1.jpg
378 0.02%29/Jun/05 22:03/graphics/fun/netbunnies/oreo-nicki1.jpg
377 0.02%29/Jun/05 22:38/graphics/fun/netbunnies/lucy-rebecca1.jpg
377 0.01%29/Jun/05 21:23/graphics/fun/netbunnies/fellafoot-silver1.jpg
377 0.01%29/Jun/05 15:55/graphics/fun/netbunnies/cookie+mocha1-gatto1.jpg
377 0.01%29/Jun/05 21:28/journal/3-11/graphics/apple-by-fence-ill.gif
377 0.01%29/Jun/05 21:49/graphics/fun/netbunnies/daphne_dopey-chen1.jpg
377 0.01%29/Jun/05 22:13/graphics/fun/netbunnies/bunny2-libby1.jpg
377 0.02%29/Jun/05 18:44/graphics/fun/netbunnies/harley2-ko1.jpg
377 0.01%29/Jun/05 23:53/graphics/fun/netbunnies/mojave2-brown1.jpg
377 0.01%29/Jun/05 20:36/graphics/fun/netbunnies/riley3-charisemaria1.jpg
377 0.02%29/Jun/05 20:33/graphics/fun/netbunnies/hamilton-camelot1.jpg
377 0.01%29/Jun/05 22:46/graphics/fun/netbunnies/harvey.jpg
377 0.01%29/Jun/05 14:15/graphics/fun/netbunnies/jackie.jpg
376 0.01%29/Jun/05 22:49/chapters/san-diego/adoption/company.html
376 0.01%29/Jun/05 21:42/graphics/fun/netbunnies/glamorous.jpg
376 0.01%29/Jun/05 21:05/graphics/fun/netbunnies/lulu-velas1.jpg
376 0.01%29/Jun/05 20:31/graphics/fun/netbunnies/lilieozzycharity-lilbit1.jpg
376 0.03%29/Jun/05 23:53/graphics/fun/netbunnies/boys2-martin1.jpg
376 0.01%29/Jun/05 20:54/graphics/fun/netbunnies/bunnies1-kimberley1.jpg
376 0.02%29/Jun/05 22:38/graphics/fun/netbunnies/clover3-sumanski1.jpg
376 0.03%29/Jun/05 20:32/graphics/fun/netbunnies/montythumper3-carpenter1.jpg
375 0.01%29/Jun/05 19:32/graphics/fun/netbunnies/bunny2-heinsma1.jpg
375 0.01%29/Jun/05 19:55/chapters/san-diego/diet/plants.html
375 0.01%29/Jun/05 21:29/graphics/fun/netbunnies/simone5.jpg
375 0.02%29/Jun/05 22:17/rabbit-center/adoptables/graphics/big/bungee08sml.jpg
375 0.01%29/Jun/05 20:23/graphics/fun/netbunnies/rudi-scherkamp1.jpg
375 0.01%29/Jun/05 21:21/graphics/fun/netbunnies/rabbit2-klarman1.jpg
375 0.02%29/Jun/05 17:10/graphics/fun/netbunnies/rockey1-kirk1.jpg
375 0.01%29/Jun/05 19:29/graphics/books/hoptoit.gif
375 0.01%29/Jun/05 16:09/graphics/fun/netbunnies/r2-3-lin1.jpg
375 0.04%29/Jun/05 22:48/graphics/fun/netbunnies/puff-lindren-white-toilet.jpg
375 0.01%29/Jun/05 20:58/graphics/fun/netbunnies/thumper-button1.jpg
375 0.02%29/Jun/05 21:49/graphics/fun/netbunnies/muggsie2-nilgesl1.jpg
375 0.02%29/Jun/05 22:04/graphics/fun/netbunnies/gimli2-schroede1.jpg
375 0.01%29/Jun/05 21:44/graphics/fun/netbunnies/frenchy+maybe-lorian1.jpg
374 0.01%29/Jun/05 17:10/graphics/fun/netbunnies/bunny1-chica1.jpg
374 0.02%29/Jun/05 21:50/graphics/fun/netbunnies/floppy-small1.jpg
374 0.01%29/Jun/05 23:53/links/sections/allywebpage.html
374 0.03%29/Jun/05 20:55/graphics/fun/netbunnies/tracy.jpg
374 0.01%29/Jun/05 22:34/graphics/fun/netbunnies/bunnies3-kimberley1.jpg
374 0.02%29/Jun/05 21:42/graphics/fun/netbunnies/emma2-beavis1.jpg
374 0.01%29/Jun/05 22:10/graphics/fun/netbunnies/duncan13.jpg
374 0.02%29/Jun/05 22:46/graphics/fun/netbunnies/bunny7-stasinos1.jpg
374 0.01%29/Jun/05 21:29/graphics/fun/netbunnies/queenofthehill2.jpg
373 0.01%29/Jun/05 14:01/graphics/fun/netbunnies/maggie-Dooley1.jpg
373 0.01%29/Jun/05 22:05/graphics/fun/netbunnies/pele02.jpg
373 0.03%29/Jun/05 19:56/graphics/fun/netbunnies/Bunny_in_a_Bowl_1.gif
373 0.01%29/Jun/05 20:32/graphics/fun/netbunnies/joey2-grinnel1.jpg
373 0.01%29/Jun/05 20:33/graphics/fun/netbunnies/maybetire-ladykat1.jpg
372 0.01%29/Jun/05 23:53/graphics/fun/netbunnies/janchair2-marturano1.jpg
372 0.03%29/Jun/05 22:37/graphics/fun/netbunnies/butz1-french1.jpg
371 0.01%29/Jun/05 21:21/graphics/fun/netbunnies/oreofluff-varghese1.jpg
371 0.01%29/Jun/05 22:03/graphics/fun/netbunnies/pebbles-hearn1.jpg
371 0.03%29/Jun/05 16:20/graphics/fun/netbunnies/santarabbitandpresentkarask.jpg
371 0.02%29/Jun/05 21:02/graphics/fun/netbunnies/riley1.jpg
371 0.01%29/Jun/05 22:15/graphics/fun/netbunnies/cozybun2.jpg
370 29/Jun/05 19:29/links/sections/nc-find120x90.gif
370 0.01%29/Jun/05 21:38/graphics/fun/netbunnies/mfaces.jpg
370 29/Jun/05 19:29/graphics/books/peacable.gif
370 28/Jun/05 11:04/webmail/images/attach.gif
370 0.01%29/Jun/05 22:37/graphics/fun/netbunnies/sparkiesnow-small1.jpg
369 0.01%29/Jun/05 21:30/graphics/fun/netbunnies/grethel-broley1.jpg
369 0.01%29/Jun/05 20:59/graphics/fun/netbunnies/croppedbunny-emily1.jpg
369 0.01%29/Jun/05 20:32/graphics/fun/netbunnies/rose-doubleday1.jpg
369 0.01%29/Jun/05 22:25/graphics/fun/netbunnies/nicklovesannie-kyrene1.jpg
369 0.01%29/Jun/05 19:43/graphics/fun/netbunnies/french04.jpg
368 0.01%29/Jun/05 22:05/graphics/fun/netbunnies/bunny-sugalski1.jpg
368 0.01%30/Jun/05 00:06/graphics/fun/netbunnies/hamilton-chercat1.jpg
368 29/Jun/05 23:45/rabbit-center/boarding.html
368 0.01%29/Jun/05 23:53/graphics/fun/netbunnies/patty2-mckinnon1.jpg
368 0.02%29/Jun/05 21:24/graphics/fun/netbunnies/harvey-Elliott1.jpg
368 0.02%29/Jun/05 19:43/rabbit-center/hayward_rescue/hayward_graphics/boy_tumor_exam.jpg
367 0.01%29/Jun/05 19:57/graphics/fun/netbunnies/smokey+daisy-jack1.jpg
367 0.01%29/Jun/05 19:29/graphics/fun/netbunnies/bunny8-Baker1.jpg
367 0.02%29/Jun/05 21:52/graphics/fun/netbunnies/cb-fraleigh1.jpg
366 0.01%29/Jun/05 23:18/graphics/fun/netbunnies/gingerricky-montgomery1.jpg
366 0.01%29/Jun/05 22:21/journal/2-1/loss-support.html
366 0.01%29/Jun/05 22:14/graphics/fun/netbunnies/bunnies9-doerfler1.jpg
366 0.02%29/Jun/05 22:47/graphics/fun/netbunnies/minirex-sandamander1.jpg
366 0.02%29/Jun/05 19:32/graphics/fun/netbunnies/bunnybabies-Linares1.jpg
366 0.01%29/Jun/05 19:42/graphics/fun/netbunnies/pichi1-lopez1.jpg
366 0.02%29/Jun/05 22:24/graphics/fun/netbunnies/nick-athensgold1.jpg
366 0.01%29/Jun/05 20:25/graphics/fun/netbunnies/fibby2-orozco1.jpg
366 0.02%29/Jun/05 21:35/graphics/fun/netbunnies/rabbie-cooper1.jpg
366 29/Jun/05 19:29/graphics/books/right-pet.gif
366 0.02%29/Jun/05 22:36/graphics/fun/netbunnies/ears1-magee1.jpg
365 0.02%29/Jun/05 20:31/graphics/fun/netbunnies/nidoran-correa1.jpg
365 0.02%29/Jun/05 21:18/graphics/fun/netbunnies/pokey1-chiang1.jpg
365 0.02%29/Jun/05 21:22/graphics/fun/netbunnies/fuzzy_harley4-ko1.jpg
364 0.01%29/Jun/05 19:07/graphics/fun/netbunnies/elliot2-cote1.jpg
364 0.01%29/Jun/05 20:59/graphics/fun/netbunnies/nibbs1.jpg
364 0.02%29/Jun/05 21:47/graphics/fun/netbunnies/patrick-rudeck1.jpg
364 0.02%29/Jun/05 20:04/graphics/fun/netbunnies/harveywatchingtvnorth.jpg
363 0.01%29/Jun/05 22:38/graphics/fun/netbunnies/dinkyscale-melin1.jpg
363 0.01%29/Jun/05 20:02/graphics/fun/netbunnies/roozelda1-gannon1.jpg
363 0.02%29/Jun/05 19:28/graphics/fun/netbunnies/sherlock.jpg
363 0.01%29/Jun/05 21:49/graphics/fun/netbunnies/elwood-mcclure1.jpg
363 0.01%29/Jun/05 16:08/graphics/fun/netbunnies/mattboo-Carlson1.jpg
362 0.01%29/Jun/05 18:32/journal/3-3/law-rabbit.html
362 0.01%29/Jun/05 21:22/graphics/fun/netbunnies/dodger2-montoya1.jpg
362 0.01%29/Jun/05 15:31/graphics/fun/tinytim.gif
362 0.02%29/Jun/05 21:27/graphics/fun/netbunnies/tepp1-noa1.jpg
361 0.01%29/Jun/05 23:54/links/sections/mailing-lists.html
361 0.01%29/Jun/05 19:26/care/vets_nocal.html
361 0.01%29/Jun/05 20:24/graphics/fun/netbunnies/oliver-habel1.jpg
361 0.01%29/Jun/05 21:30/graphics/fun/netbunnies/lucky-davis1.jpg
360 0.01%29/Jun/05 20:30/graphics/fun/netbunnies/midnight1-pasquarello1.jpg
360 0.03%29/Jun/05 13:35/graphics/fun/netbunnies/ericrags3.jpg
359 29/Jun/05 21:23/graphics/fun/netbunnies/fidge-n-fuzz.jpg
359 0.01%29/Jun/05 21:01/graphics/fun/netbunnies/scotchcutie-thomas1.jpg
358 0.01%29/Jun/05 21:23/graphics/fun/netbunnies/morty2-alcorn1.jpg
357 0.01%29/Jun/05 21:22/chapters/san-diego/diet/rabbit_GI_physiology.html
357 0.01%29/Jun/05 23:56/graphics/fun/netbunnies/ChipEat2.JPG
356 0.02%29/Jun/05 20:55/graphics/fun/netbunnies/maeve+draighnean-mcnulty1.jpg
355 0.01%29/Jun/05 16:23/graphics/fun/netbunnies/dande3-smigo1.jpg
355 0.01%29/Jun/05 16:09/graphics/fun/netbunnies/midnight-dawn1.jpg
355 0.01%29/Jun/05 20:02/graphics/fun/netbunnies/funia-izabella1.jpg
355 0.01%29/Jun/05 21:48/graphics/fun/netbunnies/nevat-puyol1.jpg
355 0.01%29/Jun/05 18:01/journal/3-12/allergies.html
354 0.02%29/Jun/05 19:43/rabbit-center/hayward_rescue/hayward_graphics/yellow_bunny_exam_2.jpg
353 0.01%29/Jun/05 20:08/graphics/fun/netbunnies/missflop-hess1.jpg
352 0.01%29/Jun/05 22:28/graphics/fun/netbunnies/rex-poole1.jpg
352 0.01%29/Jun/05 22:02/graphics/fun/netbunnies/mrb-pfirsch1.jpg
352 29/Jun/05 23:56/chapters/san-francisco/home-banner.gif
350 0.01%29/Jun/05 22:21/rabbit-center/hayward_rescue/hayward_rabbits_Janet-Lance.html
349 28/Jun/05 11:04/webmail/images/right-grey.gif
348 29/Jun/05 23:35/graphics/easter/rabbit5.gif
348 28/Jun/05 11:04/webmail/images/left-grey.gif
348 0.01%29/Jun/05 23:46/chapters/san-diego/behavior/altering.html
348 0.01%29/Jun/05 21:30/graphics/fun/netbunnies/flop1-julian1.jpg
347 0.31%29/Jun/05 19:30/rabbit-center/lucky/images/safe-2.png
347 29/Jun/05 23:53/chapters/oregon/rabbits.html
344 0.01%29/Jun/05 22:07/journal/3-11/thorax.html
343 0.01%29/Jun/05 23:23/journal/3-9/bonding.html
340 0.02%29/Jun/05 23:18/rabbit-center/hayward_rescue/witness_statements.html
339 28/Jun/05 11:04/webmail/images/new.gif
339 0.02%29/Jun/05 19:43/rabbit-center/hayward_rescue/hayward_graphics/yellow_boy_exam_3.jpg
339 0.01%29/Jun/05 21:49/graphics/fun/netbunnies/sean-odell1.jpg
338 0.02%29/Jun/05 19:27/graphics/postcard/lavender.jpg
337 0.01%29/Jun/05 21:16/graphics/postcard/willow-in-bed-with-teddy.jpg
336 0.05%29/Jun/05 19:43/rabbit-center/hayward_rescue/hayward_graphics/bonepile.jpg
334 0.01%29/Jun/05 22:25/chapters/san-diego/adoption/Adoption_Photos/Bandit_adoption_7Jun05.jpg
334 28/Jun/05 11:04/webmail/images/last-grey.gif
333 29/Jun/05 21:48/rabbit-center/events.html
332 29/Jun/05 21:26/rabbit-center/rabbit_ofthe_month/may05/
332 29/Jun/05 23:26/journal/1/sara.html
329 0.01%29/Jun/05 21:12/adoption/rabbits-at-easter.html
328 29/Jun/05 21:02/chapters/san-francisco/logo.gif
327 29/Jun/05 19:43/rabbit-center/hayward_rescue/hayward_graphics/shed.jpg
327 29/Jun/05 21:20/health/abscess.html
326 29/Jun/05 23:58/journal/4-7/bereavedbunny.html
325 29/Jun/05 18:04/journal/3-11/trucking.html
323 0.02%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/auction_photos-2004.html
322 0.01%29/Jun/05 15:59/graphics/postcard/Pl-sch10.jpg
322 0.01%29/Jun/05 19:43/rabbit-center/hayward_rescue/hayward_graphics/corpse1.jpg
321 29/Jun/05 10:59/links/sections/memorial.html
320 0.01%29/Jun/05 22:42/chapters/san-diego/diet/hayisbasis.html
319 29/Jun/05 23:01/links/sections/karma.html
319 29/Jun/05 21:44/links/sections/zipzoefoo.html
314 28/Jun/05 11:04/webmail/images/first-grey.gif
313 29/Jun/05 22:11/graphics/easter/
16 29/Jun/05 21:48  /graphics/easter/?N=D
13 28/Jun/05 07:31  /graphics/easter/?N=A
12 28/Jun/05 07:15  /graphics/easter/?M=A
11 27/Jun/05 18:06  /graphics/easter/?D=A
313 0.01%29/Jun/05 18:23/journal/3-10/graphics/pain.gif
313 29/Jun/05 22:22/journal/3-7/graphics/rescue-circle.gif
312 29/Jun/05 23:53/chapters/oregon/images/buttonbar_02.gif
311 0.01%29/Jun/05 21:16/graphics/postcard/paddington.jpg
311 0.01%29/Jun/05 18:41/journal/2-10/gutherie.html
310 29/Jun/05 23:53/chapters/oregon/images/buttonbar_01.gif
310 29/Jun/05 23:53/chapters/oregon/images/buttonbar_04.gif
310 29/Jun/05 20:15/care/angora.html
308 29/Jun/05 23:53/chapters/oregon/images/buttonbar_03.gif
308 29/Jun/05 23:53/chapters/oregon/images/banner_450x120.jpg
307 29/Jun/05 23:53/chapters/oregon/images/buttonbar_07.gif
307 0.01%29/Jun/05 23:36/chapters/san-diego/health/vet-talk/dental.html
307 0.01%29/Jun/05 21:52/chapters/san-diego/behavior/bonding.html
306 29/Jun/05 23:53/chapters/oregon/images/buttonbar_06.gif
305 29/Jun/05 19:12/help/search.html
305 0.01%29/Jun/05 18:35/journal/2-5/gift.html
305 0.01%29/Jun/05 22:06/help/subject-index.html
305 29/Jun/05 23:53/chapters/oregon/images/buttonbar_05.gif
305 0.01%29/Jun/05 22:39/journal/2-5/yes-to-rabbits.html
304 29/Jun/05 23:17/chapters/san-diego/health/molting.html
304 0.01%29/Jun/05 23:46/journal/4-7/letters.html
302 29/Jun/05 19:29/rabbit-center/lucky/latestphotos.htm
301 0.01%29/Jun/05 21:48/chapters/san-diego/behavior/litter_compare.html
299 29/Jun/05 17:15/fun/answer3.html
299 29/Jun/05 20:31/chapters/socal/banner.gif
298 29/Jun/05 22:19/fun/answer2.html
297 29/Jun/05 19:15/journal/1/jb.html
295 0.01%29/Jun/05 21:41/chapters/san-diego/diet/pellets.html
295 29/Jun/05 23:44/rabbit-center/resources/
295 0.01%29/Jun/05 19:32/journal/2-9/recordkeeping.html
294 0.01%29/Jun/05 18:09/journal/3-9/palmer.html
293 29/Jun/05 22:21/chapters/san-diego/behavior/quiz/nextquestion.gif
290 29/Jun/05 22:21/chapters/san-diego/behavior/quiz/next-arrow.gif
290 0.01%29/Jun/05 21:57/journal/3-3/graphics/law.gif
289 29/Jun/05 18:47/journal/3-7/ungetaway.html
288 29/Jun/05 22:42/links/history.html
287 29/Jun/05 23:03/links/palace_pet.html
285 29/Jun/05 14:50/faq/sections/
15 28/Jun/05 12:31  /faq/sections/?N=D
14 28/Jun/05 07:14  /faq/sections/?D=A
14 28/Jun/05 06:28  /faq/sections/?M=A
12 28/Jun/05 07:39  /faq/sections/?N=A
284 0.01%29/Jun/05 23:33/journal/3-12/chiropractor.html
282 29/Jun/05 17:48/chapters/san-diego/health/health-cert.html
281 29/Jun/05 22:41/links/sections/fun-facts.html
281 30/Jun/05 00:00/journal/2-8/quality-of-life.html
280 29/Jun/05 21:40/translations/portugese/
280 0.01%29/Jun/05 14:44/chapters/san-diego/health/spay_neuter_rebates.html
280 29/Jun/05 22:42/chapters/san-diego/health/vet-talk/cuniculi.html
279 0.01%29/Jun/05 19:46/journal/1/making-a-houserabbit.html
279 29/Jun/05 20:50/chapters/mid-penninsula/adoptables.html
277 0.01%29/Jun/05 17:18/chapters/san-diego/behavior/know_thumper.html
276 29/Jun/05 23:00/faq/sections/hrs-info.html
275 29/Jun/05 18:01/journal/3-12/graphics/allergies.gif
273 29/Jun/05 22:17/hrs-info/premiums.html
273 29/Jun/05 19:40/journal/3-1/graphics/learn-1.gif
272 0.01%29/Jun/05 19:40/journal/3-1/graphics/learn-2.gif
272 29/Jun/05 19:40/journal/3-1/graphics/dorothy.gif
271 29/Jun/05 19:29/rabbit-center/lucky/adopted.htm
271 29/Jun/05 12:13/links/sections/links.html
270 0.01%29/Jun/05 20:06/graphics/fun/netbunnies/IMG04.JPG
270 0.01%29/Jun/05 22:21/rabbit-center/hayward_rescue/hayward_graphics/Janet_karen.JPG
269 0.01%29/Jun/05 20:07/graphics/fun/netbunnies/LEO-2-small.JPG
267 0.01%29/Jun/05 23:23/journal/3-9/graphics/chase1.gif
266 0.01%29/Jun/05 21:47/chapters/san-diego/health/vet-talk/sludge.html
266 0.02%29/Jun/05 22:21/rabbit-center/hayward_rescue/hayward_graphics/Janet_fresh-air.JPG
265 0.01%29/Jun/05 23:23/journal/3-9/graphics/chase2.gif
265 0.01%29/Jun/05 23:23/journal/3-9/graphics/2snuggling-from-back.gif
262 29/Jun/05 12:40/journal/2-5/ever-be-friends.html
262 29/Jun/05 23:44/rabbit-center/resources/images/no-pict.gif
262 29/Jun/05 23:01/fun/tiny-tim.html
261 29/Jun/05 21:02/chapters/san-francisco/carrot.gif
261 0.01%29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_rabbits_volunteers.html
260 0.01%29/Jun/05 22:39/journal/2-12/to-fly-or-not-to-fly.html
260 29/Jun/05 21:26/chapters/san-diego/behavior/losing.html
260 0.07%29/Jun/05 19:17/adopt-a-rabbit-month/MythFlyer2003.pdf
260 0.01%29/Jun/05 21:47/journal/2-12/thumper-and-me.html
259 0.01%29/Jun/05 21:02/chapters/san-francisco/images/with_sheryl.jpg
258 29/Jun/05 21:02/chapters/san-francisco/bun.gif
258 0.01%29/Jun/05 20:01/graphics/fun/netbunnies/DCP00205.JPG
257 0.01%29/Jun/05 21:02/chapters/san-francisco/images/with_joel.jpg
256 29/Jun/05 19:29/rabbit-center/lucky/images/back_photos.gif
256 0.01%29/Jun/05 23:42/journal/4-7/study.html
256 0.01%29/Jun/05 22:23/chapters/san-diego/health/vet-talk/elderly.html
256 29/Jun/05 21:53/graphics/index/baby-zowie-profile-l.gif
255 0.02%29/Jun/05 22:21/rabbit-center/hayward_rescue/hayward_graphics/Lance_Phyllis.jpg
255 29/Jun/05 21:55/chapters/michigan/
254 29/Jun/05 23:05/journal/3-1/floorscapes.html
254 29/Jun/05 20:58/rabbit-center/links.html
253 29/Jun/05 21:02/chapters/san-francisco/leap2.gif
253 0.01%29/Jun/05 22:22/chapters/san-diego/aboutus/events.html
252 0.01%29/Jun/05 23:43/journal/4-7/friend.html
252 29/Jun/05 21:02/chapters/san-francisco/run2.gif
251 0.01%29/Jun/05 21:58/graphics/mine/foo/1-baby-foo.jpg
251 29/Jun/05 20:48/journal/2-6/hasenpfeffer.html
250 0.03%29/Jun/05 19:29/rabbit-center/lucky/images/recent-2.gif
250 0.02%29/Jun/05 19:29/rabbit-center/lucky/images/recent-1_000.gif
