Web Server Statistics for House Rabbit Society

Program started at Fri-30-Sep-2005 03:10.
Analysed requests from Thu-01-Sep-2005 00:08 to Fri-30-Sep-2005 00:07 (29.00 days).

General Summary

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report contains overall statistics.

Figures in parentheses refer to the 7-day period ending 30-Sep-2005 03:10.

Successful requests: 7,152,568 (1,903,738)
Average successful requests per day: 246,646 (271,962)
Successful requests for pages: 1,446,716 (395,834)
Average successful requests for pages per day: 49,887 (56,547)
Failed requests: 240,832 (62,275)
Redirected requests: 13,837 (3,674)
Distinct files requested: 13,794 (8,566)
Distinct hosts served: 239,709 (67,306)
Corrupt logfile lines: 120
Data transferred: 72.13 gigabytes (19.33 gigabytes)
Average data transferred per day: 2.49 gigabytes (2.76 gigabytes)

Monthly Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the activity in each month.

Each unit (+) represents 40,000 requests for pages or part thereof.

monthreqspages 
Sep 200571525681446716+++++++++++++++++++++++++++++++++++++

Busiest month: Sep 2005 (1,446,716 requests for pages).

Daily Summary

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the total activity for each day of the week, summed over all the weeks in the report.

Each unit (+) represents 6,000 requests for pages or part thereof.

dayreqspages 
Sun952817200098++++++++++++++++++++++++++++++++++
Mon1044169214756++++++++++++++++++++++++++++++++++++
Tue1050375201312++++++++++++++++++++++++++++++++++
Wed1047896212891++++++++++++++++++++++++++++++++++++
Thu1220652246450++++++++++++++++++++++++++++++++++++++++++
Fri921560190705++++++++++++++++++++++++++++++++
Sat915099180504+++++++++++++++++++++++++++++++

Hourly Summary

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the total activity for each hour of the day, summed over all the days in the report.

Each unit (+) represents 2,500 requests for pages or part thereof.

hourreqspages 
012659627433+++++++++++
112676627542++++++++++++
212854732631++++++++++++++
312154927043+++++++++++
414618030745+++++++++++++
519998843121++++++++++++++++++
625837654679++++++++++++++++++++++
730221762774++++++++++++++++++++++++++
832721265136+++++++++++++++++++++++++++
934787273567++++++++++++++++++++++++++++++
1039256178591++++++++++++++++++++++++++++++++
1140696385571+++++++++++++++++++++++++++++++++++
1241502790488+++++++++++++++++++++++++++++++++++++
1341443684773++++++++++++++++++++++++++++++++++
1438189081023+++++++++++++++++++++++++++++++++
1537819282519++++++++++++++++++++++++++++++++++
1639731583624++++++++++++++++++++++++++++++++++
1740830480027+++++++++++++++++++++++++++++++++
1840749674890++++++++++++++++++++++++++++++
1940644468217++++++++++++++++++++++++++++
2040713166296+++++++++++++++++++++++++++
2128098452645++++++++++++++++++++++
2219677839214++++++++++++++++
2317374434167++++++++++++++

Domain Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the countries of the computers which requested files.

Listing domains, sorted by the amount of traffic.

reqs%bytesdomain
317605342.45%.net (Networks)
168108223.33%.com (Commercial)
95923213.16%[unresolved numerical addresses]
236414 2.92%.edu (USA Higher Education)
170460 2.73%.ca (Canada)
173674 2.18%.uk (United Kingdom)
117538 1.59%.au (Australia)
32716 1.36%.fr (France)
74289 1.01%.org (Non Profit Making Organisations)
66193 0.94%.us (United States)
32320 0.62%.nl (Netherlands)
29350 0.52%.de (Germany)
14816 0.49%.be (Belgium)
21767 0.48%.it (Italy)
17738 0.41%.fi (Finland)
24480 0.37%.jp (Japan)
22146 0.36%.gov (USA Government)
21820 0.32%.sg (Singapore)
18266 0.31%.pl (Poland)
19576 0.31%.mil (USA Military)
25050 0.30%.nz (New Zealand)
13142 0.29%.mx (Mexico)
11020 0.25%.se (Sweden)
7009 0.21%.pe (Peru)
7107 0.20%.ch (Switzerland)
12871 0.20%.my (Malaysia)
9287 0.20%.br (Brazil)
8426 0.16%.no (Norway)
11248 0.15%.hu (Hungary)
4338 0.14%.ma (Morocco)
10673 0.13%.th (Thailand)
4642 0.12%.pt (Portugal)
5862 0.12%.hr (Croatia)
5708 0.11%.dk (Denmark)
12462 0.10%.ee (Estonia)
4282 0.10%.es (Spain)
4425 0.09%.ro (Romania)
5337 0.09%.tr (Turkey)
2410 0.09%.cl (Chile)
3451 0.08%.ar (Argentina)
3551 0.08%.at (Austria)
5165 0.07%.il (Israel)
3249 0.07%.ru (Russia)
3745 0.07%.tw (Taiwan)
6179 0.06%.gr (Greece)
5142 0.05%.id (Indonesia)
3832 0.05%.hk (Hong Kong)
3129 0.04%.cz (Czech Republic)
1927 0.04%.co (Colombia)
3002 0.04%.ph (Philippines)
2720 0.03%.arpa (Arpanet)
1662 0.03%[unknown domain]
2358 0.03%[domain not given]
3387 0.03%.in (India)
1026 0.03%.sk (Slovakia)
1619 0.03%.sa (Saudi Arabia)
1463 0.02%.lu (Luxembourg)
1677 0.02%.is (Iceland)
1308 0.02%.mt (Malta)
1904 0.02%.za (South Africa)
1264 0.02%.tt (Trinidad and Tobago)
1097 0.01%.cy (Cyprus)
566 0.01%.vn (Vietnam)
899 0.01%.ie (Ireland)
738 0.01%.lt (Lithuania)
536 0.01%.tv (Tuvalu)
689 0.01%.lv (Latvia)
527 0.01%.bg (Bulgaria)
613 0.01%.si (Slovenia)
475 0.01%.gt (Guatemala)
748 0.01%.uy (Uruguay)
283 0.01%.do (Dominican Republic)
608 0.01%.yu (Former Yugoslavia)
422 0.01%.pk (Pakistan)
156 .info (Informational)
180 .ad (Andorra)
103 .ni (Nicaragua)
274 .int (International Treaty Organisations)
161 .bw (Botswana)
334 .ae (United Arab Emirates)
299 .cr (Costa Rica)
166 .gh (Ghana)
159 .np (Nepal)
131 .nu (Niue)
190 .ua (Ukraine)
108 .om (Oman)
282 .zm (Zambia)
157 .aw (Aruba)
139 .py (Paraguay)
256 .ba (Bosnia-Herzegovina)
259 .tz (Tanzania)
207 .cc (Cocos (Keeling) Islands)
32 .ws (Samoa)
109 .qa (Qatar)
58 .ve (Venezuela)
252 .mu (Mauritius)
176 .jo (Jordan)
158 .lb (Lebanon)
72 .hn (Honduras)
39 .ac (Ascension Island)
120 .vi (Virgin Islands (USA))
146 .gy (Guyana)
109 .name (Individuals)
113 .lk (Sri Lanka)
62 .cn (China)
62 .biz (Businesses)
62 .ky (Cayman Islands)
11 .pf (French Polynesia)
2 .an (Netherlands Antilles)
47 .dm (Dominica)
69 .ec (Ecuador)
99 .ke (Kenya)
93 .eg (Egypt)
2 .bs (Bahamas)
58 .ge (Georgia)
15 .bo (Bolivia)
85 .bm (Bermuda)
69 .kr (South Korea)
21 .na (Namibia)
50 .to (Tonga)
23 .hm (Heard and McDonald Islands)
15 .bz (Belize)
66 .zw (Zimbabwe)
62 .mv (Maldives)
50 .kz (Kazakhstan)
5 .li (Liechtenstein)
23 .ci (Ivory Coast)
11 .su (Former USSR)
19 .by (Belarus)
65 .md (Moldova)
10 .sv (El Salvador)
34 .gg (Guernsey)
29 .cu (Cuba)
31 .mz (Mozambique)
11 .coop (Co-operatives)
4 .mn (Mongolia)
9 .bn (Brunei Darussalam)
21 .bd (Bangladesh)
24 .aero (Air Transport Industry)
12 .fj (Fiji)
15 .pg (Papua New Guinea)
2 .cx (Christmas Island)
1 .er (Eritrea)
13 .pr (Puerto Rico)
22 .vu (Vanuatu)
2 .dz (Algeria)
11 .sm (San Marino)
10 .kh (Cambodia)
12 .mk (Macedonia (Former Yugoslav Republic))
3 .am (Armenia)
1 .tc (Turks and Caicos Islands)
2 .nc (New Caledonia)
1 .sy (Syria)
1 .tp (East Timor)
1 .gl (Greenland)
4 .sc (Seychelles)
1 .je (Jersey)