249 0.02%29/Jun/05 19:29/rabbit-center/lucky/images/recent-3_000.gif
249 0.02%29/Jun/05 23:18/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_2.JPG
248 29/Jun/05 20:47/rabbit-center/retail/store2S.jpg
248 0.02%29/Jun/05 19:29/rabbit-center/lucky/images/recent-6.gif
248 0.01%29/Jun/05 19:29/rabbit-center/lucky/images/recent-4.gif
248 29/Jun/05 20:47/rabbit-center/retail/store1S.jpg
247 29/Jun/05 13:18/fun/reader-photos.html
247 0.01%29/Jun/05 23:18/rabbit-center/hayward_rescue/hayward_graphics/Ubu_day1.JPG
247 29/Jun/05 19:29/rabbit-center/lucky/images/back_photos_002.gif
246 29/Jun/05 20:47/rabbit-center/retail/store3S.jpg
244 29/Jun/05 19:13/cgi-bin/suid/~rabbit2/search
244 0.01%29/Jun/05 23:18/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_3.jpg
243 29/Jun/05 20:15/graphics/angora.jpg
243 29/Jun/05 22:21/chapters/san-diego/quizstart.html
243 0.02%29/Jun/05 19:29/rabbit-center/lucky/images/recent-5.gif
242 29/Jun/05 20:47/rabbit-center/retail/carrot.gif
241 0.02%29/Jun/05 20:30/hrs-info/hrs.pdf
240 29/Jun/05 19:33/journal/2-9/rebel-with-paws.html
240 29/Jun/05 16:53/care/shavings.html
240 29/Jun/05 16:50/chapters/san-diego/health/vet-talk/cuniculi-up.html
240 0.01%29/Jun/05 23:18/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_11.jpg
238 0.01%29/Jun/05 23:18/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_4.jpg
238 0.01%29/Jun/05 22:21/rabbit-center/hayward_rescue/hayward_graphics/Lance_med-facility.JPG
238 29/Jun/05 19:02/chapters/san-diego/health/ears.html
237 0.02%29/Jun/05 23:18/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_10.jpg
237 29/Jun/05 23:45/rabbit-center/graphics/icon_boardpage.gif
236 29/Jun/05 23:31/journal/3-5/beyond-petting.html
236 28/Jun/05 11:04/webmail/images/left.gif
235 28/Jun/05 11:04/webmail/images/right.gif
235 29/Jun/05 19:59/journal/3-7/snake-bite.html
235 29/Jun/05 22:34/care/vets_texas.html
235 29/Jun/05 17:18/chapters/san-diego/adoption/Adoption_Photos/HRS_Honey_3_11Jul03.JPG
235 29/Jun/05 21:12/adoption/adoption-policies.html
235 29/Jun/05 22:02/chapters/san-diego/health/vet-talk/zinc.html
234 0.02%29/Jun/05 22:21/rabbit-center/hayward_rescue/hayward_graphics/Lance_relaxing.JPG
234 29/Jun/05 21:12/index-small.html
233 29/Jun/05 21:12/translations/german/
233 29/Jun/05 23:49/journal/2-6/reel-rabbits.html
232 0.01%29/Jun/05 16:16/rabbit-center/rabbit_ofthe_month/may05/images/lily1_big.jpg
232 29/Jun/05 16:44/journal/warren-wise/fleas.html
232 0.01%29/Jun/05 23:18/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_6.jpg
231 0.02%29/Jun/05 23:18/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_9.jpg
231 0.02%29/Jun/05 23:18/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_7.jpg
230 0.01%29/Jun/05 22:07/journal/3-11/graphics/xray1.gif
230 29/Jun/05 18:30/chapters/san-diego/health/choosevet.html
230 0.02%29/Jun/05 22:03/graphics/babies/harvey.jpg
230 29/Jun/05 21:22/chapters/san-diego/adoption/new_zealands.html
229 29/Jun/05 13:55/graphics/calendars/
13 29/Jun/05 13:55  /graphics/calendars/?D=A
12 28/Jun/05 19:29  /graphics/calendars/?M=A
12 28/Jun/05 19:28  /graphics/calendars/?N=D
229 0.01%29/Jun/05 22:07/journal/3-11/graphics/xray2.gif
229 29/Jun/05 18:04/journal/3-11/graphics/dutch-munch.gif
229 29/Jun/05 21:12/hrs-info/adoption-education-center.html
228 29/Jun/05 19:09/presspolicies.html
226 0.01%29/Jun/05 20:51/chapters/san-diego/health/death.html
226 29/Jun/05 23:18/rabbit-center/hayward_rescue/whiterabbit.jpg
226 0.01%29/Jun/05 22:07/journal/3-11/graphics/xray3.gif
225 0.02%29/Jun/05 22:21/rabbit-center/hayward_rescue/hayward_graphics/Janet_Lance_karens-lap.JPG
225 29/Jun/05 23:33/rabbit-center/rabbit_ofthe_month/common/bunnyR.gif
225 0.01%29/Jun/05 16:51/journal/3-8/rabbits-in-the-plural.html
224 29/Jun/05 23:33/rabbit-center/rabbit_ofthe_month/common/bunnyL.gif
224 29/Jun/05 21:12/rabbit-center/hq-volunteer.html
223 29/Jun/05 23:39/graphics/fun/lapin.gif
222 29/Jun/05 23:18/rabbit-center/hayward_rescue/rabbit.jpg
222 29/Jun/05 19:55/rabbit-center/news_release/
222 0.01%29/Jun/05 16:16/rabbit-center/rabbit_ofthe_month/may05/images/lily_play.jpg
220 29/Jun/05 20:04/graphics/fun/netbunnies/Freckles-1.JPG
220 29/Jun/05 22:42/chapters/san-diego/health/vet-talk/beadtherapy.html
218 0.03%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Baseball_front.JPG
218 29/Jun/05 23:18/chapters/san-diego/diet/sources.html
216 29/Jun/05 21:08/graphics/breeds/
10 29/Jun/05 06:32  /graphics/breeds/?M=A
215 30/Jun/05 00:01/rabbit-center/buddy/
214 29/Jun/05 18:37/journal/3-7/stray-roundup.html
213 29/Jun/05 18:41/rabbit-center/hayward_rescue/hayward_graphics/Julie-k_Toby.jpg
213 0.01%30/Jun/05 00:02/caregerman/leben-mit-kaninchen.html
213 29/Jun/05 22:51/journal/2-2/perfection.html
213 29/Jun/05 23:18/rabbit-center/hayward_rescue/clip_image023.gif
212 29/Jun/05 14:19/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Black_agouti.JPG
211 0.01%29/Jun/05 22:42/rabbit-center/lucky_letter-writing.html
210 29/Jun/05 18:50/chapters/san-diego/health/eye_scanning.html
209 29/Jun/05 16:51/rabbit-center/resources/vets.html
208 29/Jun/05 21:05/journal/3-2/disabled.html
208 29/Jun/05 23:53/chapters/oregon/images/leslieelliot.jpg
207 0.01%29/Jun/05 20:03/graphics/fun/netbunnies/ElvisandMaddy.JPG
207 0.01%29/Jun/05 21:24/rabbit-center/hayward_rescue/hayward_rabbits_animal-place.html
207 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Baseball_back.JPG
206 0.03%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/blue-bunny-earrings.JPG
206 0.03%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/large_bunny_plaque.jpg
206 29/Jun/05 22:44/fun/answer13.html
204 29/Jun/05 22:39/journal/3-7/places-to-be.html
203 29/Jun/05 22:39/hrs-info/policies.html
202 0.06%29/Jun/05 20:04/graphics/fun/netbunnies/HRS photos 4-12 to 5-3-03
201 29/Jun/05 23:56/chapters/oregon/
201 0.01%29/Jun/05 20:06/graphics/fun/netbunnies/IttyBityBuns.JPG
200 29/Jun/05 21:32/chapters/san-diego/behavior/toys.html
200 29/Jun/05 18:20/journal/3-1/trouble-with-ears.html
200 29/Jun/05 22:49/journal/3-9/bale-of-hay.html
200 29/Jun/05 14:17/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Fat_orange_rex.JPG
199 29/Jun/05 23:17/care/tips98.html
198 29/Jun/05 02:35/graphics/fun/netbunnies/photos-to-upload/
20 28/Jun/05 14:14  /graphics/fun/netbunnies/photos-to-upload/?M=A
18 28/Jun/05 14:15  /graphics/fun/netbunnies/photos-to-upload/?S=A
18 28/Jun/05 14:16  /graphics/fun/netbunnies/photos-to-upload/?D=A
18 28/Jun/05 06:11  /graphics/fun/netbunnies/photos-to-upload/?N=A
18 28/Jun/05 14:13  /graphics/fun/netbunnies/photos-to-upload/?N=D
15 28/Jun/05 07:19  /graphics/fun/netbunnies/photos-to-upload/?M=D
13 28/Jun/05 11:10  /graphics/fun/netbunnies/photos-to-upload/?S=D
197 29/Jun/05 21:44/graphics/thumbnails/tiny-izzy.gif
196 0.01%29/Jun/05 19:29/rabbit-center/lucky/images/adopted-5.gif
196 29/Jun/05 19:22/rabbit-center/lucky/letter-writting.htm
196 0.01%29/Jun/05 19:29/rabbit-center/lucky/images/adopted-3.gif
196 0.02%29/Jun/05 19:29/rabbit-center/lucky/images/adopted-1.gif
196 0.01%29/Jun/05 19:29/rabbit-center/lucky/images/adopted-4.gif
195 29/Jun/05 22:42/chapters/san-diego/behavior/quiz/q9.html
195 0.01%29/Jun/05 19:29/rabbit-center/lucky/images/adopted-6.gif
195 0.01%29/Jun/05 18:01/chapters/san-diego/behavior/bunnies_teaching_bunnies.html
195 0.02%29/Jun/05 19:29/rabbit-center/lucky/images/adopted-7.gif
195 0.02%29/Jun/05 19:29/rabbit-center/lucky/images/adopted-2.gif
194 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/beatrix_potter_books.JPG
193 29/Jun/05 23:53/chapters/oregon/images/jordan.jpg
193 29/Jun/05 23:32/rabbit-center/retail/cages.html
192 29/Jun/05 23:08/translations/japanese/red-urine-j.txt
192 0.01%29/Jun/05 13:48/chapters/san-diego/aboutus/bunnyfest/auction_photos-2003.html
191 29/Jun/05 22:42/chapters/san-diego/behavior/quiz/q10.html
191 29/Jun/05 21:44/graphics/thumbnails/tiny-zippy.gif
190 29/Jun/05 21:48/care/vets_michigan.html
190 29/Jun/05 22:29/chapters/san-diego/adoption/guidelines.html
190 29/Jun/05 21:44/graphics/thumbnails/tiny-king-foo.gif
189 29/Jun/05 21:44/graphics/thumbnails/tiny-zowie.gif
188 0.01%29/Jun/05 22:17/rabbit-center/adoptables/graphics/big/mohawk r1424 09sml.jpg
188 29/Jun/05 20:45/chapters/san-diego/behavior/quiz/q7.html
188 29/Jun/05 21:37/chapters/oakland/fight.html
187 29/Jun/05 20:44/chapters/san-diego/behavior/quiz/q3.html
187 29/Jun/05 11:41/hrs-info/history.html
186 29/Jun/05 23:53/chapters/oregon/images/sally.jpg
185 29/Jun/05 23:53/chapters/oregon/images/rex.jpg
184 29/Jun/05 20:44/chapters/san-diego/behavior/quiz/q2.html
183 0.02%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/blue_porcelain_bunny.JPG
183 29/Jun/05 18:40/chapters/san-diego/health/vet-talk/
183 29/Jun/05 12:06/hrs-info/membership-form.html
183 29/Jun/05 23:53/chapters/oregon/images/georgefrancine.jpg
183 29/Jun/05 18:41/rabbit-center/hayward_rescue/hayward_rabbits_toby_tribute.html
183 29/Jun/05 20:31/journal/4-3/house-fly.html
182 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/calendar.jpg
182 29/Jun/05 19:49/chapters/san-diego/aboutus/member.html
182 29/Jun/05 22:42/chapters/oakland/woolblok.html
182 29/Jun/05 19:56/rabbit-center/lucky/luckystory.htm
182 29/Jun/05 21:04/chapters/san-diego/health/vet-talk/stress.html
182 29/Jun/05 23:53/chapters/oregon/images/william.jpg
181 29/Jun/05 23:53/chapters/oregon/images/bruce.jpg
181 29/Jun/05 20:45/chapters/san-diego/behavior/quiz/q8.html
181 29/Jun/05 23:47/journal/4-7/visdelight.html
180 29/Jun/05 19:30/rabbit-center/lucky/luckysaved.htm
180 0.01%29/Jun/05 20:06/graphics/fun/netbunnies/Inseperable0002.JPG
179 29/Jun/05 23:20/chapters/san-diego/products/clothing.html
179 29/Jun/05 23:53/chapters/oregon/images/maurice.jpg
179 29/Jun/05 20:44/chapters/san-diego/behavior/quiz/q4.html
179 29/Jun/05 19:04/chapters/michigan/x.gif
178 29/Jun/05 21:30/journal/4-4/pandora.html
177 29/Jun/05 21:13/journal/3-2/litter-diggers.html
177 29/Jun/05 23:21/chapters/san-diego/adoption/find_rabbit.html
176 29/Jun/05 20:45/chapters/san-diego/behavior/quiz/q6.html
176 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/coffee_cookie_bsket.JPG
176 29/Jun/05 20:23/opinion/petco.html
176 29/Jun/05 20:44/chapters/san-diego/behavior/quiz/q5.html
176 0.03%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/chargers_basket.jpg
175 29/Jun/05 19:43/chapters/san-diego/behavior/digger.html
175 29/Jun/05 18:55/rabbit-center/graphics/icon_eventspage.gif
175 0.01%29/Jun/05 21:16/graphics/postcard/Tommy2.jpg
174 29/Jun/05 19:04/chapters/michigan/fosters.html
174 29/Jun/05 18:47/journal/3-7/graphics/ungetaway.gif
174 29/Jun/05 18:09/journal/3-9/graphics/palmer.gif
174 0.01%29/Jun/05 20:48/journal/2-6/graphics/hasie-2.gif
173 0.01%29/Jun/05 17:06/help/toc.html
172 29/Jun/05 21:54/chapters/san-diego/behavior/besttoy.html
172 29/Jun/05 20:44/chapters/san-diego/behavior/quiz/q4answer_true.html
172 29/Jun/05 20:42/chapters/san-diego/adoption/pre-adoption.html
172 29/Jun/05 20:07/rabbit-center/retail/no-pict.gif
171 29/Jun/05 18:40/rabbit-center/hayward_rescue/hayward_rabbits_johanna.html
171 29/Jun/05 20:44/chapters/san-diego/behavior/quiz/q3answer_true.html
170 29/Jun/05 18:09/journal/3-9/graphics/snuggle-bunnies.gif
170 0.03%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/ice_tea_basket.JPG
169 29/Jun/05 12:15/faqgerman/sections/kastration.html
169 29/Jun/05 21:25/rabbit-center/hayward_rescue/hayward_graphics/olga103tiny.jpg
169 29/Jun/05 23:30/journal/3-8/numbers.html
169 29/Jun/05 21:18/care/tips99.html
168 29/Jun/05 21:25/rabbit-center/hayward_rescue/hayward_graphics/prana088tiny.jpg
168 29/Jun/05 21:25/rabbit-center/hayward_rescue/hayward_graphics/samantha077tiny.jpg
168 29/Jun/05 20:09/graphics/fun/netbunnies/Lovers2.JPG
168 29/Jun/05 23:44/rabbit-center/graphics/icon_resources.gif
168 29/Jun/05 19:58/chapters/san-diego/health/vet-talk/enteritis.html
167 30/Jun/05 00:04/journal/3-9/companions-not-dinner.html
167 29/Jun/05 14:51/translations/spanish/debo-darle-de-comer.html
166 29/Jun/05 19:19/graphics/mine/
13 28/Jun/05 01:39  /graphics/mine/?M=A
11 27/Jun/05 18:06  /graphics/mine/?D=A
11 27/Jun/05 18:06  /graphics/mine/?N=D
10 27/Jun/05 18:07  /graphics/mine/?N=A
166 29/Jun/05 20:46/chapters/san-diego/behavior/quiz/q9answer_false.html
166 29/Jun/05 21:57/links/breed-descriptions.html
166 29/Jun/05 17:03/graphics/mine/toby-izzy/
12 28/Jun/05 06:46  /graphics/mine/toby-izzy/?N=D
166 29/Jun/05 16:38/rabbit-center/hayward_rescue/hayward_rabbits_update_jun6_04.html
165 29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/zephyr081tiny.jpg
165 29/Jun/05 22:12/easter/flyer/
165 29/Jun/05 20:06/graphics/fun/netbunnies/IMG02.JPG
165 29/Jun/05 17:56/journal/3-12/graphics/chiro.gif
164 29/Jun/05 13:27/journal/3-10/conference.html
164 0.01%29/Jun/05 15:53/rabbit-center/adoptables/graphics/big/yuna-r1395-16sml.jpg
164 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/smbunnyball.jpg
164 0.03%29/Jun/05 09:00/rabbit-center/adoptables/images/mr_missy_big.gif
163 29/Jun/05 20:45/chapters/san-diego/behavior/quiz/q7answer_true.html
162 29/Jun/05 20:44/chapters/san-diego/behavior/quiz/q5answer_false.html
162 0.01%29/Jun/05 20:11/rabbit-center/retail/cubesetL.jpg
162 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Bigbunnyball.jpg
162 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunnykins_album_rabbit.JPG
162 0.01%29/Jun/05 23:38/rabbit-center/adoptables/graphics/big/sara1-sml.jpg
161 29/Jun/05 16:21/hrs-info/other-support.html
161 29/Jun/05 20:44/chapters/san-diego/behavior/quiz/q2answer_false.html
161 0.02%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/perfume_bottle.JPG
161 29/Jun/05 10:41/journal/2-5/wabbit.html
160 29/Jun/05 12:45/faqgerman/sections/medizinischefragen.html
160 0.01%29/Jun/05 11:20/help/atomz-hints.html
160 0.03%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/avon_basket.JPG
160 29/Jun/05 13:01/journal/3-2/marshmallow.html
160 0.01%29/Jun/05 16:31/care/living-with-a-houserabbit.pdf
160 0.01%29/Jun/05 22:23/chapters/san-diego/aboutus/bunnyfest/bunnyfest_2004.html
159 0.01%29/Jun/05 20:06/graphics/fun/netbunnies/IMG13.JPG
159 29/Jun/05 18:40/hrs-info/volunteer.html
159 0.01%29/Jun/05 18:29/translations/spanish/brochure-spanish.html
158 29/Jun/05 19:30/rabbit-center/lucky/spayed.htm
158 29/Jun/05 12:51/journal/3-8/words.html
158 29/Jun/05 20:58/care/vhd-guidelines.html
156 29/Jun/05 23:44/journal/4-7/subaru.html
156 29/Jun/05 15:36/graphics/postcard/
10 28/Jun/05 19:41  /graphics/postcard/?D=A
10 28/Jun/05 19:43  /graphics/postcard/?M=A
10 28/Jun/05 20:03  /graphics/postcard/?M=D
10 28/Jun/05 19:44  /graphics/postcard/?N=D
156 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/F&F_teapot.JPG
156 29/Jun/05 18:04/journal/3-1/graphics/wascel.gif
156 29/Jun/05 12:45/faqgerman/
156 29/Jun/05 18:04/journal/3-1/graphics/george.gif
155 29/Jun/05 18:04/journal/3-1/graphics/fifi.gif
155 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/thermometer.JPG
155 0.02%29/Jun/05 19:30/rabbit-center/lucky/images/safe-1.gif
155 29/Jun/05 20:55/rabbit-center/adoptpolicies.html
155 29/Jun/05 22:12/easter/flyer/food-not-free.jpg
154 29/Jun/05 20:06/graphics/fun/netbunnies/IMG044.JPG
154 29/Jun/05 19:57/chapters/san-diego/behavior/new_home.html
154 0.02%29/Jun/05 19:30/rabbit-center/lucky/images/safe-3.gif
153 29/Jun/05 21:13/vets/vet-list-additions.html
152 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/flying_bunny_flower_pitcher.JPG
152 29/Jun/05 14:06/journalgerman/2-12/fliegenmaden.html
151 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/zorro_dr-harvey.jpg
151 29/Jun/05 21:46/chapters/san-diego/health/vet-talk/myths.html
149 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/fairy_bird-feeder.JPG
149 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/pellet_jar.JPG
149 0.02%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/baby_bib_bunny.JPG
148 29/Jun/05 09:46/graphics/fun/netbunnies/Romeo.JPG
148 29/Jun/05 14:51/journal/3-1/sheltering-spirit.html
147 0.06%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_purse_XL_t-shirt.JPG
147 29/Jun/05 17:57/easter/kids.html
147 29/Jun/05 17:19/journal/2-6/rick-fred-pj.html
147 29/Jun/05 22:36/journal/4-5/frith.html