Organisation Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the organisations of the computers which requested files.

Listing the top 20 organisations by the number of requests, sorted by the number of requests.

reqs%bytesorganisation
667944 8.70%comcast.net
373666 5.44%rr.com
280123 4.15%pacbell.net
250202 3.77%aol.com
245907 3.07%verizon.net
214036 3.05%cox.net
167603 2.09%charter.com
131181 1.93%adelphia.net
112936 1.50%optonline.net
104855 1.09%ameritech.net
100442 1.31%bellsouth.net
85621 1.06%btcentralplus.com
81840 1.05%swbell.net
77586 1.11%sympatico.ca
77017 0.71%level3.net
76297 1.12%shawcable.net
75228 0.87%qwest.net
73155 0.98%rogers.com
71428 1.40%ntli.net
57966 0.73%blueyonder.co.uk
382753554.86%[not listed: 21,654 organisations]

Search Word Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists which words people used in search engines to find the site.

Listing the top 30 query words by the number of requests, sorted by the number of requests.

reqssearch term
51644rabbit
33269rabbits
10278bunny
8055language
8008body
7748baby
7016care
6892house
6637of
5940bunnies
5734a
5496pictures
4527to
3940how
3928society
3640for
2947in
2547wild
2380pet
2181what
2116and
1793the
1782do
1568litter
1419facts
1352cute
1299training
1259is
1251about
1083kaninchen
144102[not listed: 9,148 search terms]

Operating System Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the operating systems used by visitors.

Listing operating systems, sorted by the number of requests for pages.

no.reqspagesOS
165930231282024Windows
 53313981045575  Windows XP
 671120133620  Windows 2000
 40110467731  Windows 98
 12962524049  Windows ME
 209973833  Windows NT
 175502971  Windows Server 2003
 99462261  Windows 95
 104351870  Unknown Windows
 822111  Windows CE
 263  Windows 3.1
236535274552Macintosh
36030346191Known robots
46506533459OS unknown
5369167986Unix
 338407284  Linux
 2482413  SunOS
 584281  BSD
 55  Other Unix
 33  HP-UX
 10  AIX
 10  IRIX
61375341WebTV
79464Symbian OS
83535Amiga
98717RISC OS
1044BeOS
11111OS/2

Status Code Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the HTTP status codes of all requests.

Listing status codes, sorted numerically.

reqsstatus code
6059898200 OK
14349206 Partial content
11967301 Document moved permanently
1870302 Document found elsewhere
1078321304 Not modified since last retrieval
303400 Bad request
31401 Authentication required
8403 Access forbidden
239753404 Document not found
183405 Method not allowed
432408 Request timeout
13414 Requested filename too long
102416 Requested range not valid
6500 Internal server error
1501 Request type not supported

File Size Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the sizes of files.

sizereqs%bytes
01110912 
1B- 10B512 
11B- 100B226265 0.02%
101B- 1kB1312683 0.57%
1kB- 10kB252936316.57%
10kB-100kB189819464.15%
100kB- 1MB7413917.81%
1MB- 10MB500 0.88%

File Type Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the extensions of files.

Listing extensions with at least 0.1% of the traffic, sorted by the amount of traffic.

reqs%bytesextension
128948146.35%.jpg [JPEG graphics]
34187117.25%[directories]
109944613.97%.html [Hypertext Markup Language]
366678612.99%.gif [GIF graphics]
69404 3.41%.JPG
475550 2.66%.cgi [CGI scripts]
6488 2.30%.pdf [Adobe Portable Document Format]
2568 0.37%.bmp
14028 0.28%.png [PNG graphics]
186946 0.43%[not listed: 25 extensions]

Directory Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the directories from which files were requested. (The figures for each directory include all of its subdirectories.)

Listing directories with at least 0.01% of the traffic, sorted by the amount of traffic.

reqs%bytesdirectory
368799354.81%/graphics/
81528612.61%/chapters/
335677 8.24%/rabbit-center/
744189 7.14%/fun/
229012 3.52%/journal/
117656 2.67%/faq/
475169 2.64%/cgi-bin/
199290 2.62%[root directory]
88093 1.74%/care/
1179 0.98%/flyers/
25472 0.56%/hrs-info/
32116 0.43%/behavior/
32312 0.41%/links/
17971 0.32%/adoption/
16340 0.29%/health/
44873 0.26%/easter/
524 0.08%/adopt-a-rabbit-month/
6600 0.08%/translations/
3166 0.07%/foster-homes/
5453 0.07%/kids/
101255 0.07%/spam_vaccine/
2702 0.06%/help/
3748 0.05%/vets/
2338 0.05%/faqgerman/
24742 0.05%/styles/
124208 0.03%/icons/
2006 0.03%/opinion/
6260 0.03%/webmail/
2024 0.02%/stories/
1330 0.01%/postcard/
1606 0.01%/chat/
491 0.01%/caregerman/
1487 0.02%[not listed: 12 directories]

Request Report

(Go To: Top | General Summary | Monthly Report | Daily Summary | Hourly Summary | Domain Report | Organisation Report | Search Word Report | Operating System Report | Status Code Report | File Size Report | File Type Report | Directory Report | Request Report)

This report lists the files on the site.

Listing files with at least 20 requests, sorted by the number of requests.

reqs%byteslast timefile
682226 6.26%30/Sep/05 00:05/fun/net-bunnies.html
318250 2.34%29/Sep/05 21:41/cgi-bin/chat/chat.cgi
32884 0.21%22/Sep/05 06:40  /cgi-bin/chat/chat.cgi?action=chat&id=icypuqfwazpoqzberyoqcuhbdyjrpr
3257 0.01%23/Sep/05 14:38  /cgi-bin/chat/chat.cgi?action=chat&id=rcbrmlrkcvsnbcdboodbmeksanvvrw&pause=
2927 0.03% 8/Sep/05 23:14  /cgi-bin/chat/chat.cgi?action=chat&id=vzuajvkaetlchzhlyeedjtwvbviies
2812 0.02%18/Sep/05 17:46  /cgi-bin/chat/chat.cgi?action=chat&id=xyzbqsnbvspcoeqzondnzvrqpjefat
2773 0.02%20/Sep/05 20:41  /cgi-bin/chat/chat.cgi?action=chat&id=tcrnploqzpfpfvzxfqiedlurktwfee
2202 0.02%17/Sep/05 23:09  /cgi-bin/chat/chat.cgi?action=chat&id=exhvsmlznvrcqgmbiatevjkkkcpdtb
2160 0.02%25/Sep/05 21:03  /cgi-bin/chat/chat.cgi?action=chat&id=xinlnixnwuxesqworsnlezwbpitoqg
1992 0.02% 5/Sep/05 21:19  /cgi-bin/chat/chat.cgi?action=chat&id=zsgwfwsrmgujkncqbpessxypbfnvar
1944 0.02%26/Sep/05 22:24  /cgi-bin/chat/chat.cgi?action=chat&id=ewnefzfcpnilbhzpifymbwwrbpvfgu
1878 0.02%28/Sep/05 20:38  /cgi-bin/chat/chat.cgi?action=chat&id=wilpavidtunbcngwufcuacvcymsddp
1864 0.02%22/Sep/05 21:56  /cgi-bin/chat/chat.cgi?action=chat&id=fggrxoeksworftnbwsbosgpfxaequf
1743 0.02% 8/Sep/05 23:14  /cgi-bin/chat/chat.cgi?action=chat&id=rwztunudzuvwlqrzjgeexqlzridqjb
1726 0.01%24/Sep/05 21:59  /cgi-bin/chat/chat.cgi?action=chat&id=wqkzkkfgxliolhgmwlcxmeaipqcvyn
1675 0.01%24/Sep/05 21:59  /cgi-bin/chat/chat.cgi?action=chat&id=xopzkeotpfcsxixkidljovvvyrvqfv&pause=
1610  7/Sep/05 01:26  /cgi-bin/chat/chat.cgi?action=chat&id=dyyxkmxrffdkjsxevphtmwgzlqchcz&pause=
1601 0.01%25/Sep/05 20:40  /cgi-bin/chat/chat.cgi?action=chat&id=yxaiwragqsdcfulbvfmadadcxucmcu
1576 0.01% 3/Sep/05 20:48  /cgi-bin/chat/chat.cgi?action=chat&id=lvhvxtfbgsemmycomndegikudfiwji&pause=
1543  8/Sep/05 16:15  /cgi-bin/chat/chat.cgi?action=chat&id=nemrjldhknaopwasmmxmfgtwktapgf
1533 0.01%23/Sep/05 21:26  /cgi-bin/chat/chat.cgi?action=chat&id=kjzbjvwknzhtswippnaaoyapmdrdmv
1524 0.01%23/Sep/05 21:24  /cgi-bin/chat/chat.cgi?action=chat&id=bkgqvvnfzgtqncxdsvzwzmjdrlkidj
1453 0.01% 7/Sep/05 20:16  /cgi-bin/chat/chat.cgi?action=chat&id=urycoxjyztamglkrbfbxyxmzvrjqeq&pause=
1422 0.01% 8/Sep/05 21:53  /cgi-bin/chat/chat.cgi?action=chat&id=hpecyaggcevayyxkkrjfajfbphoxlk
1419 0.01%25/Sep/05 20:12  /cgi-bin/chat/chat.cgi?action=chat&id=lhkrcpresnlwbahqlmncmabbvwukfy
1272 0.01%25/Sep/05 14:28  /cgi-bin/chat/chat.cgi?action=chat&id=fsrtlllcgtnfqkdmvyczroqwflqgwo
1252 0.01%23/Sep/05 21:24  /cgi-bin/chat/chat.cgi?action=chat&id=uiterdzjostqvrzegfgbrgrdqosaqa
1228 0.01% 5/Sep/05 21:00  /cgi-bin/chat/chat.cgi?action=chat&id=npazjmkmhcaotqmdtjdlavdmfiinjf
1227 0.01% 5/Sep/05 21:39  /cgi-bin/chat/chat.cgi?action=chat&id=izduanoggitywktcljlyenqawclsas&pause=
1193 0.01%26/Sep/05 21:57  /cgi-bin/chat/chat.cgi?action=chat&id=qcsrvuzadnkvokxohqzwjqnueicrsz
1168 0.01%17/Sep/05 21:30  /cgi-bin/chat/chat.cgi?action=chat&id=irrczkjtcsynjuaungriszklwqrbxy
1152 0.01%22/Sep/05 21:52  /cgi-bin/chat/chat.cgi?action=chat&id=mjfkyuywmozugkawkxfqrtkzcdcwdg
1137 0.01%29/Sep/05 19:10  /cgi-bin/chat/chat.cgi?action=chat&id=brggekydwnzeaghgougauglpnwzxkr&pause=
1111 0.01%11/Sep/05 21:18  /cgi-bin/chat/chat.cgi?action=chat&id=otatlqskkxxxsdcljylmnwcagmhslp
1105 0.01%20/Sep/05 18:43  /cgi-bin/chat/chat.cgi?action=chat&id=vbwkqtkpicsgbdexkidyhzdzkvxxxp
1093 0.01%13/Sep/05 19:56  /cgi-bin/chat/chat.cgi?action=chat&id=tqcwygmcgljlqywpooalnnzyqzclep&pause=
1085 0.01%15/Sep/05 20:38  /cgi-bin/chat/chat.cgi?action=chat&id=vurjeifpzfzaoeuklxladpgstpcpmm
1079 25/Sep/05 08:45  /cgi-bin/chat/chat.cgi?action=chat&id=gsdyawlnknjuvxhtvwiyqbfiwtkefw&pause=
1071 0.01% 1/Sep/05 20:56  /cgi-bin/chat/chat.cgi?action=chat&id=dbblfftqcpjjmzxfgcxatdhkjrwfwm
1066 0.01% 2/Sep/05 21:44  /cgi-bin/chat/chat.cgi?action=chat&id=agkjgakgwiedclvsqxwliqcqlscden
1061 0.01%26/Sep/05 21:57  /cgi-bin/chat/chat.cgi?action=chat&id=nxiwnayjaiysefjethkgmdosnxcbwl&pause=
1055 0.01% 2/Sep/05 19:13  /cgi-bin/chat/chat.cgi?action=chat&id=hdnvnhvxuwmunhbbftoedomidrlgqt
1053 0.01%18/Sep/05 19:03  /cgi-bin/chat/chat.cgi?action=chat&id=bikzglcdrfijcxwywveckfpsxozxqt
1039 0.01%29/Sep/05 21:15  /cgi-bin/chat/chat.cgi?action=chat&id=htjpzbunjxdgyjzbmpqlyvyilgflaw&pause=
1027 0.01%27/Sep/05 15:39  /cgi-bin/chat/chat.cgi?action=chat&id=lzswvtyijyqddkkrgwkpgvixqwxuru