146 29/Jun/05 15:57/journal/3-12/fosterer-allergies.html
146 29/Jun/05 16:12/journal/3-2/drawing-blood.html
146 0.02%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Country_Art_Rabbit.JPG
146 29/Jun/05 21:26/journal/2-7/hop.html
145 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Dr-Harvey_pregnant_girls.jpg
145 29/Jun/05 19:25/rescue/resources.html
144 29/Jun/05 18:41/rabbit-center/hayward_rescue/hayward_graphics/Toby_2.JPG
144 29/Jun/05 20:23/graphics/postcard/amos.jpg
144 29/Jun/05 18:41/rabbit-center/hayward_rescue/hayward_graphics/Toby_1.JPG
143 29/Jun/05 23:10/rabbit-center/adoption-contract.rtf
143 29/Jun/05 20:46/chapters/san-diego/behavior/quiz/q10answer_false.html
142 0.01%29/Jun/05 21:33/graphics/postcard/tracy.jpg
142 29/Jun/05 14:10/journal/3-6/giving-is-recieving.html
142 29/Jun/05 22:05/journal/2-10/rabbits-on-the-road.html
142 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/charming_tails_carrot-bunny.JPG
141 29/Jun/05 21:18/faq/sections/shy.html
141 29/Jun/05 13:25/chapters/san-diego/adoption/in-house.html
141 29/Jun/05 22:42/chapters/san-diego/behavior/quiz/q1answer_false.html
140 29/Jun/05 23:00/journal/3-8/multi-maintenance.html
140 29/Jun/05 21:25/journal/3-9/chester.html
140 29/Jun/05 18:01/chapters/san-diego/behavior/graphics/looking-in-crate.gif
139 29/Jun/05 18:01/chapters/san-diego/behavior/graphics/peering-above-crate.gif
139 29/Jun/05 16:09/chapters/san-diego/aboutus/donations.html
139 29/Jun/05 18:01/chapters/san-diego/behavior/graphics/2by-crate-gate.gif
139 29/Jun/05 23:21/chapters/san-diego/adoption/supplies.html
139 29/Jun/05 23:36/rabbit-center/adoptables/graphics/big/spike-sasparilla161sml.jpg
138 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Blue_flwr_trnkt_box.JPG
138 29/Jun/05 15:47/journal/3-10/pbs.html
138 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Karen_Richard.jpg
137 29/Jun/05 23:55/hrs-info/chapterapplication.html
137 29/Jun/05 21:12/rabbit-center/adopt-procedures.html
137 29/Jun/05 17:05/chapters/san-diego/terms_use.html
137 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Liane-ko_Frankie.jpg
137 0.01%29/Jun/05 16:51/journal/3-8/graphics/plural.gif
136 29/Jun/05 23:20/chapters/san-diego/products/graphics/Caffeine_ladies-t_aqua.JPG
136 29/Jun/05 20:30/chapters/san-diego/adoption/right.html
136 29/Jun/05 20:31/rabbit-center/grooming.html
136 29/Jun/05 23:41/journal/4-7/pimpernell.html
136 29/Jun/05 13:11/chapters/san-diego/aboutus/volunteer_ops.html
135 29/Jun/05 12:33/journal/warren-wise/new-chapter.html
135 29/Jun/05 01:37/journal/3-9/diners-beware.html
135 30/Jun/05 00:02/links/sections/books-fiction.html
135 29/Jun/05 19:59/journal/3-7/graphics/snake-bite-bunny.gif
135 29/Jun/05 13:32/journal/3-8/pound.html
135 0.02%29/Jun/05 22:13/easter/flyer/childstory.pdf
135 29/Jun/05 01:37/journal/2-11/dont-call-me-kind.html
135 29/Jun/05 21:56/easter/link.html
135 0.01%29/Jun/05 19:31/rabbit-center/lucky/images/lucky20ondock_000.jpg
134 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Francine_dr-harvey.jpg
134 29/Jun/05 05:01/hrs-info/whats-new-archive97.html
134 29/Jun/05 21:48/chapters/san-diego/behavior/grief.html
133 29/Jun/05 22:25/fun/answer6.html
133 29/Jun/05 13:55/chapters/san-diego/behavior/quiz/q8answer_true.html
133 29/Jun/05 23:07/translations/japanese/spay-neuter-j.txt
133 0.01%29/Jun/05 19:14/faq/sections/orphan-old.html
132 0.01%29/Jun/05 19:31/rabbit-center/lucky/images/abusersondock_000.jpg
132 0.01%29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/animal_place_girls_emerge.jpg
132 29/Jun/05 17:31/graphics/links/
131 0.09%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny-stamp_pin.JPG
131 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_bank_2.JPG
131 29/Jun/05 19:59/journal/3-7/graphics/necrotic-tissue.gif
131 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/charmingtails_photo_frame.JPG
131 29/Jun/05 16:28/hrs-info/vet-conference/
130 29/Jun/05 13:57/spam_vaccine/mailto.gif
130 29/Jun/05 23:20/chapters/san-diego/products/graphics/Abbys_Rose_peach.JPG
130 29/Jun/05 18:24/hrs-info/whats-new-archive98.html
130 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/zen_bunny.JPG
130 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Frankie_dr-harvey.jpg
130 0.02%21/Jun/05 19:57/chapters/san-diego/adoption/Adoption_Photos/HRS_Stewart_1_Feb05.jpg
129 29/Jun/05 19:59/journal/3-7/graphics/bunny-w-bandage.gif
129 29/Jun/05 23:30/hrs-info/supporting.html
129 28/Jun/05 20:58/journal/3-4/kids-program.html
129 29/Jun/05 19:59/journal/3-7/graphics/recovered.gif
129 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Samantha_dr-harvey.jpg
128 29/Jun/05 20:07/rabbit-center/retail/cubesetS.jpg
128 0.01%29/Jun/05 23:20/chapters/san-diego/products/graphics/Rabbit_house_babydoll_tshirt.jpg
128 29/Jun/05 20:42/chapters/san-diego/adoption/pdf_icon.gif
128 0.01%29/Jun/05 19:30/rabbit-center/lucky/images/spayed-3.gif
128 0.01%29/Jun/05 14:22/graphics/mine/zippy1.jpg
128 0.01%29/Jun/05 23:26/rabbit-center/adoptables/graphics/big/fred r1412-09sml.jpg
128 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/flowerpot_white_tshirt.JPG
128 29/Jun/05 23:20/chapters/san-diego/products/graphics/Established_t_ls_green.JPG
128 29/Jun/05 20:10/graphics/fun/netbunnies/MRBIG01.JPG
128 29/Jun/05 14:21/rabbit-center/graphics/icon_links.gif
128 29/Jun/05 23:20/chapters/san-diego/products/graphics/Herman_baseball_jersey.jpg
128 29/Jun/05 20:07/rabbit-center/retail/lrgcageS.jpg
128 29/Jun/05 20:10/graphics/fun/netbunnies/MVC-016S.JPG
127 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/pet_photo_book.JPG
127 29/Jun/05 23:20/chapters/san-diego/products/graphics/Established_t_wht_ss.JPG
127 0.01%29/Jun/05 19:30/rabbit-center/lucky/images/spayed-1.gif
127 29/Jun/05 13:38/easter/help.html
127 29/Jun/05 13:55/chapters/san-diego/behavior/quiz/q6answer_false.html
127 29/Jun/05 23:20/chapters/san-diego/products/graphics/Herman_jr-raglan_tee.jpg
127 29/Jun/05 12:12/links/sections/stories-rabbits-tell.html
127 0.01%29/Jun/05 19:30/rabbit-center/lucky/images/spayed-2.gif
127 29/Jun/05 23:20/chapters/san-diego/products/graphics/Caffeine_beefy-t_purple.JPG
126 29/Jun/05 21:05/journal/3-2/graphics/disabled-2.gif
126 29/Jun/05 23:08/rabbit-center/lucky/sf-crronicle.htm
126 29/Jun/05 23:20/chapters/san-diego/products/graphics/ladies-t_clock_ylw-blu_2.JPG
126 29/Jun/05 21:05/journal/3-2/graphics/disabled-1.gif
126 29/Jun/05 14:01/chapters/oakland/oldbun.html
125 0.01%29/Jun/05 23:20/chapters/san-diego/products/graphics/grey_clock_tshirt_small.gif
125 29/Jun/05 21:17/journal/3-10/overgrooming.html
125 0.01%29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Cadbury_2_19May05.jpg
125 0.01%29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/animal_place_chk-out_new_buns.jpg
125 29/Jun/05 21:20/rabbit-center/hayward_rescue/hayward_rabbits_spay-neuter.html
125 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_placemat_bowl.JPG
125 29/Jun/05 23:20/chapters/san-diego/products/graphics/Herman_ash_grey.jpg
124 29/Jun/05 23:39/graphics/awards/
10 28/Jun/05 19:32  /graphics/awards/?M=A
10 28/Jun/05 19:33  /graphics/awards/?N=D
124 0.02%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/metal_platter.JPG
124 29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_rabbits_eileen.html
124 29/Jun/05 20:09/graphics/fun/netbunnies/Lupsu_nolo.bmp
124 29/Jun/05 23:20/chapters/san-diego/products/graphics/mens-t_clock_ylw_blu.JPG
124 30/Jun/05 00:00/hrs-info/whats-new-archive04.html
124 0.01%29/Jun/05 20:13/graphics/fun/netbunnies/Nibbel3.JPG
124 29/Jun/05 16:58/journal/3-4/daycare.html
124 29/Jun/05 20:10/graphics/fun/netbunnies/MVC-011S.JPG
124 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/blanket_purse.JPG
124 29/Jun/05 16:16/rabbit-center/hayward_rescue/hayward_rabbits_play-areas.html
123 29/Jun/05 18:41/rabbit-center/hayward_rescue/hayward_rabbits_one-group.html
123 29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/clip_image012.jpg
123 29/Jun/05 20:28/opinion/cruelty-case.html
123 29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/clip_image010.jpg
122 29/Jun/05 22:33/journal/4-5/ode.html
122 29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/animal_place_prana-move.jpg
122 0.01%29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/pen_redesign.jpg
121 29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Cody_1_20Jun05.jpg
121 29/Jun/05 19:45/chapters/san-diego/products/books.html
121 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/finishing_pens.jpg
121 29/Jun/05 18:34/rabbit-center/news_release/index_clip_image002.jpg
121 0.01%29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/animal_place_lemonade_rita.jpg
121 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/lenox_rabbit_cky-jar.jpg
121 29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Angel1_Jun05.jpg
121 29/Jun/05 17:12/hrs-info/benefits.html
121 29/Jun/05 08:20/hrs-info/whats-new-archive01.html
120 29/Jun/05 23:33/journal/2-7/whos-the-pet.html
119 21/Jun/05 19:55/chapters/san-diego/adoption/Adoption_Photos/HRS_Cherokee_Apr05.jpg
119 0.01%29/Jun/05 22:17/rabbit-center/adoptables/graphics/big/baloo-sml.jpg
119 29/Jun/05 19:45/chapters/san-diego/products/accessories.html
119 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Play_structures_installed.jpg
119 0.04%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/cutting_board.JPG
118 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/F&F_salt-pepper.JPG
118 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/japanese_bowls.JPG
118 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Pam-m_Frankie.jpg
118 29/Jun/05 22:45/chapters/san-diego/behavior/litterbox.html
118 29/Jun/05 22:58/journal/3-8/yard-sale-bunny.html
118 29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_DallasRandi1_Jun05.jpg
118 29/Jun/05 07:18/hrs-info/whats-new-archive00.html
117 29/Jun/05 19:34/rabbit-center/lucky/letter-from.htm
117 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Nancy-J_rabbit-back.jpg
117 29/Jun/05 16:46/fun/answer11.html
117 29/Jun/05 20:08/graphics/fun/netbunnies/Lau2.jpjg
117 0.01%29/Jun/05 21:16/graphics/postcard/izzy-portrait-crop.jpg
116 29/Jun/05 16:57/journal/3-2/geriatric.html
116 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Robin_Julie_best-friends.jpg
116 29/Jun/05 23:08/translations/japanese/digestibility-j.txt
116 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/rain_gauge.JPG
116 0.01%29/Jun/05 21:46/help/toc-url.html
116 29/Jun/05 22:28/fun/answer5.html
116 29/Jun/05 16:10/chapters/michigan/jeremy2a.jpg
116 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Kerry_s_frankie.jpg
115 29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/animal_place_sam_rita.jpg
115 29/Jun/05 19:53/journal/1/books.html
115 29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/animal_place_new_girl.jpg
115 29/Jun/05 18:40/rabbit-center/hayward_rescue/hayward_graphics/johanna_medical_exam.JPG
115 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_rabbits_adoption.html
115 29/Jun/05 20:43/links/zowie.html
114 29/Jun/05 19:01/rabbit-center/hayward_rescue/hayward_rabbits_letter_writing.html
114 29/Jun/05 20:10/graphics/fun/netbunnies/MVC-018F.JPG
114 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Karen_J_Danny.jpg
114 29/Jun/05 20:10/graphics/fun/netbunnies/MVC-015S.JPG
114 29/Jun/05 23:06/translations/japanese/amoxicillin-warning-j.txt
114 29/Jun/05 23:20/chapters/san-diego/adoption/bunny_bonding.html
114 29/Jun/05 20:11/graphics/fun/netbunnies/MVC-029S.JPG
113 29/Jun/05 20:53/journal/4-3/finders-keepers.html
113 28/Jun/05 23:23/links/sections/
15 28/Jun/05 20:52  /links/sections/?N=A
15 28/Jun/05 23:23  /links/sections/?M=D
15 28/Jun/05 23:12  /links/sections/?N=D
14 28/Jun/05 23:02  /links/sections/?D=D
10 28/Jun/05 19:40  /links/sections/?S=A
10 27/Jun/05 12:50  /links/sections/?D=A
10 27/Jun/05 20:04  /links/sections/?M=A
113 28/Jun/05 17:10/rabbit-center/hayward_rescue/hayward_rabbits_toby.html
113 29/Jun/05 20:49/cgi-bin/chat/stream.cgi
17 29/Jun/05 20:49  /cgi-bin/chat/stream.cgi?action=stream&id=icrgawmdbblefozlijasryidawpvot&pause=
13  5/Jun/05 20:01  /cgi-bin/chat/stream.cgi?action=stream&id=zxrhzgtlaqtstxddaayqojvctfjkfs&pause=
11  6/Jun/05 19:47  /cgi-bin/chat/stream.cgi?action=stream&id=ohjabgbaoupfnfidrrjpdfrapbmkkl&pause=
113 0.02%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/big_grey_bunny.JPG
113 29/Jun/05 16:10/chapters/michigan/banner.gif
113 29/Jun/05 19:15/fun/answer12.html
113 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Kelly_s_Zorro.jpg
113 29/Jun/05 19:50/journal/3-2/foot-problems.html
113 29/Jun/05 04:06/hrs-info/whats-new-archive03.html
113 29/Jun/05 19:48/hrs-info/vet-conference/vetcon.gif
113 29/Jun/05 16:09/journal/3-3/life-worthy.html
112 29/Jun/05 15:50/journal/3-9/you-never-know.html
112 29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/animal_place_sam_boy.jpg
112 0.01%29/Jun/05 18:41/rabbit-center/hayward_rescue/hayward_graphics/tt_6.JPG
112 29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/animal_place_bunny_temple2.jpg
112 0.01%29/Jun/05 12:37/graphics/mine/foo33.jpg
112 29/Jun/05 12:34/hrs-info/web.html
112 0.03%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bedtime_story_bunny.JPG
111 29/Jun/05 15:10/journal/3-11/letters.html
111 0.01%29/Jun/05 18:41/rabbit-center/hayward_rescue/hayward_graphics/tt_5.JPG
111 29/Jun/05 12:47/translations/portugese/baby-myths.html
111 29/Jun/05 20:14/graphics/fun/netbunnies/Perla.JPG
111 0.01%29/Jun/05 18:41/rabbit-center/hayward_rescue/hayward_graphics/toby_ramp.JPG
111 29/Jun/05 18:41/rabbit-center/hayward_rescue/hayward_graphics/tt_1.JPG
111 29/Jun/05 21:16/graphics/postcard/tabatha.jpg
111 29/Jun/05 18:41/rabbit-center/hayward_rescue/hayward_graphics/tt-3.JPG
111 0.01%29/Jun/05 14:22/graphics/mine/emmybunny.jpg
110 29/Jun/05 18:41/rabbit-center/hayward_rescue/hayward_graphics/tt_3.JPG
110 29/Jun/05 23:35/rabbit-center/retail/treats.html
110 29/Jun/05 17:46/rabbit-center/hayward_rescue/hayward_rabbits_district_attny.html
110 29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/animal_place_varina_goat.jpg
110 0.01%29/Jun/05 18:41/rabbit-center/hayward_rescue/hayward_graphics/tt_2.JPG
110 29/Jun/05 13:49/chapters/san-diego/health/hotline.html
109 29/Jun/05 23:44/graphics/gallery/
11 28/Jun/05 20:36  /graphics/gallery/?N=D
10 28/Jun/05 20:34  /graphics/gallery/?D=A
109 29/Jun/05 16:23/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Brown-eyed_bun.JPG
109 29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/animal_place_regulars1.jpg
109 0.01%29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/bunny_every_lap.jpg
109 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Christine_M_Lance.jpg
109 29/Jun/05 11:58/health/frontline.html
108 0.01%29/Jun/05 14:56/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Cybis_Bunny_Bottom.JPG
108 29/Jun/05 18:40/graphics/resources/
16 29/Jun/05 12:50  /graphics/resources/?M=A
11 29/Jun/05 12:47  /graphics/resources/?S=A
11 29/Jun/05 12:53  /graphics/resources/?N=D
10 29/Jun/05 12:44  /graphics/resources/?D=A
108 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Justus_p_baxter.jpg
108 29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/animal_place_kibblefest_1.jpg
108 0.01%29/Jun/05 13:02/graphics/postcard/Rab1.jpg
108 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/hilltop_house_souvenirs.JPG
108 29/Jun/05 19:26/care/vets-bay-area.html
108 29/Jun/05 16:38/rabbit-center/hayward_rescue/hayward_graphics/hayward4.jpg
108 29/Jun/05 12:39/rabbit-center/adoptables/graphics/big/R705 Java 47 sml.jpg
107 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Terry-L-Sombra.jpg
107 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/basket_candles.JPG
107 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/diane_wat_t-shirt.JPG
107 29/Jun/05 19:04/chapters/michigan/corey8.jpg
107 0.02%29/Jun/05 15:31/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Royal_Doulton_Bunnykins_HighRes.jpg
106 29/Jun/05 23:37/rabbit-center/adoptables/graphics/big/r835heidi25sml.jpg
106 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Pam-M-michael_stroll.jpg
106 29/Jun/05 15:35/graphics/banners/