1023 25/Sep/05 11:24  /cgi-bin/chat/chat.cgi?action=chat&id=yugfuxauxxghscabdvifarggbquans&pause=
1021 0.01%20/Sep/05 20:39  /cgi-bin/chat/chat.cgi?action=chat&id=vxnpwuslqglaaegmmkswgynxxjiznv
1007 0.01% 8/Sep/05 21:50  /cgi-bin/chat/chat.cgi?action=chat&id=bhgfpjcxrfmlhauqunqotwzbepfcjr&pause=
997 0.01%28/Sep/05 18:46  /cgi-bin/chat/chat.cgi?action=chat&id=ncrlprfnmtjjsbbdzjpaipsshdhsxi
997 0.01%18/Sep/05 19:48  /cgi-bin/chat/chat.cgi?action=chat&id=iocznsshhexkjgbsfncjtgcvbqrugy&pause=
996 0.01%12/Sep/05 21:08  /cgi-bin/chat/chat.cgi?action=chat&id=gqpxaxduvwxpqifeucqduugnogyodv
992 0.01%28/Sep/05 20:25  /cgi-bin/chat/chat.cgi?action=chat&id=gtvgkmuqfewghvtghnbnvdebckfsii&pause=
970 0.01% 5/Sep/05 19:45  /cgi-bin/chat/chat.cgi?action=chat&id=jveguedwptpczwptpauoeahhoocbzr
954 0.01%19/Sep/05 19:49  /cgi-bin/chat/chat.cgi?action=chat&id=xdkgxjdmvsxbxeropfdtwlicygwalt&pause=
936  4/Sep/05 10:46  /cgi-bin/chat/chat.cgi?action=chat&id=cxqaorotqhjtuhzwipouvnqfrvtymk
924 0.01%11/Sep/05 20:14  /cgi-bin/chat/chat.cgi?action=chat&id=hhesageltfwipmcegswpmzcmzwyrei
903 0.01%14/Sep/05 19:03  /cgi-bin/chat/chat.cgi?action=chat&id=dtytovtluhawrfufzhdvhuzufwupke
896 0.01%19/Sep/05 20:38  /cgi-bin/chat/chat.cgi?action=chat&id=fkwrnvgfvixgaqmqbkrlkvdcqgblfn
896 0.01%18/Sep/05 18:55  /cgi-bin/chat/chat.cgi?action=chat&id=clukhpskerrhbekipktftfuwrykgij
895 0.01% 2/Sep/05 20:02  /cgi-bin/chat/chat.cgi?action=chat&id=uzobmglyfgdzoriqowyrbaiqljhhfw&pause=
877 0.01%17/Sep/05 21:09  /cgi-bin/chat/chat.cgi?action=chat&id=rwbndjaieoaysmvstjhfedypmdzxsh&pause=
869 0.01%24/Sep/05 19:58  /cgi-bin/chat/chat.cgi?action=chat&id=zcdzrimpgosqjmpjkhukikyvkfsqyi
861 0.01%20/Sep/05 17:27  /cgi-bin/chat/chat.cgi?action=chat&id=vbwkqtkpicsgbdexkidyhzdzkvxxxp&pause=
856 0.01%24/Sep/05 10:15  /cgi-bin/chat/chat.cgi?action=chat&id=salxuzbukrtudzkuqoztzebghcqdat
832 0.01% 2/Sep/05 18:53  /cgi-bin/chat/chat.cgi?action=chat&id=dauxmyacmrsfpgezzyqiwcceawybez&pause=
826 0.01%26/Sep/05 20:49  /cgi-bin/chat/chat.cgi?action=chat&id=bssfzngkhgvrwnnoufbcfgxnywpubi
820 0.01%21/Sep/05 19:05  /cgi-bin/chat/chat.cgi?action=chat&id=nmgqgzglbaqkcveeiyeeaycngksvse
812 0.01% 7/Sep/05 20:14  /cgi-bin/chat/chat.cgi?action=chat&id=xnuibnulejfpaiumbrcckersidikkf&pause=
810 25/Sep/05 17:23  /cgi-bin/chat/chat.cgi?action=chat&id=qeavkhusmwdjkvzqxpkqqffrzxkyql
808 0.01%20/Sep/05 19:18  /cgi-bin/chat/chat.cgi?action=chat&id=iakrnxqfbjamflvfmsbgjpysomphnh&pause=
804 0.01%16/Sep/05 20:49  /cgi-bin/chat/chat.cgi?action=chat&id=oeztalflopoyebiplgqmigzqduzgup&pause=
801 0.01% 1/Sep/05 18:37  /cgi-bin/chat/chat.cgi?action=chat&id=dywiktsudvbrtpacsygqyrqzjxqsre&pause=
796  5/Sep/05 14:27  /cgi-bin/chat/chat.cgi?action=chat&id=aqvoqvptuzacpdxxtxzuojntkihroa
793 0.01%11/Sep/05 20:49  /cgi-bin/chat/chat.cgi?action=chat&id=pwiwhowfvmghikxketnmjeggwdbruh&pause=
792 0.01%16/Sep/05 21:17  /cgi-bin/chat/chat.cgi?action=chat&id=vkhxsnugknixuvzpsprdfoxnwktiho
782 0.01%27/Sep/05 21:15  /cgi-bin/chat/chat.cgi?action=chat&id=xszfwcrfinzyvizrvfupidzhmukula
781 0.01%11/Sep/05 21:17  /cgi-bin/chat/chat.cgi?action=chat&id=wnhfgfnzocvrgbaakxouufombdiewo
780 0.01%17/Sep/05 20:18  /cgi-bin/chat/chat.cgi?action=chat&id=fsuywepmajthlsvoptgjaqjobajxag
773 0.01%18/Sep/05 18:57  /cgi-bin/chat/chat.cgi?action=chat&id=mwpapzgygmaukbhtsffcitgntpdqmn
771 0.01%29/Sep/05 21:28  /cgi-bin/chat/chat.cgi?action=chat&id=eoyrbcvqxegwicznkahkcqrczfpyvm&pause=
769 0.01% 2/Sep/05 19:38  /cgi-bin/chat/chat.cgi?action=chat&id=dtpsdjzkkstayhjuhugcsvdygidrue&pause=
769 25/Sep/05 13:47  /cgi-bin/chat/chat.cgi?action=chat&id=bugridrqquureprdkvoualozslkyue&pause=
754 0.01%17/Sep/05 19:58  /cgi-bin/chat/chat.cgi?action=chat&id=umemqnghvxrtfscaekrfcyamgpctzx&pause=
754  9/Sep/05 23:44  /cgi-bin/chat/chat.cgi?action=chat&id=ojejzpveutcjtnhvxgwszlzxabtakm&pause=
743  5/Sep/05 17:25  /cgi-bin/chat/chat.cgi?action=chat&id=npazjmkmhcaotqmdtjdlavdmfiinjf&pause=
742 0.01%20/Sep/05 18:50  /cgi-bin/chat/chat.cgi?action=chat&id=naeagvwocmtvtnipdbccedeuziscpa&pause=
737 0.01% 7/Sep/05 21:23  /cgi-bin/chat/chat.cgi?action=chat&id=urycoxjyztamglkrbfbxyxmzvrjqeq
733 0.01% 2/Sep/05 21:44  /cgi-bin/chat/chat.cgi?action=chat&id=bcwgpoljwunzcbbdlrkccmcanywuux&pause=
732 0.01%25/Sep/05 18:45  /cgi-bin/chat/chat.cgi?action=chat&id=njvchyjlrkkzqtsxixxneqzgyhqndd&pause=
731 0.01%18/Sep/05 20:59  /cgi-bin/chat/chat.cgi?action=chat&id=xvamamcpkxojdnybluyjxujmlwdcgd
731  5/Sep/05 00:17  /cgi-bin/chat/chat.cgi?action=chat&id=hcgqnqcfjqecskmcugaamwtctseama&pause=
715 0.01%27/Sep/05 22:00  /cgi-bin/chat/chat.cgi?action=chat&id=uqsukbzvfnogpmadrvxayffuopdhse
706 0.01%25/Sep/05 18:01  /cgi-bin/chat/chat.cgi?action=chat&id=sgadotvzoowqcrgutslaxtpqffhidk
699 0.01%20/Sep/05 18:21  /cgi-bin/chat/chat.cgi?action=chat&id=jvigtifpxuhzrgqyalickazbkruzlp
697 0.01% 5/Sep/05 20:11  /cgi-bin/chat/chat.cgi?action=chat&id=cbzhirzypgoinlxytzcddkgsvsmurh
694 0.01% 7/Sep/05 20:46  /cgi-bin/chat/chat.cgi?action=chat&id=zzsdelhsvnwqmuvrmbdbqfghqxuctt
687 0.01%26/Sep/05 19:34  /cgi-bin/chat/chat.cgi?action=chat&id=ndsyjxrvfbazfrqyorrrfnvqsubxjn&pause=
681 0.01%25/Sep/05 17:40  /cgi-bin/chat/chat.cgi?action=chat&id=kvyabbgzteeqeboyqwnaepjyjfmlbq&pause=
678 0.01% 9/Sep/05 20:36  /cgi-bin/chat/chat.cgi?action=chat&id=qwaiikkcicngnmadnpwystgpqsrpmm&pause=
676 0.01%25/Sep/05 20:12  /cgi-bin/chat/chat.cgi?action=chat&id=mqcriodycmmeyukqaakxewwaltcyil
673 0.01%29/Sep/05 21:18  /cgi-bin/chat/chat.cgi?action=chat&id=qnjpbhhnvrlcwlqynpstlppgbmigvu
667 0.01%27/Sep/05 20:44  /cgi-bin/chat/chat.cgi?action=chat&id=sbofygbpkhwtnhrniobjzwupnjsudk&pause=
666 0.01% 4/Sep/05 19:01  /cgi-bin/chat/chat.cgi?action=chat&id=ajvjcaexxsqzxilxptseuawlgbqxsn
664 28/Sep/05 21:59  /cgi-bin/chat/chat.cgi?action=chat&id=xjapudtdvsxajwtgswttogpttarzdi
655 0.01% 8/Sep/05 18:53  /cgi-bin/chat/chat.cgi?action=chat&id=emboourftuxotfucspaodmnllspose
654 0.01%24/Sep/05 20:37  /cgi-bin/chat/chat.cgi?action=chat&id=oyeqlcbhsrfdyqaotinltlrjqdbmfd&pause=
650 0.01% 6/Sep/05 19:55  /cgi-bin/chat/chat.cgi?action=chat&id=imxhbwvvobrklgfziisxhupwiqzlag&pause=
648 0.01%19/Sep/05 20:29  /cgi-bin/chat/chat.cgi?action=chat&id=anlslebempfkxqzsejxigfgvxklinz
648 0.01% 5/Sep/05 19:00  /cgi-bin/chat/chat.cgi?action=chat&id=zucmvxmwnsvpkkkxhmtzbnpoktmdhz
648 0.01%13/Sep/05 20:53  /cgi-bin/chat/chat.cgi?action=chat&id=khcdzrwgpqnviexqtrxmxaqxizrfdr&pause=
647 0.01%17/Sep/05 22:15  /cgi-bin/chat/chat.cgi?action=chat&id=rboatzzcqlpzdixqzmqvmexjzftydt&pause=
644 0.01% 1/Sep/05 18:26  /cgi-bin/chat/chat.cgi?action=chat&id=cpeymvfqgfebazteamilpudihpjruz
638  3/Sep/05 21:03  /cgi-bin/chat/chat.cgi?action=chat&id=cgwphdkgigwqhxnprvjrcocoodwdpl&pause=
637 0.01%28/Sep/05 20:20  /cgi-bin/chat/chat.cgi?action=chat&id=rvirmvcpkbghktvdaxzkcnvhzvwdum
629 0.01% 4/Sep/05 19:17  /cgi-bin/chat/chat.cgi?action=chat&id=pqktxswzyklwufumdarapkquqrhxqy
629 27/Sep/05 20:22  /cgi-bin/chat/chat.cgi?action=chat&id=haucnzpyogxuyuumutvumtixiglpto&pause=
628 24/Sep/05 22:25  /cgi-bin/chat/chat.cgi?action=chat&id=uhdqokonhvkeyztwduthcfveidndew&pause=
626 24/Sep/05 21:59  /cgi-bin/chat/chat.cgi?action=chat&id=csuoynbkepbsigajyqmiahyhddffdp&pause=
623 0.01%22/Sep/05 21:52  /cgi-bin/chat/chat.cgi?action=chat&id=senqepyhhymjhnxqchawzdqihujvug
623 12/Sep/05 18:13  /cgi-bin/chat/chat.cgi?action=chat&id=hyejudemmfistjakuyaddkswqzoirx&pause=
619 0.01%23/Sep/05 21:12  /cgi-bin/chat/chat.cgi?action=chat&id=qycsxeoykpajrnemzfeunkyijrzvee&pause=
619 0.01%26/Sep/05 20:53  /cgi-bin/chat/chat.cgi?action=chat&id=xwpkitbwyuxjggjwbzbzoufgpmtzcl&pause=
618 0.01% 5/Sep/05 19:37  /cgi-bin/chat/chat.cgi?action=chat&id=ufxohltjfzltngbbxbhcktuyxtzpvs&pause=
610 21/Sep/05 17:59  /cgi-bin/chat/chat.cgi?action=chat&id=bdjfaexsprujfuxfaawrlwndhlpnxg&pause=
610 0.01% 4/Sep/05 21:00  /cgi-bin/chat/chat.cgi?action=chat&id=twmjxtcgmvlaubxguclwmokeyzkqwq
609 0.01%18/Sep/05 17:22  /cgi-bin/chat/chat.cgi?action=chat&id=mgnsaqsfspwthdwcvstzvhzsffyvvh&pause=
603 24/Sep/05 19:45  /cgi-bin/chat/chat.cgi?action=chat&id=wflhqansdumyohwewumqaorqgqxnml&pause=
602 24/Sep/05 09:01  /cgi-bin/chat/chat.cgi?action=chat&id=salxuzbukrtudzkuqoztzebghcqdat&pause=
601 0.01%28/Sep/05 19:02  /cgi-bin/chat/chat.cgi?action=chat&id=vdlxehtrvztdmnsrqlfevbqzidxqja
597 15/Sep/05 20:59  /cgi-bin/chat/chat.cgi?action=chat&id=mnrhmqheacbofkqkmggbbzxvujewfv
596 0.01%20/Sep/05 20:39  /cgi-bin/chat/chat.cgi?action=chat&id=hfwhyiicymqbiqmlefzrxzsfomqvft&pause=
594 0.01%28/Sep/05 19:02  /cgi-bin/chat/chat.cgi?action=chat&id=nhygsvnrravqvhadxhmncglkcgyfcm&pause=
592 18/Sep/05 20:59  /cgi-bin/chat/chat.cgi?action=chat&id=uoctqwbxrkshkgpruvjhjsanspmbjq
589 0.01%13/Sep/05 18:46  /cgi-bin/chat/chat.cgi?action=chat&id=cztvwukwvqrnkpbdyyfwhkiakmlitc
585 0.01%22/Sep/05 20:20  /cgi-bin/chat/chat.cgi?action=chat&id=hkggzgwudlxzlsqeikumrnjszaxnmp&pause=