12 29/Jun/05 05:26  /graphics/banners/?D=A
12 29/Jun/05 13:55  /graphics/banners/?M=A
12 28/Jun/05 04:10  /graphics/banners/?N=D
106 29/Jun/05 16:38/rabbit-center/hayward_rescue/hayward_graphics/hayward1.jpg
106 29/Jun/05 15:29/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Cybis_Bunny_Snowball_front.JPG
106 29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/clip_image002.jpg
106 29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/animal_place_new_arrivals2.jpg
105 29/Jun/05 15:19/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Business_card_holder.JPG
105 29/Jun/05 16:38/rabbit-center/hayward_rescue/hayward_graphics/hayward2.jpg
105 29/Jun/05 18:40/rabbit-center/hayward_rescue/hayward_graphics/johanna_growth.JPG
105 29/Jun/05 19:04/chapters/michigan/acb10.jpg
105 29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/animal_place_lemonade3.jpg
105 29/Jun/05 11:40/journal/2-5/community-ed.html
105 29/Jun/05 16:38/rabbit-center/hayward_rescue/hayward_graphics/hayward3.jpg
105 0.01%29/Jun/05 18:40/rabbit-center/hayward_rescue/hayward_graphics/johanna_shelter.JPG
105 29/Jun/05 16:22/journal/warren-wise/hot-weather.html
104 29/Jun/05 18:29/translations/dutch/blaasontsteking-en-blaasstenen-bij-het-konijn.html
104 29/Jun/05 19:43/journal/2-7/power-plays.html
104 29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/animal_place_varina.jpg
104 29/Jun/05 18:52/journal/3-7/graphics/sleeping-in-desk.gif
104 29/Jun/05 11:44/hrs-info/survey.html
104 29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/animal_place_lemonade_girl.jpg
104 29/Jun/05 21:48/graphics/index/
10 29/Jun/05 21:48  /graphics/index/?N=A
104 29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/animal_place_toe_cleaning.jpg
104 29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/animal_place_kibblefest_2.jpg
103 29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/animal_place_sam1.jpg
103 29/Jun/05 13:24/rabbit-center/graphics/icon_involvedpage.gif
103 29/Jun/05 00:39/rabbit-center/lucky/letter-to.htm
103 29/Jun/05 19:04/chapters/michigan/lilly6.jpg
103 28/Jun/05 19:46/graphics/mine/fripouille.html
103 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Yuri_Ito_Benton.jpg
103 29/Jun/05 19:04/chapters/michigan/cdez11.jpg
103 29/Jun/05 16:35/journal/3-3/soft-stool.html
103 29/Jun/05 13:59/chapters/san-francisco/docs.html
102 29/Jun/05 02:28/chapters/san-diego/products/coloring_book.html
102 29/Jun/05 14:08/rabbit-center/lucky/letters_to_judge.htm
102 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/two_pins.jpg
102 0.01%29/Jun/05 18:40/rabbit-center/hayward_rescue/hayward_graphics/Zorro_testicle-growth.JPG
102 29/Jun/05 19:04/chapters/michigan/milo6.jpg
102 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/baby_jumper.JPG
102 0.01%29/Jun/05 18:40/rabbit-center/hayward_rescue/hayward_graphics/johanna_better_now.JPG
102 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/hay-rack.jpg
101 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/tapestry_pillow.JPG
101 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/bunnQA.jpg
101 29/Jun/05 16:04/journal/3-4/togetherness.html
101 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/kids_writing_basket.JPG
101 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/space_rabbit_poster.JPG
101 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/resin_plaque.JPG
101 29/Jun/05 15:47/hrs-info/how-donations-are-used.html
101 0.02%29/Jun/05 15:18/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Danko_Bunny_Collectibles.JPG
101 0.01%29/Jun/05 15:28/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Royal_Doulton_Bunnykins_bottom.JPG
101 29/Jun/05 11:41/graphics/thumbnails/
10 27/Jun/05 18:05  /graphics/thumbnails/?S=A
10 29/Jun/05 11:41  /graphics/thumbnails/?D=A
101 0.01%29/Jun/05 20:46/chapters/san-diego/adoption/Easter/Rabbits_and_Children.html
100 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Kelle_k_Benton.jpg
100 0.01%29/Jun/05 18:52/journal/3-7/graphics/bunnys-w-toys.gif
100 29/Jun/05 19:04/chapters/michigan/jason4.jpg
100 29/Jun/05 19:04/chapters/michigan/spot3.jpg
100 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/rustic_candle_holders.JPG
100 29/Jun/05 19:05/chapters/michigan/boo1.jpg
100 29/Jun/05 21:59/chapters/san-diego/aboutus/find_out_more.html
100 29/Jun/05 18:04/journal/3-5/toxoplasmosis.html
100 29/Jun/05 19:04/chapters/michigan/sarah2.jpg
100 29/Jun/05 19:05/chapters/michigan/mtz1.jpg
100 29/Jun/05 19:04/chapters/michigan/luke10.jpg
99 0.01%29/Jun/05 23:36/rabbit-center/adoptables/graphics/big/basil46sml.jpg
99 29/Jun/05 18:40/rabbit-center/hayward_rescue/hayward_graphics/Zorro_mask.JPG
99 29/Jun/05 09:48/graphics/fun/netbunnies/Sugaree-Bigwig.JPG
99 29/Jun/05 22:37/care/vets_tennessee.html
99 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/angel_bunny.JPG
99 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/rustic_ceramic_bunny.JPG
99 29/Jun/05 09:20/faqgerman/sections/spielzeug.html
99 29/Jun/05 22:08/graphics/mine/foo/6-licking.jpg
99 0.01%29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/eileen_page_bottom.jpg
99 0.06%29/Jun/05 02:00/hrs-info/stats/all.html
99 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/furniture_feet.JPG
98 0.01%29/Jun/05 13:45/graphics/calendars/0763149349_b.jpg
98 29/Jun/05 02:01/hrs-info/whats-new-archive96.html
98 0.02%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_pin.JPG
98 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Kerry_S_Janet.jpg
98 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Carol_S_bunny_lap.jpg
98 29/Jun/05 18:40/rabbit-center/hayward_rescue/hayward_graphics/Zorro_w-Karen.JPG
98 0.01%29/Jun/05 22:16/rabbit-center/buddy/images/buddy1.gif
98 29/Jun/05 22:55/journal/4-4/paul-bloom.html
98 29/Jun/05 22:17/rabbit-center/buddy/images/buddy-traced.gif
98 0.01%29/Jun/05 22:17/rabbit-center/buddy/images/buddy2.gif
98 29/Jun/05 18:40/rabbit-center/hayward_rescue/hayward_graphics/happy_johanna.JPG
97 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Carol_S_Jeanne_S_ttouch.jpg
97 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Jeanne_S_bunny_lap.jpg
97 29/Jun/05 13:21/chapters/san-diego/adoption/Adoption_Photos/HA_Jemma_Mar05.jpg
97 0.01%29/Jun/05 18:40/rabbit-center/hayward_rescue/hayward_graphics/Micheal_w-boys.JPG
97 29/Jun/05 23:08/translations/japanese/fiber-j.txt
97 29/Jun/05 19:04/chapters/michigan/ellie2.jpg
97 29/Jun/05 22:16/rabbit-center/buddy/images/garbera3.gif
96 29/Jun/05 01:44/graphics/hrs-rabbits/
10 27/Jun/05 18:05  /graphics/hrs-rabbits/?N=D
96 29/Jun/05 23:54/rabbit-center/retail/toys.html
96 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/styupark_book.JPG
96 0.01%29/Jun/05 18:40/rabbit-center/hayward_rescue/hayward_graphics/Michael_Karen.JPG
96 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/year_of_rabbit.JPG
96 29/Jun/05 14:39/chapters/san-diego/adoption/Adoption_Photos/Lacey_happy_adoption_Feb05.jpg
96 29/Jun/05 07:37/journal/3-7/graphics/rescue-pen.gif
96 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/votive_cndl_watering-can.JPG
96 29/Jun/05 14:00/chapters/san-diego/adoption/Adoption_Photos/Brandy_adoption_Feb05.jpg
96 0.01%29/Jun/05 07:38/journal/3-7/graphics/rescue-group.gif
96 29/Jun/05 21:00/journal/warren-wise/grooming-table.html
96 29/Jun/05 14:21/rabbit-center/hayward_rescue/hayward_rabbits_media_coverage.html
95 29/Jun/05 13:51/chapters/san-diego/adoption/Adoption_Photos/Lacey_adoption_2_Feb05.jpg
95 29/Jun/05 14:41/chapters/san-diego/adoption/Adoption_Photos/Donovan_adoption_composite.jpg
95 29/Jun/05 04:06/hrs-info/whats-new-archive02.html
95 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_bird_house.JPG
95 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Kelle_K_boys_driveway_2.jpg
95 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/alpaca_bunny.JPG
95 29/Jun/05 14:42/graphics/fun/netbunnies/The Secret
95 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/white_collectible_bunny.JPG
95 0.01%29/Jun/05 18:40/rabbit-center/hayward_rescue/hayward_graphics/Michael_abscess.JPG
95 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/key_rack.jpg
95 0.02%29/Jun/05 13:49/chapters/san-diego/adoption/Adoption_Photos/Starr_adoption_23Jan05.jpg
94 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/blanket_rattle-bunny.JPG
94 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_pillow_sz-chart.JPG
94 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/2-bunny_creamers.JPG
94 29/Jun/05 02:18/hrs-info/whats-new-archive99.html
94 21/Jun/05 19:55/chapters/san-diego/adoption/Adoption_Photos/HA_Gracie-Star_Mar05.jpg
94 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_blanket_peter.JPG
94 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Justus_Sam.jpg
94 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/wood_door_hanger.JPG
94 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Southwest_bunny_pins.jpg
94 0.02%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/garden_stakes.JPG
94 28/Jun/05 22:37/translations/spanish/rescue-spanish.html
94 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/photo_bracelet.JPG
94 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Kelle_K_Bernie.jpg
94 29/Jun/05 14:40/chapters/san-diego/adoption/Adoption_Photos/HRS_Harley_adoption_12Feb05.jpg
93 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Terry-L_Sombra_nail-trim.jpg
93 29/Jun/05 21:54/hrs-info/awards.html
93 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/jodi_jensen_print.JPG
93 29/Jun/05 07:01/faqgerman/sections/ernaehrung.html
93 29/Jun/05 22:20/graphics/shelter/
11 28/Jun/05 19:34  /graphics/shelter/?D=A
10 29/Jun/05 22:20  /graphics/shelter/?M=A
93 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/carrot_trivet.JPG
93 29/Jun/05 07:37/journal/3-7/graphics/woman-w-bunny.gif
93 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/powder_room_bunny.JPG
93 29/Jun/05 19:48/hrs-info/vet-conference/original-brochure.html
93 29/Jun/05 11:14/rabbit-center/hurt-rabbit.html
93 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/white_bunny_cookie-jar.JPG
93 0.01%29/Jun/05 17:10/hrs-info/volunteerapp.doc
93 29/Jun/05 14:25/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Rice_bowls.JPG
92 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/white_casserole.JPG
92 29/Jun/05 23:21/chapters/san-diego/adoption/take_home.html
92 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Karen_J_Janet.jpg
92 29/Jun/05 19:12/fun/answer8.html
92 29/Jun/05 13:46/graphics/misc/
13 29/Jun/05 12:29  /graphics/misc/?N=D
10 28/Jun/05 19:24  /graphics/misc/?S=A
92 29/Jun/05 23:35/rabbit-center/adoptables/images/lily_big.jpg
92 29/Jun/05 22:52/journal/3-11/radiologist.html
92 29/Jun/05 15:16/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Natures_children_plate.JPG
92 29/Jun/05 11:14/journal/3-6/soft-stool-no-veggies.html
92 29/Jun/05 14:27/fun/answer4.html
92 29/Jun/05 23:45/journal/3-7/program.html
92 28/Jun/05 22:09/faqgerman/sections/kinder.html
91 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/white_trinket_box.JPG
91 29/Jun/05 09:24/faqgerman/sections/gefahren.html
91 29/Jun/05 14:24/graphics/mine/foo/8-zowie-holiday-inn.jpg
91 29/Jun/05 22:51/rabbit-center/adoptables/graphics/big/luke3-r1396-47sml.jpg
91 28/Jun/05 17:25/graphics/fun/netbunnies/cookie.gif
91 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_soap_dish.JPG
91 29/Jun/05 22:42/care/vets_svirginia.html
91 29/Jun/05 23:37/rabbit-center/adoptables/graphics/big/r834hayley11sml.jpg
91 29/Jun/05 23:52/translations/dutch/
91 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/brn_bunny_photo_album.JPG
90 29/Jun/05 23:13/graphics/books/
90 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/grey_stuffed_bunny.JPG
90 29/Jun/05 17:10/chapters/oregon/sanctuary.html
90 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/welcome_sign.JPG
90 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Aimee_R_Zorro.jpg
90 29/Jun/05 12:49/journal/submissions.html
90 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/olympic_bobblehead.JPG
90 29/Jun/05 14:28/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Baby_Lamp.JPG
90 29/Jun/05 11:41/rabbit-center/hayward_rescue/hayward_rabbits_cruelty_report.html
90 0.01%29/Jun/05 15:38/graphics/postcard/strawberry-white-baby.jpg
90 0.01%29/Jun/05 23:39/graphics/adopt-a-highway.jpg
90 29/Jun/05 10:07/rabbit-center/header.gif
89 30/Jun/05 00:04/rabbit-center/retail/guinea.html
89 29/Jun/05 15:34/graphics/store/
11 28/Jun/05 19:40  /graphics/store/?D=A
11 28/Jun/05 19:39  /graphics/store/?M=A
89 29/Jun/05 10:30/graphics/fun/netbunnies/att00218.jpeg
89 0.01%29/Jun/05 22:17/rabbit-center/adoptables/P2050012med.jpg
89 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Phyllis_Lance.jpg
89 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Sombra_dr-harvey_hypno.jpg
89 29/Jun/05 12:18/chapters/oregon/adoption.html
89 29/Jun/05 11:36/health/database.html
89 29/Jun/05 14:54/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Ricker_wine_goblet.jpg
89 28/Jun/05 23:31/journal/3-1/a-hare-about-the-house.html
88 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Kerry_S_Lewis.jpg
88 29/Jun/05 16:39/journal/about.html
88 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Rug_lotion.jpg
88 29/Jun/05 23:07/translations/japanese/incisors-j.txt
88 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Olga_dr-harvey.jpg
88 0.03%29/Jun/05 22:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/placemats_napking-rings.JPG
88 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/welcome_sign_2.JPG
88 29/Jun/05 23:47/chapters/oakland/
88 29/Jun/05 15:27/rabbit-center/hayward_rescue/hayward_graphics/Michael_dr-harvey_1.jpg
88 29/Jun/05 23:07/translations/japanese/haydiet-j.txt
88 29/Jun/05 16:33/press-kit/easter-press-release.html
88 0.01%29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/shiny_bunny_box.JPG
88 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/stuffed_bunny_carrier.JPG
88 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/brn_bunny_puzzle.jpg
87 29/Jun/05 19:56/chapters/san-diego/products/jewelry.html
87 29/Jun/05 14:54/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Salad_quiche_set.JPG
87 29/Jun/05 09:50/graphics/fun/netbunnies/Twilight.gif
87 28/Jun/05 20:24/chapters/oregon/supplies.html
87 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_plaque.JPG
87 29/Jun/05 17:44/chapters/oregon/vets.html
87 29/Jun/05 23:57/rabbit-center/retail/bags.html
87 29/Jun/05 14:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Grey_bunny-in-arms.JPG
87 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/easter_tea_set.JPG
87 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/rustic_rabbit_w-heart.JPG
86 28/Jun/05 18:02/graphics/mine/phil/
11 28/Jun/05 05:28  /graphics/mine/phil/?D=A
11 28/Jun/05 16:01  /graphics/mine/phil/?M=A
11 28/Jun/05 05:30  /graphics/mine/phil/?N=D
86 29/Jun/05 20:06/rabbit-center/graphics/adopt-t.gif
86 29/Jun/05 07:36/graphics/thanks/
86 29/Jun/05 14:58/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Barfoot_Drawing.JPG
86 28/Jun/05 14:42/journal/4-5/doors-open.html
86 29/Jun/05 20:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/pink_nesting_rabbit.JPG
85 29/Jun/05 14:54/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Silver_bracelet.jpg
85 29/Jun/05 17:55/chapters/san-diego/health/laser_surgery.html
85 0.01%29/Jun/05 09:46/rabbit-center/updates/images/snowflake_000.jpg
85 0.01%29/Jun/05 22:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Abbys_rose_framed.JPG
85 29/Jun/05 14:28/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bochy_photo.JPG
85 29/Jun/05 16:33/journal/3-1/cold-tempeatures.html
85 0.02%29/Jun/05 07:34/rabbit-center/updates/images/bucky.jpg
84 29/Jun/05 06:12/chapters/san-francisco/overlooked.html
84 29/Jun/05 14:21/fun/answer10.html
84 29/Jun/05 19:19/icons/text.gif
84 29/Jun/05 23:44/rabbit-center/retail/food.html
84 29/Jun/05 06:49/journal/3-11/
84 29/Jun/05 10:40/graphics/fun/netbunnies/bunny.bmp
83 29/Jun/05 22:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/F&F_canape_platter.JPG
83 29/Jun/05 23:07/translations/japanese/emergencies-j.txt