585 17/Sep/05 22:17  /cgi-bin/chat/chat.cgi?action=chat&id=wfizxgpqmbekjzafdlvimyyimajsca&pause=
583  4/Sep/05 20:38  /cgi-bin/chat/chat.cgi?action=chat&id=zljpuagpfuwkrsiozepmvvzonjkpxn&pause=
576 19/Sep/05 18:05  /cgi-bin/chat/chat.cgi?action=chat&id=tqisccggolgvpwsivqkrpwpfxgsoov
572 15/Sep/05 20:32  /cgi-bin/chat/chat.cgi?action=chat&id=rjgaujpnoemhipmfmlezkttgmyrbqw&pause=
571 17/Sep/05 19:46  /cgi-bin/chat/chat.cgi?action=chat&id=yqksanhceerostjtrabvetoylcmeqf
570 25/Sep/05 19:37  /cgi-bin/chat/chat.cgi?action=chat&id=nyfppmfrutepgtkgbslnargyypcxkr&pause=
569 12/Sep/05 20:31  /cgi-bin/chat/chat.cgi?action=chat&id=hhornkkmjcifyngqdvachoctnglwwe&pause=
567  5/Sep/05 13:52  /cgi-bin/chat/chat.cgi?action=chat&id=aqvoqvptuzacpdxxtxzuojntkihroa&pause=
565  4/Sep/05 19:04  /cgi-bin/chat/chat.cgi?action=chat&id=bgzvnqigbimzofanajwwmegzgvlygk&pause=
564 23/Sep/05 21:16  /cgi-bin/chat/chat.cgi?action=chat&id=vkvhebgjwrziybhimfkgguufkgjizg&pause=
562 0.01%26/Sep/05 21:54  /cgi-bin/chat/chat.cgi?action=chat&id=iczywnxagqzjscpmycpliqlnlgsgcj&pause=
562 0.01%20/Sep/05 20:46  /cgi-bin/chat/chat.cgi?action=chat&id=glfrxswggrolihbjkxbixbbzcaapbf&pause=
559 27/Sep/05 19:58  /cgi-bin/chat/chat.cgi?action=chat&id=jlebqlalxanfilodvuhilwozafhmrf&pause=
559 24/Sep/05 22:15  /cgi-bin/chat/chat.cgi?action=chat&id=miextgzddxtybzgtcwzgvlpukufiee
559 28/Sep/05 16:34  /cgi-bin/chat/chat.cgi?action=chat&id=elmniyaxmxgthykhngwyurhfiyncdd&pause=
558  5/Sep/05 16:49  /cgi-bin/chat/chat.cgi?action=chat&id=kxxqmuljceguctikqptckdelnbfite
556 15/Sep/05 19:03  /cgi-bin/chat/chat.cgi?action=chat&id=qrropgpfeylfvnzuhprdbtfixgubwd
554 25/Sep/05 17:14  /cgi-bin/chat/chat.cgi?action=chat&id=gpwlkfjgemlvdcrcfubtmmkxajvcwa&pause=
551  3/Sep/05 20:34  /cgi-bin/chat/chat.cgi?action=chat&id=tpngvgfzqmjehqantxxeavhezijyod&pause=
548 28/Sep/05 20:13  /cgi-bin/chat/chat.cgi?action=chat&id=cbvkpbezllhtpkxhfegjvcrutidauo&pause=
547 12/Sep/05 18:00  /cgi-bin/chat/chat.cgi?action=chat&id=ruviygjedkrnbasurdyvzvxzvolkvy
545  5/Sep/05 21:19  /cgi-bin/chat/chat.cgi?action=chat&id=yfeztwmktottgbgkjwtivzmaaiaaco&pause=
544  7/Sep/05 21:14  /cgi-bin/chat/chat.cgi?action=chat&id=vnxedotawgzhgvhlxakbrhlowklfgj
543  9/Sep/05 18:42  /cgi-bin/chat/chat.cgi?action=chat&id=vnjfykvpcpgdcecstkponwthslvvda&pause=
542 22/Sep/05 17:43  /cgi-bin/chat/chat.cgi?action=chat&id=dodcmjkbocpjvlcnowmbwhwcyvwivb
542  8/Sep/05 22:16  /cgi-bin/chat/chat.cgi?action=chat&id=wmewhwoucxlrijytaxtrnxlcnqpoll
539 13/Sep/05 20:57  /cgi-bin/chat/chat.cgi?action=chat&id=ebmrxeuhishjfdzrqbdkuwxqmgnffd
536 14/Sep/05 20:15  /cgi-bin/chat/chat.cgi?action=chat&id=bkkedlchzfwmnlekpwgselvnrmctrs&pause=
535 17/Sep/05 19:05  /cgi-bin/chat/chat.cgi?action=chat&id=bkxvrvfdckvyexokvfjlfafcyxitjr
535  8/Sep/05 19:58  /cgi-bin/chat/chat.cgi?action=chat&id=bzdfxqehrnbuuzelkedgxmohtsomnc
533 0.01%17/Sep/05 23:11  /cgi-bin/chat/chat.cgi?action=chat&id=oqwbgopkorhiinyyjizbbgfgbjctqe
519 25/Sep/05 18:43  /cgi-bin/chat/chat.cgi?action=chat&id=gpwlkfjgemlvdcrcfubtmmkxajvcwa
519 23/Sep/05 17:19  /cgi-bin/chat/chat.cgi?action=chat&id=jobplskkzcipteiabmemskjvlabbuf
518  8/Sep/05 21:38  /cgi-bin/chat/chat.cgi?action=chat&id=ifhsfecnmztejzliltwwukjzzzvolx&pause=
514 13/Sep/05 20:07  /cgi-bin/chat/chat.cgi?action=chat&id=kymvdwofeiiemmwmepgkmknkjsicyf&pause=
510  4/Sep/05 14:44  /cgi-bin/chat/chat.cgi?action=chat&id=ifyathjkxifgddijladvtuybabzfpo
510 28/Sep/05 19:52  /cgi-bin/chat/chat.cgi?action=chat&id=jjxzcczpewfsldnbhaptjniwpgeosy
510  1/Sep/05 17:31  /cgi-bin/chat/chat.cgi?action=chat&id=sdrvnsyiajsejtozxsgmnzzhwvampo
509 22/Sep/05 20:46  /cgi-bin/chat/chat.cgi?action=chat&id=zejybzjiikfcdwjswchqdfezhpspmd&pause=
507 23/Sep/05 21:36  /cgi-bin/chat/chat.cgi?action=chat&id=kuvwzethruvxyijxnykstyjdatvbrs&pause=
506 10/Sep/05 20:29  /cgi-bin/chat/chat.cgi?action=chat&id=uurvyupkppruyrrwdzjiokptqqvhxn&pause=
505 21/Sep/05 20:44  /cgi-bin/chat/chat.cgi?action=chat&id=zezeedejhkdtqntickuvtirkkrjajw&pause=
502 24/Sep/05 11:48  /cgi-bin/chat/chat.cgi?action=chat&id=wccdxazpgoevxewyrjumgigtmuugtl&pause=
499 28/Sep/05 17:36  /cgi-bin/chat/chat.cgi?action=chat&id=hvzujdwpdlxjivvzyjdjpnhqqsxdjd
497 26/Sep/05 18:28  /cgi-bin/chat/chat.cgi?action=chat&id=ocpkhyerpmrkvndjbvtvfvpnihmill&pause=
493 20/Sep/05 20:09  /cgi-bin/chat/chat.cgi?action=chat&id=tkytscshlsniuymcsqsltbbzikodic&pause=
493 21/Sep/05 20:42  /cgi-bin/chat/chat.cgi?action=chat&id=xfvuiwlzgvsmswuzecegffnszrxuhs
492  3/Sep/05 19:43  /cgi-bin/chat/chat.cgi?action=chat&id=aytxozgjskiarxyavsaheqszblvjwh&pause=
491  9/Sep/05 20:42  /cgi-bin/chat/chat.cgi?action=chat&id=bvxevrzypulddmbylronosjntpeszv
491 10/Sep/05 20:58  /cgi-bin/chat/chat.cgi?action=chat&id=isrtccmhistkxtxnagmruncuathjkc
491 28/Sep/05 18:32  /cgi-bin/chat/chat.cgi?action=chat&id=tpsczsayuegwvdvtvuoaaqjopcjzeq
490  8/Sep/05 22:06  /cgi-bin/chat/chat.cgi?action=chat&id=cliijlzrtyzhsrphhcmawtlqyduqkz
489 28/Sep/05 22:02  /cgi-bin/chat/chat.cgi?action=chat&id=iwacwrwyiuzcezykadzyyncxdlwuuj
486 12/Sep/05 21:09  /cgi-bin/chat/chat.cgi?action=chat&id=zmnvirvvazcqsmggfzfuvzkketcbma
485 23/Sep/05 20:34  /cgi-bin/chat/chat.cgi?action=chat&id=fggthdlbbaaoafnnqlyzcuklxathwy&pause=
484 11/Sep/05 21:15  /cgi-bin/chat/chat.cgi?action=chat&id=iwtcgthgsxdfodgdrwibswdbeaiuxc&pause=
478 23/Sep/05 19:09  /cgi-bin/chat/chat.cgi?action=chat&id=upbdzftlijdgfagvhguyndaxanunxy&pause=
475 20/Sep/05 16:40  /cgi-bin/chat/chat.cgi?action=chat&id=kowpabnojzkbrqocrvegirpljhgtod
474  8/Sep/05 22:15  /cgi-bin/chat/chat.cgi?action=chat&id=gxdypivjdiifviwndvecldtmomsjau
470 21/Sep/05 20:31  /cgi-bin/chat/chat.cgi?action=chat&id=kusatzjukunlirranwxprjgfcqlkfq&pause=
465 19/Sep/05 21:09  /cgi-bin/chat/chat.cgi?action=chat&id=flcylyoqafgytchfqcmnzgixuwymyz&pause=
462 21/Sep/05 18:40  /cgi-bin/chat/chat.cgi?action=chat&id=heptfoagudjmvutgqwqerrnttqrjtv
461 17/Sep/05 21:13  /cgi-bin/chat/chat.cgi?action=chat&id=lrzrplmhssrrdlvfzmvarlannajrxq
458 20/Sep/05 18:29  /cgi-bin/chat/chat.cgi?action=chat&id=xpmmfpdwoblatnvsopqoeoxglnsfib&pause=
457 29/Sep/05 21:36  /cgi-bin/chat/chat.cgi?action=chat&id=gwjotgpntxxwjiyfffvjfealxojwwo
456 13/Sep/05 18:47  /cgi-bin/chat/chat.cgi?action=chat&id=sxanzzlthrvqhmgfisyrjbxmtvweyj&pause=
456  3/Sep/05 20:38  /cgi-bin/chat/chat.cgi?action=chat&id=xifwhxpouerimhhkftzpmpiauhhibp
455  8/Sep/05 19:54  /cgi-bin/chat/chat.cgi?action=chat&id=lvmavgsielbvibhefpufhmdiizccuf&pause=
452  6/Sep/05 16:42  /cgi-bin/chat/chat.cgi?action=chat&id=oclexwyfsoewraqecgdezymfvjsfse
451 19/Sep/05 20:31  /cgi-bin/chat/chat.cgi?action=chat&id=zntmyspezpovznwnxpgiyfczzjdafj&pause=
446 20/Sep/05 17:25  /cgi-bin/chat/chat.cgi?action=chat&id=qrlqzistjtmqqcrowjsraaevhnpzah&pause=
441 19/Sep/05 20:43  /cgi-bin/chat/chat.cgi?action=chat&id=ilnuqlwugwsblfkvbfletzfaklmdic
440 25/Sep/05 20:20  /cgi-bin/chat/chat.cgi?action=chat&id=eojheytbzgaxxsnutypxgjqsscesfe&pause=
437 17/Sep/05 22:32  /cgi-bin/chat/chat.cgi?action=chat&id=mplkjzorpcfwxqbhkumubeorlghypu
436  1/Sep/05 20:23  /cgi-bin/chat/chat.cgi?action=chat&id=wmrkbrsvyccyzlmttgzcqcvxmrsfky&pause=
433 28/Sep/05 21:59  /cgi-bin/chat/chat.cgi?action=chat&id=bqxpcdqthnkdctyzenozgwkbyspwta
432 28/Sep/05 20:46  /cgi-bin/chat/chat.cgi?action=chat&id=tfukvslmjpwqkvxdgvddvarxhoqpbu
431 27/Sep/05 22:03  /cgi-bin/chat/chat.cgi?action=chat&id=zjntcezcgxisshwqosgbhumiwwnttz
428 17/Sep/05 19:39  /cgi-bin/chat/chat.cgi?action=chat&id=hhrjjsrmkgymyjiilkoamyujzecpic
427 14/Sep/05 18:17  /cgi-bin/chat/chat.cgi?action=chat&id=dlqbnoifnvfqvictlcrziejbsgyxop
427 19/Sep/05 19:43  /cgi-bin/chat/chat.cgi?action=chat&id=taefcvftewtglvptiivfbflenxwzwl
423  5/Sep/05 21:48  /cgi-bin/chat/chat.cgi?action=chat&id=mjnjvoyxetrkmguopfahkmlsjxkekm
422 25/Sep/05 22:12  /cgi-bin/chat/chat.cgi?action=chat&id=cycnrfvikkidgqlxmwkojmbrxovkfz&pause=
421  4/Sep/05 20:52  /cgi-bin/chat/chat.cgi?action=chat&id=aszmyykfwujvispxcambkwgemuhiyx
420 14/Sep/05 19:03  /cgi-bin/chat/chat.cgi?action=chat&id=talnstwlibqmwdbmhpfoczjfeefupa&pause=
417 29/Sep/05 21:41  /cgi-bin/chat/chat.cgi?action=chat&id=kvpgxznokhweuxzgzrfyyvqkctrlhc
417 16/Sep/05 21:38  /cgi-bin/chat/chat.cgi?action=chat&id=ejajohuroyweziaaqyjcikpckfmgww
417 24/Sep/05 20:59  /cgi-bin/chat/chat.cgi?action=chat&id=cyodqgpjvgxummrgqlnsdqkeltvbdk&pause=
416 24/Sep/05 18:58  /cgi-bin/chat/chat.cgi?action=chat&id=gaxeuooshgqffgaevytcqeslcqbsyd
415  3/Sep/05 13:17  /cgi-bin/chat/chat.cgi?action=chat&id=oioggkndttlrvvexhsyrdultjdycso&pause=
414 25/Sep/05 13:54  /cgi-bin/chat/chat.cgi?action=chat&id=vdlstujouydbhvbjwlejmoyagaglog&pause=
414 23/Sep/05 20:07  /cgi-bin/chat/chat.cgi?action=chat&id=arwhkgtgcmtvtuddckwmfjmxuxfsnv
413  6/Sep/05 19:47  /cgi-bin/chat/chat.cgi?action=chat&id=qyfakhbxzyatubrguilklwbrndakbn
413 19/Sep/05 20:47  /cgi-bin/chat/chat.cgi?action=chat&id=awzkjzjvquenmqvzutcbzgjxpwtyrb
413 25/Sep/05 19:21  /cgi-bin/chat/chat.cgi?action=chat&id=yqnzgoqmvhseleahakmmrvafgpfjym