82 28/Jun/05 23:34/journal/2-7/permanence.html
82 29/Jun/05 15:19/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Blue_Lattice_flwrd_vase.JPG
82 28/Jun/05 12:45/chapters/san-diego/diet/guide.html
82 29/Jun/05 19:45/chapters/san-diego/products/graphics/Caps_navy_black.JPG
82 29/Jun/05 19:45/chapters/san-diego/products/graphics/Herman_grooming_apron.jpg
82 29/Jun/05 19:45/chapters/san-diego/products/graphics/tote_back.jpg
82 29/Jun/05 19:45/chapters/san-diego/products/graphics/Caps_khaki_stone_carrot.JPG
82 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/auction_photos.html
82 29/Jun/05 23:06/translations/japanese/bibliography-j.txt
82 29/Jun/05 19:45/chapters/san-diego/products/graphics/tote-front.jpg
82 29/Jun/05 19:45/chapters/san-diego/products/graphics/Caps_black_stone_navy.JPG
82 29/Jun/05 12:07/fun/reader-photos2.html
82 29/Jun/05 21:41/chapters/oakland/hall.html
82 29/Jun/05 22:21/chapters/san-diego/behavior/quiz/q1answer_true.html
81 29/Jun/05 19:40/chapters/oakland/bladder.html
81 28/Jun/05 23:01/journal/3-8/disaster-preparedness.html
81 29/Jun/05 23:38/rabbit-center/retail/carry.html
81 29/Jun/05 22:45/chapters/san-diego/behavior/graphics/litterbox_after.jpg
81 29/Jun/05 19:50/journal/warren-wise/eulogies.html
80 29/Jun/05 22:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Harmony_Kingomd_TJ.jpg
80 29/Jun/05 18:25/journal/3-11/burn-out.html
80 29/Jun/05 14:56/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Chargers_Jersey.JPG
80 0.01%29/Jun/05 15:28/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Primitive Bunny & Box.JPG
80 29/Jun/05 09:48/graphics/fun/netbunnies/Spencer-Bianca.JPG
80 29/Jun/05 01:30/journal/donations.html
80 29/Jun/05 22:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/white_resin_bunnies.JPG
80 29/Jun/05 14:47/chapters/san-diego/aboutus/bunnyfest/bunnyfest_2003_photos.html
80 29/Jun/05 14:05/graphics/fun/netbunnies/blond-3.tif
80 29/Jun/05 22:45/chapters/san-diego/behavior/graphics/litterbox_before.jpg
80 28/Jun/05 13:41/chapters/san-diego/aboutus/volunteer_handout.html
80 29/Jun/05 14:23/graphics/mine/foo/2-pumpkin-foo.jpg
79 29/Jun/05 21:48/care/vets_hawaii.html
79 29/Jun/05 14:58/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Alabaster_bunny.JPG
79 29/Jun/05 13:01/chapters/san-francisco/bunny-butt.gif
79 29/Jun/05 23:00/journal/3-8/graphics/multi.gif
79 29/Jun/05 21:48/graphics/homepage/
79 29/Jun/05 21:27/chapters/oakland/hurtshop.html
79 29/Jun/05 21:40/chapters/san-diego/aboutus/bunnyfest/bunnyfest_2001_photos.html
79 29/Jun/05 03:07/faqgerman/sections/draussen.html
79 29/Jun/05 14:55/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Japanese_teapot.JPG
78 29/Jun/05 23:00/journal/3-8/graphics/dexter.gif
78 29/Jun/05 22:17/graphics/mine/foo/gifs/
78 28/Jun/05 23:55/chapters/oregon/newsletter.html
78 29/Jun/05 11:25/care/holidays.html
78 29/Jun/05 22:29/care/vets-uncovered-regions.txt
78 29/Jun/05 15:55/journal/3-6/making-a-difference.html
78 28/Jun/05 21:29/chapters/san-diego/aboutus/whoweare.html
78 29/Jun/05 06:44/journal/2-11/willingly-useful.html
77 29/Jun/05 22:42/care/vets_louisiana.html
77 29/Jun/05 14:27/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Easter_Bell.JPG
77 29/Jun/05 15:28/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Rosie_rabbit_Franklin-mint.JPG
77 29/Jun/05 11:36/easter/thanks.html
77 29/Jun/05 17:06/journal/3-11/ww.html
77 29/Jun/05 23:08/translations/japanese/bladder-stones-j.txt
77 29/Jun/05 09:14/chapters/san-diego/adoption/right_rabbit.html
76 29/Jun/05 23:29/rabbit-center/retail/care.html
76 29/Jun/05 23:41/rabbit-center/retail/hay.html
76 29/Jun/05 15:29/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Garden_Bunnies_Wall_Hanging.JPG
76 29/Jun/05 15:32/graphics/10.gif
75 28/Jun/05 07:57/faqgerman/sections/tierarzt.html
75 29/Jun/05 11:14/rabbit-center/lucky/PETA.htm
75 29/Jun/05 23:07/translations/japanese/eye-problems-j.txt
75 29/Jun/05 13:30/graphics/books/amazon.gif
75 29/Jun/05 16:12/fun/izzy-zowie/lisa-t.jpg
75 29/Jun/05 13:30/graphics/books/mitten.gif
75 29/Jun/05 14:55/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Rabbit_Pitcher_2.JPG
75 29/Jun/05 23:22/care/emergency-planning.html
75 29/Jun/05 08:59/faqgerman/sections/zusammenfuehrung.html
74 0.01%29/Jun/05 23:27/rabbit-center/adoptables/graphics/thumb/
74 29/Jun/05 20:04/journal/1/bunnymoon.html
74 29/Jun/05 22:57/easter/hidden-egg.html
74 29/Jun/05 16:09/journal/3-3/rescuers-worst-nightmare.html
74 29/Jun/05 22:17/rabbit-center/adoptables/graphics/big/tia r1409 06sml.jpg
74 29/Jun/05 11:40/caregerman/
74 29/Jun/05 21:25/journal/3-9/graphics/lop-eating-hay.gif
74 29/Jun/05 15:41/rabbit-center/lucky/release_adopted.htm
73 29/Jun/05 19:45/chapters/san-diego/products/graphics/rabbit_in_the_house_booklet_small.gif
73 29/Jun/05 21:48/chapters/san-francisco/stores.html
73 0.01%29/Jun/05 22:22/rabbit-center/adoptables/graphics/big/Eva31sml.jpg
73 29/Jun/05 10:41/adopt-a-rabbit-month/press-release-04.html
73 0.01%29/Jun/05 23:36/rabbit-center/adoptables/graphics/big/dantesiliconvalley.JPG
73 29/Jun/05 15:16/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Peter_Rabbit_Frame-Book.JPG
73 0.01%29/Jun/05 14:22/graphics/mine/zippy2.jpg
73 29/Jun/05 19:45/chapters/san-diego/products/graphics/Stories_Rabbits_Tell.jpg
73 29/Jun/05 13:30/graphics/books/watershipdown.gif
72 29/Jun/05 11:09/links/calendar.html
72 29/Jun/05 14:52/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Two_flower_Pots.JPG
72 30/Jun/05 00:00/rabbit-center/retail/deco.html
72 29/Jun/05 15:14/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/White_rabbit_casserole.JPG
72 29/Jun/05 14:54/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Rabbit_custard_cup.JPG
72 29/Jun/05 23:51/rabbit-center/retail/vids.html
72 29/Jun/05 19:45/chapters/san-diego/products/graphics/mousepad_pic.jpg
72 29/Jun/05 19:01/journal/3-10/writers-guidelines.html
71 29/Jun/05 05:54/journal/3-4/graphics/kids.gif
71 28/Jun/05 16:26/chapters/san-diego/products/poster.html
71 0.01%29/Jun/05 14:23/graphics/mine/zippy3.jpg
71 29/Jun/05 23:47/rabbit-center/retail/litter.html
71 28/Jun/05 19:01/translations/portugese/right-person.html
71 29/Jun/05 19:45/chapters/san-diego/products/graphics/classic.gif
71 28/Jun/05 10:51/webmail/images/first.gif
71 29/Jun/05 14:28/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Baby_outfit.JPG
71 29/Jun/05 20:45/chapters/san-diego/behavior/quiz/q8answer_false.html
71 29/Jun/05 13:36/faqgerman/sections/stubenrein.html
71 29/Jun/05 14:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Welcome_sign.JPG
71 29/Jun/05 14:27/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bunny_Pitcher.JPG
71 29/Jun/05 19:45/chapters/san-diego/products/graphics/groc_list.jpg
71 29/Jun/05 15:17/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Irish_Pewter_Measure.JPG
71 29/Jun/05 23:19/chapters/oakland/ana.jpg
58 29/Jun/05 23:19  /chapters/oakland/ana.jpg?
70 29/Jun/05 14:52/graphics/mine/foo/4-under-bed.jpg
70 29/Jun/05 13:30/graphics/books/runaway-bunny.gif
70 28/Jun/05 08:50/chapters/socal/
70 29/Jun/05 19:45/chapters/san-diego/products/collectibles.html
70 29/Jun/05 13:30/graphics/books/marshmallow.gif
70 29/Jun/05 13:30/graphics/books/velveteen.gif
70 28/Jun/05 21:48/journal/3-10/
70 29/Jun/05 14:27/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Calico_bunny.JPG
70 29/Jun/05 13:01/chapters/san-francisco/blue.jpeg
70 29/Jun/05 22:41/opinion/subaru.html
69 29/Jun/05 19:45/chapters/san-diego/products/graphics/script.gif
69 29/Jun/05 15:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Two_Bisque_Bunnies_pair2.JPG
69 29/Jun/05 15:19/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bunny_Watercolor_DD.JPG
69 29/Jun/05 23:13/graphics/2003arrmsugar2.jpg
69 29/Jun/05 18:42/journal/3-1/first-rescue.html
69 29/Jun/05 13:30/graphics/books/tales.gif
69 29/Jun/05 13:30/graphics/books/potter.gif
69 29/Jun/05 19:45/chapters/san-diego/products/graphics/Decal-orange.JPG
69 29/Jun/05 07:35/journal/warren-wise/photos.html
69 29/Jun/05 15:29/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Flowered_Bunny_Trinket_Box.JPG
69 29/Jun/05 15:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Two_Bisque_Bunnies_pair1.JPG
69 29/Jun/05 19:45/chapters/san-diego/products/graphics/Decal_blue.JPG
68 29/Jun/05 15:19/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bunny_cabbage_pitcher.JPG
68 29/Jun/05 15:57/journal/3-12/graphics/fosterer-allergies.gif
68 29/Jun/05 15:32/graphics/adoption-ed-small-oval.jpg
68 29/Jun/05 14:26/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/HK_Fergie_2.jpg
68 29/Jun/05 23:05/care/vets_iowa.html
68 29/Jun/05 20:07/rabbit-center/retail/tentS.jpg
68 29/Jun/05 21:03/chapters/oakland/nobadrab.html
68 29/Jun/05 21:02/chapters/oregon/images/bunnymascot6.jpg
68 29/Jun/05 14:25/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Napkin_rings.JPG
68 29/Jun/05 13:31/graphics/books/jackrabbit.gif
68 29/Jun/05 21:48/care/vets_scarolina.html
68 29/Jun/05 20:11/rabbit-center/retail/tunnelS.gif
68 29/Jun/05 20:07/rabbit-center/retail/matS.jpg
68 28/Jun/05 21:18/chapters/oakland/bunwalk.html
68 0.01%29/Jun/05 14:53/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Tall_Grape_Vase.JPG
68 29/Jun/05 20:05/journal/3-5/habitat-brochure.html
67 29/Jun/05 14:55/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Fitz_Floyd_rabbit.JPG
67 29/Jun/05 14:26/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/HK_Harry_2.jpg
67 0.02%29/Jun/05 22:25/chapters/san-diego/adoption/Adoption_Photos/BJ_adopt_composite.jpg
67 28/Jun/05 22:49/rabbit-center/lucky/media_release.htm
67 29/Jun/05 20:07/rabbit-center/retail/basketS.jpg
67 29/Jun/05 13:30/graphics/books/rabbit-hill.gif
67 29/Jun/05 13:59/opinion/july-adopt-a-rabbit.html
67 29/Jun/05 13:48/chapters/san-diego/products/graphics/house_rabbit_handbook_small.jpg
67 29/Jun/05 20:07/rabbit-center/retail/ringS.jpg
66 29/Jun/05 20:07/rabbit-center/retail/ballS.gif
66 29/Jun/05 19:48/hrs-info/vet-conference/CAROLYNN.gif
66 28/Jun/05 16:01/journal/2-9/special-rabbit.html
66 0.01%29/Jun/05 14:26/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Football_2.JPG
66 29/Jun/05 14:27/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Fairy_Bunny.JPG
66 29/Jun/05 11:56/behaviourgerman/koerpersprache.html
66 29/Jun/05 23:59/journal/warren-wise/saftey.html
66 29/Jun/05 21:03/care/vets_arkansas.html
66 29/Jun/05 14:27/fun/answer7.html
66 29/Jun/05 08:15/graphics/mine/toby-izzy/izzy-best.jpg
66 29/Jun/05 12:14/hrs-info/adopt-a-highway.html
66 29/Jun/05 13:01/journal/3-2/graphics/marsh.gif
66 29/Jun/05 19:50/journal/2-6/hands-on-therapy.html
65 29/Jun/05 14:25/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Olympic_pins.JPG
65 29/Jun/05 19:48/hrs-info/vet-conference/hornblower3.gif
65 29/Jun/05 09:07/chapters/san-diego/aboutus/hay_elf.html
65 28/Jun/05 15:14/chapters/san-diego/aboutus/bunnyfest/bfest_auction_2004.html
65 29/Jun/05 14:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/suzie-sample.jpg
65 29/Jun/05 22:42/care/vets_wvirginia.html
65 29/Jun/05 21:02/chapters/oregon/images/sanctuaryheader.jpg
65 29/Jun/05 18:51/chapters/san-diego/aboutus/bunnyfest/bfest_toydonation.html
65 29/Jun/05 23:15/translations/japanese/aggression-j.txt
65 29/Jun/05 01:25/journal/2-6/database.html
65 29/Jun/05 22:25/chapters/san-diego/adoption/Adoption_Photos/AlfieAndy_adoption_Jun05.jpg
65 29/Jun/05 15:18/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Easter_candy_dishes-2.JPG
65 0.01%29/Jun/05 12:07/graphics/fun/netbunnies/sherlock.gif
65 29/Jun/05 16:26/journal/warren-wise/help-a-fosterer.html
65 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Anne_Geddes_doll.jpg
65 29/Jun/05 10:34/chapters/san-diego/products/graphics/smbookcover.jpg
65 29/Jun/05 19:48/hrs-info/vet-conference/hornblower2.gif
65 28/Jun/05 20:25/chapters/san-diego/aboutus/wish_list.html
65 29/Jun/05 15:28/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Large_White_Ceramic_Bunnies.JPG
65 28/Jun/05 18:57/translations/portugese/philosophy.html
65 29/Jun/05 02:13/rabbit-center/lucky/cruelty.htm
64 29/Jun/05 21:02/chapters/oregon/images/bunnymascot2.jpg
64 29/Jun/05 14:28/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Books_puzzle.JPG
64 29/Jun/05 22:17/rabbit-center/adoptables/graphics/big/helga25sml.jpg
64 29/Jun/05 23:15/translations/japanese/tusks-j.txt
64 29/Jun/05 15:17/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Lenox_Cottontail_Plate.JPG
64 29/Jun/05 15:16/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Picnic_Basket_carrier.JPG
64 29/Jun/05 20:45/chapters/san-diego/behavior/quiz/q6answer_true.html
64 29/Jun/05 14:58/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bedtime_Buddies_2.JPG
64 29/Jun/05 22:17/rabbit-center/adoptables/graphics/big/buzz25sml.jpg
64 29/Jun/05 13:48/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/ski_hat.jpg
63 29/Jun/05 13:27/journal/3-10/graphics/rosenthal.gif
63 29/Jun/05 21:48/opinion/newsday-reprint.html
63 29/Jun/05 22:17/rabbit-center/adoptables/graphics/big/sailor11sml.jpg
63 29/Jun/05 23:07/translations/japanese/diet-j.txt
63 29/Jun/05 23:25/translations/japanese/age-related-behavior-j.txt
63 29/Jun/05 18:41/rabbit-center/hayward_rescue/hayward_graphics/angel_thanks.JPG
63 29/Jun/05 20:36/chapters/san-diego/adoption/Adoption_Photos/Mia_Jack_adoption_29Sept02.JPG
63 29/Jun/05 13:27/journal/3-10/graphics/conference1.gif
63 29/Jun/05 09:36/journal/warren-wise/cage-door.html
63 29/Jun/05 14:21/fun/answer9.html
63 29/Jun/05 23:28/translations/japanese/cuniculi-up-j.txt
62 29/Jun/05 13:27/journal/3-10/graphics/deeb.gif
62 0.01%29/Jun/05 18:41/rabbit-center/hayward_rescue/hayward_graphics/one_big_pen_1.JPG
62 29/Jun/05 13:27/journal/3-10/graphics/williford.gif
62 29/Jun/05 13:27/journal/3-10/graphics/conference2.gif
62 29/Jun/05 11:50/adoptiongerman/hrszucht.html
62 29/Jun/05 20:11/chapters/san-diego/behavior/microchip.html
62 29/Jun/05 13:27/journal/3-10/graphics/jenkins.gif
62 0.01%29/Jun/05 18:41/rabbit-center/hayward_rescue/hayward_graphics/one_big_pen_2.JPG
62 29/Jun/05 09:36/behaviourgerman/
62 29/Jun/05 23:07/translations/japanese/medical-j.txt
62 29/Jun/05 13:27/journal/3-10/graphics/harkness.gif
62 29/Jun/05 15:29/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Green-flwrd_rabbit_vase_2.JPG
62 29/Jun/05 17:02/journal/2-7/right-decision.html
62 0.01%29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/eileen_top_page.jpg
62 28/Jun/05 15:01/journal/3-10/home-office.html
62 28/Jun/05 21:43/care/reproduction.html
61 29/Jun/05 18:40/journal/3-5/warehouse.html
61 0.01%29/Jun/05 15:14/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/White_Bunny_CookieJar.JPG
61 28/Jun/05 18:59/translations/portugese/easter.html
61 29/Jun/05 16:57/journal/3-2/graphics/mcvee.gif
61 29/Jun/05 23:28/translations/japanese/cuniculi-j.txt
61 29/Jun/05 17:34/chapters/michigan/specialneeds.html
60 0.01%29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/eileen_exam_1.jpg
60 29/Jun/05 15:06/chapters/oakland/aboutus.html
60 0.01%29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/eileen_babies.jpg
60 29/Jun/05 10:25/chapters/san-francisco/graphics/adoptables/overlo1.jpg
60 29/Jun/05 16:09/journal/3-3/lead.html
60 29/Jun/05 15:31/rabbit-center/hayward_rescue/hayward_graphics/beginning_structure.JPG
60 29/Jun/05 20:15/rabbit-center/retail/hngtoysL.jpg
60 28/Jun/05 21:05/rabbit-center/lucky_rescue.html/robots.txt
60 29/Jun/05 14:47/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Auction_items_1.jpg
59 0.01%29/Jun/05 10:32/graphics/fun/netbunnies/barley1.gif
59 29/Jun/05 18:48/caregerman/leben-mit-einem.html
59 29/Jun/05 15:20/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Baby_shoes_bib_frame.JPG
59 0.01%29/Jun/05 18:41/rabbit-center/hayward_rescue/hayward_graphics/cleaning_pen.JPG
59 29/Jun/05 23:07/translations/japanese/disabled-j.txt
59 0.01%29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/eileen_exam_2.jpg
59 29/Jun/05 23:36/rabbit-center/adoptables/graphics/big/adam r1432 32sml.jpg
59 29/Jun/05 04:12/faqgerman/sections/mehrere.html
59 29/Jun/05 01:05/journal/2-5/volunteer-overview.html
58 0.01%29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/eileen_exam5.jpg
58 0.01%29/Jun/05 15:31/rabbit-center/hayward_rescue/hayward_graphics/boys_love_too.JPG
58 29/Jun/05 15:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Verdegris_Candle_Bunny.JPG
58 29/Jun/05 21:21/rabbit-center/hayward_rescue/hayward_graphics/Boys_relax.jpg
58 29/Jun/05 15:16/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Silver_Pearl_Necklace.JPG
58 29/Jun/05 15:20/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/2-Bunny_Trinket_box.JPG
58 29/Jun/05 14:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Spanish_Plate.JPG
58 29/Jun/05 14:57/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bronze_trinket_box.JPG
58 29/Jun/05 23:28/translations/japanese/orphan-j.txt
57 0.01%29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/eileen_resting_driveway.jpg
57 29/Jun/05 09:37/hrs-info/spam_vaccine/spam_vaccine.js
57 0.01%29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/eileen_feeling_better.jpg
57 29/Jun/05 15:31/rabbit-center/hayward_rescue/hayward_graphics/structure_toys.jpg
57 29/Jun/05 22:58/journal/3-8/graphics/rabbit-for-sale.gif
57 28/Jun/05 21:15/graphics/easter/anti-big-gabriella.jpg
57 29/Jun/05 17:04/chapters/oakland/adoption.html
57 0.01%29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/eileen_exam4.jpg
57 28/Jun/05 15:48/journal/3-2/writing-for-journal.html
57 29/Jun/05 10:57/translations/portugese/interpreting-behavoir.html
57 0.01%29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/eileen_exam_3.jpg
57 29/Jun/05 15:31/rabbit-center/hayward_rescue/hayward_graphics/exploring.jpg
57 29/Jun/05 14:22/graphics/breeds/pappy-mini-rex-oc.jpg
57 29/Jun/05 14:47/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Auction_items_4.JPG
56 29/Jun/05 19:40/graphics/fun/netbunnies/winzip81.exe
56 0.01%29/Jun/05 18:42/rabbit-center/hayward_rescue/hayward_graphics/eileen_sprouts.jpg
56 29/Jun/05 23:52/translations/japanese/chew-stick-j.txt
56 27/Jun/05 23:05/chapters/san-francisco/adopted.html
56 29/Jun/05 15:31/rabbit-center/hayward_rescue/hayward_graphics/more_bunnies.JPG
56 29/Jun/05 21:21/rabbit-center/hayward_rescue/hayward_graphics/girls_dine.jpg
56 29/Jun/05 21:56/hrs-info/publicity/wp-apr-97.html
56 29/Jun/05 14:47/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Premium_booth.JPG
56 29/Jun/05 15:31/rabbit-center/hayward_rescue/hayward_graphics/its-a-hit.JPG
56 28/Jun/05 21:06/links/sections/Rabbits911.html
56 29/Jun/05 21:58/graphics/mine/foo/9-cds.jpg
56 29/Jun/05 12:25/chapters/oakland/articles.html
56 29/Jun/05 21:21/rabbit-center/hayward_rescue/hayward_graphics/girl_talk.jpg
55 29/Jun/05 20:30/rabbit-center/retail/store3L.jpg
55 29/Jun/05 14:55/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Diane_Wat_blouse.JPG
55 29/Jun/05 15:18/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Gund_Flower_Bunny_2.JPG
55 29/Jun/05 14:25/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Lacquer_tray.JPG
55 29/Jun/05 14:47/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Ask-a-Vet_1.JPG
55 29/Jun/05 23:08/translations/japanese/calcium-j.txt
55 29/Jun/05 14:55/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Powder_Bobblehead.JPG
55 29/Jun/05 14:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Ruffled_bowl.JPG
55 29/Jun/05 06:48/hrs-info/petco_update.html
55 29/Jun/05 14:57/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/BunnyLove_Painting.JPG
55 29/Jun/05 15:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Small_floral_basket.JPG
55 29/Jun/05 07:45/care/recipies.html
55 29/Jun/05 14:47/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/lagomorph_lounge.JPG
55 27/Jun/05 10:39/rabbit-center/graphics/hurt-rabbit/3.jpg
55 29/Jun/05 14:18/graphics/hrs-rabbits/living-with/
54 29/Jun/05 15:17/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/HK_PotBelly_Candles.JPG
54 29/Jun/05 20:30/rabbit-center/retail/playboxL.jpg
54 29/Jun/05 15:03/journal/2-7/submissions.html
54 29/Jun/05 15:17/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/HK_RolyPoly_Salt-Pepper.JPG
54 28/Jun/05 19:02/translations/portugese/special-rabbit.html
54 29/Jun/05 15:17/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/HK_Marquis_de_Blanc.JPG
54 29/Jun/05 09:56/journal/2-7/educators.html
54 29/Jun/05 14:53/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Stuffed_buddies.JPG
54 29/Jun/05 12:51/journal/3-8/graphics/litterbox-trained.gif
54 29/Jun/05 14:57/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Blue_Fenton_Bunny.JPG
53 27/Jun/05 13:19/rabbit-center/graphics/hurt-rabbit/1.jpg
53 29/Jun/05 13:55/journal/warren-wise/priorities.html
53 29/Jun/05 22:17/rabbit-center/adoptables/graphics/big/peaches26sml.jpg
53 29/Jun/05 14:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Silver_Frames.JPG
53 29/Jun/05 09:53/rabbit-center/adoptables/graphics/big/
53 29/Jun/05 14:56/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bunny_Candy_dish.JPG
53 29/Jun/05 09:42/health/vhd-ny-dec2001.html
53 29/Jun/05 15:47/journal/3-10/graphics/ears.gif
53 27/Jun/05 10:39/rabbit-center/graphics/hurt-rabbit/2.jpg
53 29/Jun/05 21:48/care/vets_idaho.html
53 29/Jun/05 14:56/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Christmas_Bunny.JPG
53 29/Jun/05 22:17/rabbit-center/adoptables/graphics/big/bounce27sml.jpg
53 29/Jun/05 13:50/chapters/san-diego/aboutus/bunnyfest/bunnyfest_2002_photos.html
53 29/Jun/05 14:57/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bunny_Blanket_Set.jpg
53 29/Jun/05 07:05/faqgerman/sections/medizinverabreichen.html
53 29/Jun/05 22:17/rabbit-center/adoptables/graphics/big/hazel55sml.jpg
53 29/Jun/05 15:18/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Framed_Crosstitch_Bunny.JPG
53 29/Jun/05 09:41/journal/warren-wise/health-data.html
52 29/Jun/05 13:10/chapters/san-diego/behavior/quiz/q7answer_false.html
52 29/Jun/05 01:51/journal/3-3/privacy.html
52 29/Jun/05 20:30/rabbit-center/retail/haybagsL.jpg
52 28/Jun/05 08:43/faqgerman/sections/aggression-de.html
52 29/Jun/05 14:26/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Giant_Bunny.JPG
52 29/Jun/05 03:01/faqgerman/sections/unterbringung.html
52 29/Jun/05 19:16/faqgerman/sections/klassenzimmer.html
52 29/Jun/05 23:47/journal/vol2-by-subject-index.html
52 29/Jun/05 22:17/easter/flyer/flyer2.html
52 29/Jun/05 23:08/translations/japanese/pellets-j.txt
51 0.01%29/Jun/05 12:10/rabbit-center/hayward_rescue/hayward_graphics/Toby_playing.JPG
51 29/Jun/05 22:12/easter/flyer/childstory.jpg
51 29/Jun/05 14:47/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Auction_items_2.JPG
51 29/Jun/05 14:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Sock_Bunny.JPG
51 29/Jun/05 14:47/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Cottontail_cafe.JPG
51 29/Jun/05 10:37/graphics/fun/netbunnies/bj.tif
51 28/Jun/05 10:51/webmail/images/last.gif
51 29/Jun/05 19:43/journal/2-7/graphics/basset-circle.gif
51 29/Jun/05 21:48/care/vets_newmexico.html
51 29/Jun/05 15:48/chapters/oakland/title.jpg
51 29/Jun/05 15:19/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Dancing_choco_bunny.JPG
51 29/Jun/05 12:02/rabbit-center/lucky_media.html
51 29/Jun/05 22:12/easter/flyer/flyer1.gif
51 29/Jun/05 12:39/links/sections/ally_application.doc
51 29/Jun/05 11:13/adoptiongerman/
51 29/Jun/05 23:20/translations/japanese/tools-of-the-trade-j.txt
50 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_graphics/gigi084tiny.jpg
50 29/Jun/05 23:07/translations/japanese/pellet-info-j.txt
50 29/Jun/05 22:12/easter/flyer/flyer2.gif
50 0.01%29/Jun/05 14:53/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Thinking_Rabbit.JPG
50 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Wall_plaque.JPG
50 29/Jun/05 22:17/rabbit-center/adoptables/graphics/big/patootie-r1295-27sml.jpg
50 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_graphics/seymore141tiny.jpg
50 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_graphics/sambra072tiny.jpg
50 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_graphics/michael046tiny.jpg
50 28/Jun/05 15:02/chapters/san-diego/aboutus/philosophy.html
50 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_graphics/francine057tiny.jpg
50 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_graphics/bernie147tiny.jpg
50 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_graphics/johanna095tiny.jpg
50 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_graphics/angel062tiny.jpg
50 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_graphics/lewis122tiny.jpg
50 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_graphics/benton111tiny.jpg
50 29/Jun/05 23:07/translations/japanese/medical-leads-j.txt
50 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_graphics/nancy067tiny.jpg
50 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_graphics/toby025tiny.jpg
50 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_graphics/Albert_adopt.jpg
50 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_graphics/janet018tiny.jpg
50 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_graphics/baxter140tiny.jpg
50 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_graphics/diana106tiny.jpg
50 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_graphics/sam108tiny.jpg
50 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_graphics/richard131tiny.jpg
50 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_graphics/frankie041tiny.jpg
50 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_graphics/danny116tiny.jpg
50 29/Jun/05 19:43/journal/2-7/graphics/sach-circle.gif
50 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_graphics/lance005tiny.jpg
50 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_graphics/ubu031tiny.jpg
49 29/Jun/05 22:17/rabbit-center/adoptables/graphics/big/natasha03sml.jpg
49 29/Jun/05 22:12/easter/flyer/flyer3.gif
49 29/Jun/05 23:07/translations/japanese/drollery-j.txt
49 29/Jun/05 19:43/journal/2-7/graphics/greta-circle-2.gif
49 29/Jun/05 17:19/journal/2-6/graphics/pj.gif
49 29/Jun/05 21:48/care/vets_utah.html
49 29/Jun/05 19:56/chapters/san-diego/products/graphics/Prayer_box_closeup.jpg
48 29/Jun/05 21:41/chapters/oakland/hallh.gif
48 29/Jun/05 14:22/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/AK_Specialties.JPG
48 29/Jun/05 22:18/chapters/san-francisco/graphics/adoptables/cindi.jpg
48 29/Jun/05 22:57/easter/next.html
48 29/Jun/05 22:12/easter/flyer/food-not-free.pdf
48 28/Jun/05 17:20/graphics/fun/netbunnies/cashew.gif
48 29/Jun/05 14:22/care/gi-stasis.html
48 29/Jun/05 22:17/rabbit-center/adoptables/graphics/big/duncan23sml.jpg
48 28/Jun/05 21:02/rabbit-center/samosa-update.html
48 29/Jun/05 22:12/easter/flyer/flyer4.gif
48 29/Jun/05 14:15/rabbit-center/hayward_rescue/hayward_graphics/zorro011tiny.jpg
48 28/Jun/05 18:56/translations/portugese/about.html
47 29/Jun/05 19:51/chapters/san-diego/aboutus/online.html
47 29/Jun/05 20:12/rabbit-center/retail/food.jpg
47 29/Jun/05 09:18/translations/
47 29/Jun/05 13:01/chapters/san-francisco/promo.html
47 29/Jun/05 23:23/translations/japanese/fear-into-play-j.txt
47 29/Jun/05 16:28/hrs-info/vet-conference/hrs-logo.gif
47 29/Jun/05 13:40/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/avian_2.jpg
47 29/Jun/05 12:08/help/hints.html
47 29/Jun/05 14:14/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Silver_lop.JPG
47 28/Jun/05 07:25/faqgerman/sections/warmwetter.html
47 29/Jun/05 23:38/rabbit-center/adoptables/graphics/big/satin-r1308-01sml.jpg
47 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/CeramicStellar.jpg
46 29/Jun/05 13:10/chapters/san-diego/behavior/quiz/q10answer_true.html
46 29/Jun/05 17:46/rabbit-center/hayward_rescue/hayward_graphics/hayward_bunnies_3.jpg
46 29/Jun/05 20:12/rabbit-center/retail/carrierS.jpg
46 29/Jun/05 00:29/chapters/oregon/newsletter99_6.html
46 29/Jun/05 23:07/translations/japanese/trouble-with-ears-j.txt
46 29/Jun/05 20:12/rabbit-center/retail/blkbagS.jpg
46 29/Jun/05 21:50/graphics/mine/foo/7-by-couch.jpg
46 29/Jun/05 21:58/graphics/mine/foo/1-baby-foo-25.jpg
46 29/Jun/05 22:42/care/vets_montana.html
46 29/Jun/05 22:36/hrs-info/chapter pledge.doc
46 29/Jun/05 22:09/care/vets_alaska.html
45 29/Jun/05 20:12/rabbit-center/retail/haychowS.jpg
45 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/FruitStand.jpg
45 29/Jun/05 11:16/caregerman/bibliografie.html
45 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Arthur_Court_album.JPG
45 29/Jun/05 17:44/chapters/oregon/images/bunnymascot5.jpg
45 29/Jun/05 22:42/care/vets_sdakota.html
45 29/Jun/05 02:56/chapters/michigan/daisy01.jpg
45 29/Jun/05 03:03/faqgerman/sections/training-de.html
45 29/Jun/05 14:15/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Raffle_table.JPG
45 28/Jun/05 17:17/graphics/fun/netbunnies/bunnyday.JPG
45 29/Jun/05 10:27/chapters/oakland/events.html
45 29/Jun/05 17:23/links/sections/orphan_files/
44 29/Jun/05 17:10/chapters/oregon/images/sanctuary_b.jpg
44 29/Jun/05 19:29/graphics/mine/foo/5-under-table.jpg
44 29/Jun/05 16:59/chapters/oakland/resource.html
44 29/Jun/05 14:19/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Book_signing.JPG
44 29/Jun/05 02:57/chapters/michigan/alex01.gif
44 29/Jun/05 02:54/chapters/michigan/jeremy13.jpg
44 29/Jun/05 22:17/rabbit-center/adoptables/graphics/big/gretchen15sml.jpg
44 29/Jun/05 13:40/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Massage_1.JPG
44 29/Jun/05 03:14/graphics/mine/fripouille.gif
44 29/Jun/05 17:46/rabbit-center/hayward_rescue/hayward_graphics/Hayward_buns_shelter_3.JPG
43 28/Jun/05 17:19/graphics/fun/netbunnies/c1.JPG
43 29/Jun/05 06:29/rabbit-center/hayward_rescue/hayward_rabbits_adopt-benton.html
43 29/Jun/05 18:20/chapters/oregon/newsletter99_5.html
43 29/Jun/05 13:41/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/CRM_booth.JPG
43 29/Jun/05 19:49/chapters/san-diego/join_online_nowoff.gif
43 29/Jun/05 14:20/chapters/oregon/images/endquote.gif
43 29/Jun/05 14:17/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Garden_variety.JPG
43 29/Jun/05 14:20/chapters/oregon/images/startquote.gif
43 29/Jun/05 20:07/rabbit-center/retail/groominL.jpg
42 28/Jun/05 18:04/help/hrs-sherlock-plugin.hqx
42 29/Jun/05 14:46/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/HRS_Premiums_booth3.JPG
42 29/Jun/05 22:17/rabbit-center/adoptables/images/zela31sml_000.jpg
42 29/Jun/05 14:16/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Kids_Korner_1.JPG
42 29/Jun/05 12:19/health/vhd-utah-aug2001.html
42 29/Jun/05 19:49/chapters/san-diego/join_online_nowon.gif
42 29/Jun/05 19:36/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Bfest_Spirit_small.JPG
42 29/Jun/05 20:13/rabbit-center/retail/litter.jpg
42 27/Jun/05 14:38/graphics/fun/netbunnies/ukkurt.JPG
42 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Desert_Hare_Print.JPG
41 27/Jun/05 23:06/easter/flyer/flyer1.html
41 29/Jun/05 17:02/care/tips.html
41 29/Jun/05 19:36/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Info_Premium_Booths_small.JPG
41 29/Jun/05 03:08/graphics/fun/netbunnies/h1.JPG
41 29/Jun/05 14:06/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/HRS_Info_Booth2.JPG
41 26/Jun/05 11:04/graphics/fun/netbunnies/bunnyinbowl.JPG
41 29/Jun/05 14:13/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/T-Touch_demo_1.JPG
41 28/Jun/05 22:28/rabbit-center/hayward_rescue/hayward_rabbits_adopt-lance.html
41 29/Jun/05 07:31/chapters/oregon/images/bunnymascot4.jpg
40 29/Jun/05 11:37/rabbit-center/rabbit_ofthe_month/_baks/
40 29/Jun/05 13:40/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Dr_Loudis.JPG
40 28/Jun/05 16:41/easter/hrs_easter_release_2005.pdf
40 28/Jun/05 21:32/hrs-info/tenth-leap/auction-thanks.html
40 28/Jun/05 22:29/rabbit-center/hayward_rescue/hayward_rabbits_adopt-johanna.html
40 28/Jun/05 07:53/care/vets-uncovered-regions.html
40 29/Jun/05 17:10/chapters/oregon/images/sanctuary_c.jpg
40 28/Jun/05 21:20/chapters/oakland/bctheydi.html
40 29/Jun/05 19:36/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Cottontail_Cafe_small.jpg
40 29/Jun/05 14:13/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/T-Touch_demo_3.JPG
40 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Backpack.JPG
40 29/Jun/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Bunny_demo.JPG
40 28/Jun/05 21:27/hrs-info/aug00survey-results.html
40 29/Jun/05 19:36/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Chare_Massage_small.JPG
40 29/Jun/05 17:10/chapters/oregon/images/sanctuary_a.jpg
40 29/Jun/05 18:38/rabbit-center/graphics/smDSC_5138.jpg
40 27/Jun/05 01:16/graphics/fun/netbunnies/lazy.gif
40 29/Jun/05 14:20/chapters/oregon/newsletter99_4.html
40 29/Jun/05 09:47/graphics/Icon%0d
40 29/Jun/05 08:09/chapters/oregon/newsletter99_1.html
39 29/Jun/05 14:13/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/T-Touch_demo_2.JPG
39 29/Jun/05 11:05/easter/grail.mid
39 29/Jun/05 18:59/events/nj-conf-10-00.html
39 29/Jun/05 11:50/graphics/Icon_
39 29/Jun/05 19:36/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/CRM_Booth_small.JPG
39 29/Jun/05 11:02/graphics/mine/zowie6-crop.jpg
39 29/Jun/05 22:25/chapters/san-diego/adoption/Adoption_Photos/Mimi_adoption_Jun05.jpg
39 29/Jun/05 10:41/hrs-info/bookmark-hrs.html
39 29/Jun/05 13:40/rabbit-center/hayward_rescue/hayward_rabbits_adopt-janet.html
39 29/Jun/05 19:36/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Exoticare_small.JPG
39 27/Jun/05 15:04/chapters/san-diego/diet/5325.pdf
38 29/Jun/05 19:36/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Kids_Corner_1_small.JPG
38 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Candy_dish.jpg
38 29/Jun/05 10:50/chapters/san-diego/behavior/quiz/q9answer_true.html
38 29/Jun/05 11:45/hrs-info/chapter-contract.doc
38 28/Jun/05 11:05/easter/flyer/flyer3.doc
38 29/Jun/05 13:40/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/ed_booth.jpg
38 29/Jun/05 10:54/graphics/fun/netbunnies/gidget.bmp
38 29/Jun/05 07:55/journal/warren-wise/
38 29/Jun/05 21:48/chapters/oakland/behr.html
38 29/Jun/05 19:36/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Garden_Art_small.JPG
38 29/Jun/05 13:12/chapters/san-francisco/graphics/adoptables/feb02/emma.jpg
38 28/Jun/05 21:32/adopt-a-rabbit-month/poster.html
38 29/Jun/05 17:34/chapters/san-diego/aboutus/volunteer_materials.html
38 29/Jun/05 08:06/graphics/homepage/hrs-banner.gif
38 29/Jun/05 22:25/chapters/san-diego/adoption/Adoption_Photos/Sammie_adoption_20Jun05.jpg
38 29/Jun/05 21:43/chapters/oakland/nietzche.html
38 29/Jun/05 10:26/chapters/san-diego/products/graphics/rabbit-poster.JPG
38 29/Jun/05 23:33/journal/2-7/graphics/hollyk.gif
38 29/Jun/05 14:13/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Spotted_bunny.JPG
38 28/Jun/05 05:32/easter/hrs2004prnewswire.html
37 29/Jun/05 10:42/chapters/san-diego/health/graphics/Frankenbunny-1.JPG
37 29/Jun/05 15:13/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/White_bunny_pink-leash.JPG
37 29/Jun/05 23:39/rabbit-center/adoptables/images/eileen_big.jpg
37 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Fitz_Floyd_Bowl.JPG
37 27/Jun/05 21:15/graphics/banners/full-banner-short.jpg
37 29/Jun/05 10:40/rabbit-center/retail/lrgcageL.jpg
37 28/Jun/05 05:09/store/
37 29/Jun/05 08:06/graphics/homepage/backbar.gif
37 28/Jun/05 22:35/chapters/san-diego/adoption/statistic.html
37 29/Jun/05 15:28/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Cabbage_Bun_Planter.JPG
37 28/Jun/05 21:35/journal/current-issue.html
37 28/Jun/05 07:38/faqgerman/sections/nagen.html
37 29/Jun/05 12:39/journal/3-8/ww.html
37 29/Jun/05 14:38/resources/
37 28/Jun/05 22:20/rabbit-center/hayward_rescue/hayward_rabbits_adopt-baxter.html
36 29/Jun/05 14:22/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/2_white_bunnies.JPG
36 29/Jun/05 14:21/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Ask-a-Vet_3.JPG
36 29/Jun/05 06:38/caregerman/klokiste.html
36 29/Jun/05 16:31/hrs-info/tenth-leap/rsvp.html
36 28/Jun/05 17:20/graphics/fun/netbunnies/cadbury1.tif
36 26/Jun/05 16:24/graphics/fun/netbunnies/stonebunny.JPG
36 28/Jun/05 06:55/chapters/san-francisco/rainbow/
36 29/Jun/05 19:36/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Premium_Booth_small.JPG
36 29/Jun/05 10:40/graphics/fun/netbunnies/bunny1.tif
36 29/Jun/05 19:36/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Many_Hands_Booth_small.JPG
36 29/Jun/05 14:21/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Ask-a-Vet_2.JPG
36 29/Jun/05 14:20/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Bfest_view.JPG
36 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/LgRiceBowls.jpg
36 29/Jun/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Bunny_tech.JPG
36 26/Jun/05 16:23/graphics/fun/netbunnies/rabbit2.tif
36 28/Jun/05 10:02/graphics/fun/netbunnies/fuzzball1.gif
36 29/Jun/05 16:29/easter/yahooligansindex.html
35 29/Jun/05 14:51/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Boy_spotted_bunny.JPG
35 29/Jun/05 19:36/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Jodi_Jensen_Booth_small.JPG
35 28/Jun/05 19:58/chapters/oakland/cuddles.html
35 28/Jun/05 22:22/rabbit-center/hayward_rescue/hayward_rabbits_adopt-bernie.html
35 29/Jun/05 05:25/rabbit-center/rabbit_ofthe_month/common/
35 29/Jun/05 08:45/graphics/breeds/summer-dutch-dc.jpg
35 29/Jun/05 09:48/faqgerman/sections/
35 28/Jun/05 21:33/hrs-info/tenth-leap/invite.html
35 28/Jun/05 08:57/chapters/san-diego/behavior/quiz/q2answer_true.html
35 29/Jun/05 19:36/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Info_Booth_small.JPG
35 0.01%29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Tapestry_Throw.JPG
35 29/Jun/05 14:17/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/English_spot.JPG
35 29/Jun/05 19:36/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/mvc-002f_small.jpg
35 29/Jun/05 23:30/journal/3-8/graphics/couple-circle.gif
35 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/ResinBunAngle.jpg
35 29/Jun/05 11:55/easter/oldindex.html
35 29/Jun/05 15:52/journal/3-7/graphics/rabbit-sketch.gif
35 29/Jun/05 20:31/rabbit-center/graphics/icon_servicespage.gif
35 29/Jun/05 12:16/links/letter.html
35 29/Jun/05 12:12/care/tips00.html
35 28/Jun/05 05:11/graphics/easter/anti-gabriella.jpg
35 29/Jun/05 14:07/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Cottontail_Cafe.JPG
35 29/Jun/05 19:36/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/shoppers_small.jpg
35 29/Jun/05 16:20/chapters/san-diego/feedback.html
34 29/Jun/05 21:46/chapters/oakland/elmo.html
34 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/PotteryDish.jpg
34 29/Jun/05 20:14/rabbit-center/retail/hr-book.jpg
34 29/Jun/05 13:39/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/kw_cages.jpg
34 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Lisa_Goldie_Booth_small.JPG
34 29/Jun/05 06:59/journal/3-1/graphics/hare.gif
34 29/Jun/05 05:26/chapters/oregon/newsletter99_3.html
34 28/Jun/05 17:29/graphics/fun/netbunnies/doe.gif
34 28/Jun/05 21:34/chapters/socal/leap2.gif
34 27/Jun/05 01:13/graphics/fun/netbunnies/jet.JPG
34 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/And_it_was_good_small.JPG
34 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Sterling_Bunny_Pin.JPG
34 29/Jun/05 14:47/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/blk-wht_dutch-bunny.JPG
34 29/Jun/05 14:45/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Lagomorph_lounge.JPG
34 29/Jun/05 20:14/rabbit-center/retail/bokvidS.jpg
34 28/Jun/05 20:56/journal/4-5/seeking-shelters.html
34 29/Jun/05 14:15/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Pottery_vendor.JPG
34 29/Jun/05 05:36/chapters/socal/hrs-square-easter.gif
34 29/Jun/05 10:01/chapters/san-diego/health/graphics/Skye_sofa.jpg
34 28/Jun/05 21:42/chapters/socal/bun.gif
34 28/Jun/05 21:25/chapters/socal/run2.gif
34 29/Jun/05 14:05/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Kids_corner3.JPG
34 29/Jun/05 14:07/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Bfest_Massage2.JPG
33 29/Jun/05 13:01/chapters/san-francisco/graphics/adopted/abby.jpg
33 29/Jun/05 07:07/faqgerman/sections/leckereien.html
33 29/Jun/05 14:17/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Girl_pink-nose.JPG
33 29/Jun/05 22:17/rabbit-center/adoptables/graphics/big/anusha45sml.jpg
33 28/Jun/05 22:25/rabbit-center/hayward_rescue/hayward_rabbits_adopt-gigi.html
33 29/Jun/05 14:12/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/black_baby_bun.JPG
33 28/Jun/05 22:23/rabbit-center/hayward_rescue/hayward_rabbits_adopt-francine.html
33 29/Jun/05 20:14/rabbit-center/retail/1st-bunV.jpg
33 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/pewter_small.jpg
33 29/Jun/05 05:23/chapters/san-diego/adoption/cage.html
33 29/Jun/05 09:28/rabbit-center/adoptables/graphics/
33 29/Jun/05 15:27/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/HarmonyKingdom_netsuke.JPG
33 29/Jun/05 14:47/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/brown_dutch-bunny.JPG
33 27/Jun/05 00:43/chapters/socal/carrot.gif
33 29/Jun/05 14:47/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/brn_wht_spot_bunny.JPG
33 28/Jun/05 22:07/translations/japanese/litter-j.html
33 29/Jun/05 21:46/chapters/oakland/scooter.html
33 0.02%29/Jun/05 16:49/chapters/san-diego/aboutus/HRS_Adoption_Flyer_tabs_Apr05.pdf
33 28/Jun/05 22:19/rabbit-center/hayward_rescue/hayward_rabbits_adopt-angel.html
33 29/Jun/05 13:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/CRM_booth.JPG
33 27/Jun/05 00:43/chapters/socal/care.gif
33 29/Jun/05 14:48/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/White_bunny_harness.JPG
33 29/Jun/05 21:47/chapters/oakland/buffy.html
33 29/Jun/05 14:47/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/White_mini-lop_2.JPG
32 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Cottontail_Plate.JPG
32 29/Jun/05 14:46/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Old_lop_bunny.JPG
32 0.01%29/Jun/05 16:38/adopt-a-rabbit-month/ShelterPosterfinal.pdf
32 29/Jun/05 20:14/rabbit-center/retail/spayV.jpg
32 28/Jun/05 07:31/chapters/san-francisco/garden/
32 27/Jun/05 01:09/graphics/fun/netbunnies/harley.jpeg
32 28/Jun/05 16:53/hrs-info/image003.gif
32 29/Jun/05 07:32/hrs-info/credit-card.html
32 29/Jun/05 20:14/rabbit-center/retail/routeCD.jpg
32 29/Jun/05 02:42/chapters/san-francisco/adoptables_0802.html
32 29/Jun/05 20:14/rabbit-center/retail/examV.jpg
32 29/Jun/05 14:11/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/dk_brown_lop.JPG
32 29/Jun/05 21:43/chapters/oakland/rorschach.html
32 29/Jun/05 21:48/chapters/oakland/ana.html
32 29/Jun/05 14:51/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Big_agouti_bun_2.JPG
32 29/Jun/05 20:14/rabbit-center/retail/exerVCD.jpg
32 29/Jun/05 14:12/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/White_baby_bun.JPG
32 29/Jun/05 14:19/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Bunnies_all.JPG
32 27/Jun/05 01:10/graphics/fun/netbunnies/harvey2.JPG
32 29/Jun/05 22:11/graphics/easter/gabriella.jpg
32 29/Jun/05 13:41/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Brown_lop.JPG
32 29/Jun/05 11:33/care/north-carolina-vets.txt
32 29/Jun/05 14:12/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Tri-color_lop_2.JPG
32 28/Jun/05 22:26/rabbit-center/hayward_rescue/hayward_rabbits_adopt-frankie.html
32 29/Jun/05 21:47/chapters/oakland/ceci.html
32 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Kids_Corner_2_small.JPG
32 29/Jun/05 14:20/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Big_white_bunny.JPG
32 29/Jun/05 14:06/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Kids_corner1.JPG
31 29/Jun/05 15:13/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Dk_brn_bunny-on-leash.jpg
31 29/Jun/05 21:48/chapters/oakland/baby.html
31 29/Jun/05 05:26/rabbit-center/lucky_media_release.html
31 29/Jun/05 14:51/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Brown_white_dutch.jpg
31 29/Jun/05 14:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Lop_bunny_redhead.JPG
31 29/Jun/05 12:35/chapters/san-diego/aboutus/bunnyfest/bunnyfest_2003.html
31 29/Jun/05 14:05/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Kids_corner2.JPG
31 28/Jun/05 08:39/easter/flyer/flyer4.pdf
31 29/Jun/05 23:52/chapters/san-diego/aboutus/bunnyfest/bfest_volunteer.html
31 29/Jun/05 20:14/rabbit-center/retail/spaceCD.jpg
31 29/Jun/05 20:14/rabbit-center/retail/introV.jpg
31 29/Jun/05 14:48/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/White_bunny_basket.JPG
31 29/Jun/05 12:01/easter/thanks98.html
31 29/Jun/05 21:47/chapters/oakland/ben.html
31 29/Jun/05 14:11/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/brown_spot_bun.JPG
31 29/Jun/05 15:13/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/brown_white_bunny-pair.JPG
31 29/Jun/05 21:45/chapters/oakland/josie.html
31 29/Jun/05 05:31/links/sections/_old/
31 27/Jun/05 23:20/chapters/san-diego/health/mosquito.html
31 29/Jun/05 12:17/links/pasteurella-study.html
30 28/Jun/05 22:30/rabbit-center/hayward_rescue/hayward_rabbits_adopt-nancy.html
30 29/Jun/05 21:47/chapters/oakland/buttersc.html
30 25/Jun/05 13:21/graphics/fun/netbunnies/spencer-profile.JPG
30 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Info_Booth2_small.JPG
30 29/Jun/05 17:07/adoptiongerman/hrsueberbev.html
30 29/Jun/05 14:51/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Bunny_and_basket.jpg
30 29/Jun/05 21:47/chapters/oakland/daisy.html
30 29/Jun/05 19:36/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Pretty_Girl_andher_Bun_small.JPG
30 29/Jun/05 18:51/chapters/san-diego/aboutus/bunnyfest/bfest_photos/p1010046.jpg
30 29/Jun/05 14:46/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/HRS_Premiums_booth.JPG
30 29/Jun/05 21:44/chapters/oakland/macey.html
30 29/Jun/05 14:45/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Rabbit_rescue_booth.JPG
30 29/Jun/05 14:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Lop_bunny_harness.JPG
30 29/Jun/05 14:07/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Bfest_Massage.JPG
30 28/Jun/05 04:27/graphics/fun/netbunnies/foo-zippy-by-comp.gif
30 28/Jun/05 21:51/chapters/san-diego/behavior/quiz/q3answer_false.html
30 29/Jun/05 14:12/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Tri-color_lop.jpg
29 29/Jun/05 14:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Red_lady_spot_bunny.jpg
29 29/Jun/05 14:45/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/two_siamese_lops.JPG
29 29/Jun/05 21:44/chapters/oakland/maya.html
29 29/Jun/05 14:34/journal/3-4/
29 29/Jun/05 14:06/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Girl_himmi_lop.jpg
29 29/Jun/05 14:16/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Man-agouti_lop.JPG
29 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Info_Booth3_small.jpg
29 29/Jun/05 14:14/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Sarah_S_bunny_2.JPG
29 29/Jun/05 18:51/chapters/san-diego/aboutus/bunnyfest/bfest_photos/p1010078.jpg
29 28/Jun/05 06:43/translations/japanese/head-tilt-j.html
29 29/Jun/05 06:38/hrs-info/chapter_pledge.doc
29 29/Jun/05 14:03/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/hotot-in-arms.jpg
29 29/Jun/05 14:48/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/White_bunny_small.JPG
29 28/Jun/05 05:18/graphics/fun/netbunnies/hc1.JPG
29 28/Jun/05 18:50/rabbit-center/lucky_rescue.html/favicon.ico
29 28/Jun/05 07:31/chapters/oregon/newsletter99_2.html
29 29/Jun/05 13:39/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/man_nd.jpg
29 29/Jun/05 14:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Grey_bunny_basket.JPG
29 28/Jun/05 22:24/rabbit-center/hayward_rescue/hayward_rabbits_adopt-danny.html
29 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Blue_white_vase.JPG
29 29/Jun/05 14:16/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Grey_bunny_face.JPG
29 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Cottontail_Cafe2_small.JPG
29 29/Jun/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Dutch_in_grass.JPG
29 29/Jun/05 21:47/chapters/oakland/brandy.html
29 29/Jun/05 12:11/easter/solong-edit.mid
28 28/Jun/05 13:19/rabbit-center/rabbit_ofthe_month/_notes/
28 29/Jun/05 07:50/journal/3-3/
28 29/Jun/05 14:16/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Lisa_Ronco.JPG
28 29/Jun/05 14:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Mixed_bunny_pair.JPG
28 29/Jun/05 22:18/chapters/san-francisco/graphics/adoptables/taylor2.jpg
28 29/Jun/05 19:35/chapters/san-diego/aboutus/bunny_cottage.html
28 29/Jun/05 14:14/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Sarah_S_bunny.JPG
28 29/Jun/05 21:42/chapters/oakland/wallace.html
28 29/Jun/05 14:10/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/lady_spot_bunny.JPG
28 29/Jun/05 18:51/chapters/san-diego/aboutus/bunnyfest/bfest_photos/Rugby_Toy_2.JPG
28 29/Jun/05 14:20/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Big_agouti_bun.JPG
28 29/Jun/05 17:27/journal/3-3/graphics/
28 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Cottontail_Cafe3_small.JPG
28 29/Jun/05 14:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Guy_sealpoint_rex.JPG
28 29/Jun/05 14:10/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/mamas_shoulder.JPG
28 29/Jun/05 21:46/chapters/oakland/hershey.html
28 23/Jun/05 18:39/graphics/fun/netbunnies/rexspike.gif
28 28/Jun/05 05:47/chapters/oakland/vetlist.html
28 29/Jun/05 22:18/chapters/san-francisco/graphics/adoptables/taylor1.jpg
28 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Pat-the-bunny_tin.JPG
28 28/Jun/05 15:37/hrs-info/tenth-leap/10.gif
28 29/Jun/05 13:39/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/sarah_s.jpg
28 29/Jun/05 14:11/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/lady_eng_spot.JPG
27 29/Jun/05 15:13/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Seal-point_lop_red-leash.JPG
27 28/Jun/05 13:44/chapters/san-diego/behavior/quiz/q5answer_true.html
27 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Auction_browsing2_small.JPG
27 29/Jun/05 11:41/rabbit-center/hayward_rescue/hayward_graphics/da-2.jpg
27 29/Jun/05 14:04/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/group-lecture.jpg
27 29/Jun/05 15:27/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Japanese_Rice_Bowls.JPG
27 29/Jun/05 16:14/journal/4-4/
27 29/Jun/05 18:51/chapters/san-diego/aboutus/bunnyfest/bfest_photos/p1010015.jpg
27 29/Jun/05 14:14/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Sleepy_Casey.JPG
27 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/magazine_rack.jpg
27 29/Jun/05 07:42/chapters/oregon/images/bunnymascot3.jpg
27 29/Jun/05 10:56/rabbit-center/lucky_letter.html
27 0.01%29/Jun/05 14:06/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/HRS_Info_Booth.JPG
27 29/Jun/05 08:03/links/sections/unaffiliated_rescuer_app.doc
27 28/Jun/05 07:40/hrs-info/stats/day.html
27 29/Jun/05 09:59/chapters/san-diego/diet/hayrack.html
27 29/Jun/05 21:44/chapters/oakland/maybel.html
27 29/Jun/05 21:43/chapters/oakland/queen.html
27 29/Jun/05 13:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/vet_talk.jpg
27 29/Jun/05 21:42/chapters/oakland/winky.html
27 29/Jun/05 21:43/chapters/oakland/rusty.html
27 29/Jun/05 14:04/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Red_wagon_3.JPG
27 29/Jun/05 11:41/rabbit-center/hayward_rescue/hayward_graphics/da-1.jpg
27 29/Jun/05 14:08/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Basket_of_toys.JPG
27 29/Jun/05 21:46/chapters/oakland/george.html
27 29/Jun/05 21:43/chapters/oakland/siouxsie.html
27 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Zodiac_Pendant.jpg
27 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Auction_browsing_small.JPG
27 29/Jun/05 15:13/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/eng-spot-climbing-out.jpg
27 29/Jun/05 13:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Vet_talk2.JPG
27 29/Jun/05 18:51/chapters/san-diego/aboutus/bunnyfest/bfest_photos/mats.jpg
27 29/Jun/05 05:30/graphics/calendars/0763149349.jpg
27 28/Jun/05 04:49/graphics/easter/rabbit.gif
26 29/Jun/05 14:03/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/shuttle-sign.jpg
26 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Jensen_speaks_small.JPG
26 29/Jun/05 14:04/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Sarah_Sedgewick.JPG
26 28/Jun/05 04:58/chapters/san-diego/aboutus/Membership_Form.pdf
26 29/Jun/05 14:44/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/white-buns-on-grass.jpg
26 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Jodi_Jensen_Booth2_small.JPG
26 29/Jun/05 11:54/press-kit/background-info.html
26 28/Jun/05 09:27/graphics/easter/victoria.jpg
26 29/Jun/05 11:29/hrs-info/yesterdays-news.html
26 29/Jun/05 13:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/people_1.jpg
26 29/Jun/05 14:07/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/CRM_booth_2.JPG
26 29/Jun/05 21:42/chapters/oakland/skylark.html
26 29/Jun/05 14:45/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Little_girl &Jean.jpg
26 29/Jun/05 13:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/red-wagon.jpg
26 29/Jun/05 14:46/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Bunnies_under_table.JPG
26 29/Jun/05 18:51/chapters/san-diego/aboutus/bunnyfest/bfest_photos/CC1_250_333.jpg
26 29/Jun/05 18:51/chapters/san-diego/aboutus/bunnyfest/bfest_photos/p1010035.jpg
26 29/Jun/05 21:44/chapters/oakland/kiri.html
26 29/Jun/05 12:13/hrs-info/rhn.html
26 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Cottontail_cottage.jpg
26 29/Jun/05 13:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/himalyan.jpg
26 26/Jun/05 06:50/graphics/breeds/abby-mini-lop-sf.jpg
26 29/Jun/05 18:51/chapters/san-diego/aboutus/bunnyfest/bfest_photos/p1010030.jpg
26 29/Jun/05 15:32/graphics/billboard1.jpg
26 29/Jun/05 18:51/chapters/san-diego/adoption/graphics/Misha_stuffed_bunny.JPG
25 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Dedham_jewelry.JPG
25 29/Jun/05 15:06/chapters/oakland/aboutush.gif
25 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/RadioRabbit.jpg
25 29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_RaindropRomeo3_Jun05.jpg
25 29/Jun/05 11:49/easter/yahoo.html
25 29/Jun/05 22:17/rabbit-center/adoptables/graphics/big/valentino02sml.jpg
25 29/Jun/05 20:31/chapters/san-diego/aboutus/Membership_Form.rtf
25 29/Jun/05 21:41/chapters/oakland/wookie.html
25 29/Jun/05 01:16/chapters/san-diego/aboutus/bunnyfest/bfest_auction.html
25 29/Jun/05 07:17/chapters/san-diego/adoption/Adoption_Photos/HRS_Oreo_2_2Nov03.JPG
25 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Bfest_Crowd_4_small.JPG
25 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/CountryPrints.jpg
25 29/Jun/05 09:58/hrs-info/tenth-leap/individual-thanks.html
25 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/kw_cages_small.jpg
25 29/Jun/05 10:57/rabbit-center/adoptables/graphics/big/becky07sml.jpg
25 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Bfest_Crowd_3_small.JPG
25 29/Jun/05 05:56/easter/yahooligans.html
25 29/Jun/05 23:07/chapters/san-diego/adoption/Adoption_Photos/HRS_Meadow_3_20Jun05.jpg
24 29/Jun/05 15:23/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/HouseRabbitPuzzle.jpg
24 28/Jun/05 05:25/translations/japanese/emergencies-j.html
24 29/Jun/05 15:06/chapters/oakland/poster.jpg
24 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Bfest_Crowd_7_small.JPG
24 28/Jun/05 07:40/chapters/michigan/ac.html
24 29/Jun/05 14:10/rabbit-center/castro_valley_media_alert.html
24 29/Jun/05 11:54/easter/thanks99.html
24 29/Jun/05 07:20/journal/4-5/graphics/snuggle-habitat.jpg
24 29/Jun/05 06:40/rabbit-center/adoptables/graphics/big/sylvia28sml.jpg
24 29/Jun/05 14:05/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Red_wagon_2.JPG
24 29/Jun/05 10:27/chapters/oakland/join.html
24 29/Jun/05 21:46/chapters/oakland/gracie.html
24 29/Jun/05 22:17/rabbit-center/adoptables/graphics/big/juliette32sml.jpg
24 29/Jun/05 23:39/graphics/awards/50easter.gif
24 28/Jun/05 15:34/chapters/san-diego/adoption/Adoption_Photos/Butterscotch_adoption_Apr04.jpg
24 29/Jun/05 22:17/rabbit-center/adoptables/graphics/big/latte-sml.jpg
24 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Bfest_Crowd_2_small.JPG
24 29/Jun/05 14:05/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Red_wagon_1.JPG
23 29/Jun/05 15:06/chapters/oakland/tshirt.gif
23 28/Jun/05 09:27/graphics/easter/anti-victoria.jpg
23 29/Jun/05 05:26/easter/flyer/flyers.html
23 29/Jun/05 18:51/chapters/san-diego/aboutus/bunnyfest/bfest_photos/HRS_Misha_and_friend.JPG
23 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Abby_and_Friend_small.JPG
23 29/Jun/05 18:51/chapters/san-diego/aboutus/bunnyfest/bfest_photos/Peanut_toy_1.JPG
23 29/Jun/05 18:51/chapters/san-diego/aboutus/bunnyfest/North_Kylie_2_11Nov02.JPG
23 29/Jun/05 15:46/rabbit-center/retail/store2L.jpg
23 0.01%29/Jun/05 22:17/rabbit-center/adoptables/images/mazi_big.gif
23 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/2_Siamese_Lops_1_small.JPG
23 29/Jun/05 10:58/chapters/san-francisco/graphics/adopted/domirudy.jpg
23 29/Jun/05 11:02/care/vhd-letter.html
23 29/Jun/05 10:56/chapters/san-francisco/graphics/adopted/heidi.jpg
22 29/Jun/05 12:11/rabbit-center/letters_to_lucky.html
22 29/Jun/05 12:18/cgi-bin/search
22 29/Jun/05 10:54/chapters/san-francisco/graphics/adopted/molly.jpg
22 29/Jun/05 10:57/chapters/san-francisco/graphics/adopted/gillian.jpg
22 29/Jun/05 22:17/rabbit-center/adoptables/graphics/big/julie03sml.jpg
22 29/Jun/05 05:19/journal/4-5/graphics/habitat.jpg
22 29/Jun/05 05:21/journal/4-5/graphics/bunz.jpg
22 28/Jun/05 07:27/rabbit-center/job-description.html
22 29/Jun/05 10:15/chapters/san-francisco/graphics/adopted/cory.jpg
22 29/Jun/05 21:43/chapters/oakland/scotia.html
22 29/Jun/05 10:14/chapters/san-francisco/graphics/adopted/thad.jpg
22 29/Jun/05 10:52/chapters/san-francisco/graphics/adopted/tabit.jpeg
22 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Bfest_Crowd_6_small.JPG
22 29/Jun/05 10:53/chapters/san-francisco/graphics/adopted/panda.jpeg
22 29/Jun/05 10:15/chapters/san-francisco/graphics/adopted/nim.jpg
22 29/Jun/05 15:35/graphics/gallery/adopted1.gif
22 29/Jun/05 02:48/rabbit-center/rabbit_ofthe_month/
22 29/Jun/05 10:59/chapters/san-francisco/graphics/adopted/d-tort-2-i.gif
22 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Bfest_Crowd_5_small.JPG
22 29/Jun/05 10:53/chapters/san-francisco/graphics/adopted/quentin.jpg
22 29/Jun/05 11:00/chapters/san-francisco/graphics/adopted/blondi.jpeg
22 29/Jun/05 13:48/chapters/san-francisco/graphics/adoptables/Aug02/SF_Corky_Jul02.JPG
22 29/Jun/05 10:53/chapters/san-francisco/graphics/adopted/nico.jpeg
22 29/Jun/05 22:17/rabbit-center/adoptables/graphics/big/annie05sml.jpg
22 29/Jun/05 10:14/chapters/san-francisco/graphics/adopted/toby.jpg
22 28/Jun/05 07:42/rabbit-center/adoptables/graphics/big/r1017mini81sml.jpg
22 29/Jun/05 07:39/graphics/mine/foo/foo-digi.gif
22 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/2_Spotted_Buns_small.JPG
22 29/Jun/05 05:20/journal/4-5/graphics/door.jpg
22 29/Jun/05 10:52/chapters/san-francisco/graphics/adopted/stuart.jpg
22 29/Jun/05 01:54/journal/4-5/graphics/map.jpg
22 29/Jun/05 10:59/chapters/san-francisco/graphics/adopted/darby.jpeg
22 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Bfest_Crowd_small.JPG
22 29/Jun/05 06:59/journal/3-1/graphics/rescue.gif
22 29/Jun/05 10:56/chapters/san-francisco/graphics/adopted/jeremiah.gif
22 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/auction_small.jpg
22 29/Jun/05 14:37/chapters/san-francisco/graphics/adoptables/Aug02/SF_Nicolette_2_Jul02.JPG
22 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Bunny_Basket_small.JPG
22 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Bfest_Crowd_8_small.JPG
22 28/Jun/05 06:41/easter/press-release.html
21 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/BJ_Buster_small.JPG
21 29/Jun/05 11:01/chapters/san-francisco/graphics/adopted/alaska1.gif
21 29/Jun/05 15:08/chapters/san-francisco/graphics/adoptables/Aug02/SF_Chelsea_Chloe_2_Jul02.JPG
21 29/Jun/05 12:11/chapters/san-francisco/graphics/adopted/coleen-meleny-5.gif
21 28/Jun/05 16:28/chapters/san-diego/adoption/Cage-Dolce_small.jpg
21 29/Jun/05 11:00/chapters/san-francisco/graphics/adopted/benjamin-1.gif
21 29/Jun/05 10:59/chapters/san-francisco/graphics/adopted/d-gray-2-i.gif
21 29/Jun/05 10:54/chapters/san-francisco/graphics/adopted/maggie-1.gif
21 29/Jun/05 10:51/chapters/san-francisco/graphics/adopted/whitney-3.gif
21 29/Jun/05 13:14/chapters/san-francisco/graphics/adoptables/09/AUT_3060.JPG
21 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/fl00220_.jpg
21 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/BJ_Buster_2_small.JPG
21 29/Jun/05 14:36/chapters/san-francisco/graphics/adoptables/Aug02/SF_Nicolette_Jul02.JPG
21 29/Jun/05 10:54/chapters/san-francisco/graphics/adopted/marcus-1.gif
21 29/Jun/05 23:21/rabbit-center/adoptables/graphics/big/george-r1397-34sml.jpg
21 29/Jun/05 13:48/chapters/san-francisco/graphics/adoptables/Aug02/SF_Amelia_Jul02.JPG
21 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Bunny_Babies_small.JPG
21 29/Jun/05 10:55/chapters/san-francisco/graphics/adopted/k-white-i.gif
21 29/Jun/05 10:56/chapters/san-francisco/graphics/adopted/hugo-1.gif
21 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/jenkins_small.jpg
21 29/Jun/05 10:57/chapters/san-francisco/graphics/adopted/gilbert-3.gif
21 29/Jun/05 19:03/chapters/san-diego/aboutus/bunnyfest/bunnyfest_2002.html
21 29/Jun/05 13:10/chapters/san-francisco/graphics/adoptables/feb02/sparkey.jpg
21 29/Jun/05 10:55/chapters/san-francisco/graphics/adopted/k-agouti-i.gif
21 29/Jun/05 12:11/chapters/san-francisco/graphics/adopted/pinky-perry-3.gif
21 28/Jun/05 16:28/chapters/san-diego/adoption/LeithPetwerks_condo_small.JPG
21 29/Jun/05 13:14/chapters/san-francisco/graphics/adoptables/09/AUT_3053.JPG
21 29/Jun/05 12:11/chapters/san-francisco/graphics/adopted/d-black-lop-i.gif
21 29/Jun/05 15:07/chapters/san-francisco/graphics/adoptables/Aug02/SF_Chelsea_Chloe_4_Jul02.JPG
21 29/Jun/05 22:17/rabbit-center/adoptables/graphics/big/timothy27sml.jpg
21 29/Jun/05 10:58/chapters/san-francisco/graphics/adopted/dolly-1.gif
21 27/Jun/05 20:42/links/missionfish.html
21 29/Jun/05 11:00/chapters/san-francisco/graphics/adopted/cody-3.gif
21 29/Jun/05 15:08/chapters/san-francisco/graphics/adoptables/Aug02/SF_Chelsea_Chloe_3_Jul02.JPG
20 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/big_grin_small.jpg
20 27/Jun/05 18:45/graphics/digital-logo.gif
20 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Siamese_Lop_small.JPG
20 28/Jun/05 16:28/chapters/san-diego/adoption/Bess_cage_small.JPG
20 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Harlequin_and_Sandi.JPG
20 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Black_Rex_2_small.JPG
20 28/Jun/05 16:28/chapters/san-diego/adoption/Patio_setup_1_small.JPG
20 28/Jun/05 00:45/rabbit-center/lucky_margo-article.html
20 29/Jun/05 02:07/rabbit-center/rabbit_ofthe_month/common/_notes/
20 29/Jun/05 13:12/chapters/san-francisco/graphics/adoptables/feb02/dandelion.jpg
20 28/Jun/05 16:28/chapters/san-diego/adoption/Open_pen_small.JPG
20 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Maggie_Eddy_small.JPG
20 29/Jun/05 15:21/journal/3-4/graphics/
20 28/Jun/05 16:28/chapters/san-diego/adoption/Patio_setup_5_small.JPG
20 28/Jun/05 16:28/chapters/san-diego/adoption/Pen_condo_small.JPG
20 29/Jun/05 13:15/chapters/san-francisco/graphics/adoptables/07/AUT_3016.JPG
20 26/Jun/05 20:32/chapters/san-francisco/adopt.jpeg
20 28/Jun/05 03:40/rabbit-center/rabbit_ofthe_month/_baks/_notes/
20 28/Jun/05 09:19/graphics/cal-front.jpg
20 28/Jun/05 16:28/chapters/san-diego/adoption/Libby_cage_small.JPG
20 28/Jun/05 16:28/chapters/san-diego/adoption/Tina_hallway_cage_small.JPG
20 29/Jun/05 13:15/chapters/san-francisco/graphics/adoptables/07/AUT_3014.JPG
20 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Washing-Up_small.JPG
20 29/Jun/05 12:37/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Young_Woman_BrnBun_small.jpg
20 29/Jun/05 19:04/chapters/san-diego/aboutus/bunnyfest/bfest_photo_contest.html
20 29/Jun/05 21:20/cgi-bin/suid/~rabbit2/email-article.cgi
20 29/Jun/05 14:38/chapters/san-francisco/graphics/adoptables/Aug02/SF_Corky_2_Jul02.JPG
20 28/Jun/05 14:46/translations/japanese/age-related-behavior-j.html
20 26/Jun/05 20:32/chapters/san-francisco/graphics/adopted/SF_Rocky_1_Feb05.jpg
20 26/Jun/05 20:32/chapters/san-francisco/graphics/adopted/SF_Amelie_2_Feb05.jpg
20 28/Jun/05 14:53/rabbit-center/adoptables/graphics/big/colby r1423 03sml.jpg
12776 0.52%29/Jun/05 23:40[not listed: 4,348 files]