411 24/Sep/05 13:19  /cgi-bin/chat/chat.cgi?action=chat&id=btkssypzqavoviljpnqtkxcbyzyuft&pause=
410 18/Sep/05 19:03  /cgi-bin/chat/chat.cgi?action=chat&id=rolisetaksfawrkczyjtdbnitipita&pause=
410 12/Sep/05 18:10  /cgi-bin/chat/chat.cgi?action=chat&id=cdvbbhmoztdkiwkcptiqnxlthvuwtj&pause=
408 21/Sep/05 18:48  /cgi-bin/chat/chat.cgi?action=chat&id=iaksklwpudesgxmqmojyipxpzqlelf&pause=
406 27/Sep/05 20:41  /cgi-bin/chat/chat.cgi?action=chat&id=sxyzaiscyzjezcmhxoodsqdzlrbxej
406 20/Sep/05 20:07  /cgi-bin/chat/chat.cgi?action=chat&id=sjwdltivjttxpggutawpennpvagxqn&pause=
406  5/Sep/05 19:52  /cgi-bin/chat/chat.cgi?action=chat&id=boottpwudxcuktutplkujacletdfby
402 25/Sep/05 20:36  /cgi-bin/chat/chat.cgi?action=chat&id=rrtzylsynhhnrzkwcikiqtlwnxkxww
401 10/Sep/05 20:39  /cgi-bin/chat/chat.cgi?action=chat&id=jacqgjqrcovwnhxzrtodrpoeqynlck&pause=
397  4/Sep/05 18:58  /cgi-bin/chat/chat.cgi?action=chat&id=uskccqknzfwghbwcojevqutcjvivqd&pause=
397 14/Sep/05 18:58  /cgi-bin/chat/chat.cgi?action=chat&id=sftunjdocvmurkoyrvgaszzjvazvqq
396 17/Sep/05 20:18  /cgi-bin/chat/chat.cgi?action=chat&id=uvlmftqqsffeevnvokbjumxrcjrvwt
396  2/Sep/05 20:52  /cgi-bin/chat/chat.cgi?action=chat&id=ijxdzikyhesjmulkgjrxjllvsmznad
394  4/Sep/05 22:58  /cgi-bin/chat/chat.cgi?action=chat&id=zrcxxptnmwougfmeacdkvhqmvmbvor&pause=
393 25/Sep/05 17:22  /cgi-bin/chat/chat.cgi?action=chat&id=smohudxujgxxjggncpdqohtupghpzn&pause=
391  7/Sep/05 21:18  /cgi-bin/chat/chat.cgi?action=chat&id=fkxcofdcnrlufzzijesnyzlbpwwgza
387  3/Sep/05 20:24  /cgi-bin/chat/chat.cgi?action=chat&id=jzxiusfcxxbqmxddzxwmzurwrjpxnr&pause=
386  6/Sep/05 20:30  /cgi-bin/chat/chat.cgi?action=chat&id=xqsautnmhptdjanzaxxeeuyxcfpajw&pause=
383 27/Sep/05 19:47  /cgi-bin/chat/chat.cgi?action=chat&id=wcdezozirekakvhlgevqtvwliafjaj&pause=
381 20/Sep/05 19:40  /cgi-bin/chat/chat.cgi?action=chat&id=jaorinkjlrlwcacxqqjubqqztxijyf&pause=
380 18/Sep/05 17:57  /cgi-bin/chat/chat.cgi?action=chat&id=zxykhlxzaaxktzzdibtgvenlowxwcw&pause=
377 21/Sep/05 18:23  /cgi-bin/chat/chat.cgi?action=chat&id=sslarjxmofncbbyvgtwalttodjjxiv&pause=
375 12/Sep/05 20:32  /cgi-bin/chat/chat.cgi?action=chat&id=kxwatauncuavhmboepwtzhnkmwuwqv
375 23/Sep/05 20:42  /cgi-bin/chat/chat.cgi?action=chat&id=qycsxeoykpajrnemzfeunkyijrzvee
375 14/Sep/05 20:39  /cgi-bin/chat/chat.cgi?action=chat&id=qiihksackeevcroxhiqmeklmlxsrqf&pause=
375  8/Sep/05 22:03  /cgi-bin/chat/chat.cgi?action=chat&id=kdaszepinvsiqyapevunptzuojcdnc&pause=
371 21/Sep/05 20:21  /cgi-bin/chat/chat.cgi?action=chat&id=zgqzzupgxaifamnbwqisgkkblwnqwm
370 26/Sep/05 18:45  /cgi-bin/chat/chat.cgi?action=chat&id=syssyatyqdrnprjvttkltftlvtnwmq&pause=
370  6/Sep/05 19:40  /cgi-bin/chat/chat.cgi?action=chat&id=vdmcqixkybzvkppthptwfqsboondcl&pause=
369 24/Sep/05 19:35  /cgi-bin/chat/chat.cgi?action=chat&id=dfucgfocjtqvcjsuakffmlohdidzil&pause=
367 16/Sep/05 21:11  /cgi-bin/chat/chat.cgi?action=chat&id=hovstivivnjaubbynxbvdozyrnxkzw
364  9/Sep/05 20:42  /cgi-bin/chat/chat.cgi?action=chat&id=bcefnxixtwxpwfgbhrryyacsjpbbbv&pause=
363 11/Sep/05 21:17  /cgi-bin/chat/chat.cgi?action=chat&id=dqjxrffidhrdxdvfdixgtvjmlilsxs
358 25/Sep/05 14:30  /cgi-bin/chat/chat.cgi?action=chat&id=ztoypdoacpeygfnvkzkugaagmcieam
356 29/Sep/05 19:07  /cgi-bin/chat/chat.cgi?action=chat&id=fpykyduuzvznvagnjgkuiloiuukuvk
355 11/Sep/05 20:36  /cgi-bin/chat/chat.cgi?action=chat&id=dqjxrffidhrdxdvfdixgtvjmlilsxs&pause=
354 15/Sep/05 17:21  /cgi-bin/chat/chat.cgi?action=chat&id=azjxiioutdaghwzfysrmxyryuddpks&pause=
353 13/Sep/05 20:07  /cgi-bin/chat/chat.cgi?action=chat&id=iekbazzwtnxhgftroinwqmusgqbgtp&pause=
351 26/Sep/05 19:40  /cgi-bin/chat/chat.cgi?action=chat&id=roagnxmyrpriyebogovbdgdiyqlujk
351  2/Sep/05 21:21  /cgi-bin/chat/chat.cgi?action=chat&id=zmnketnrblwuklrlmobdehqzqsvozk
350 17/Sep/05 20:43  /cgi-bin/chat/chat.cgi?action=chat&id=ekqbhobpixbbhhoarvbmfugcwgltzd&pause=
349 20/Sep/05 18:08  /cgi-bin/chat/chat.cgi?action=chat&id=jregqqjnlmslggvsxickmafmyxgqqc&pause=
347 19/Sep/05 20:37  /cgi-bin/chat/chat.cgi?action=chat&id=omuniadadjrffjdllhujxehorqgnpy
346 16/Sep/05 20:19  /cgi-bin/chat/chat.cgi?action=chat&id=svwxyxozffiuhiechkmetnjupozmat&pause=
346 23/Sep/05 19:35  /cgi-bin/chat/chat.cgi?action=chat&id=hmqpampqezmsieqajcinslhoztjnee
344 11/Sep/05 20:53  /cgi-bin/chat/chat.cgi?action=chat&id=vkueqrjkqmlkfazklyohrczlbpeowp&pause=
343 28/Sep/05 19:27  /cgi-bin/chat/chat.cgi?action=chat&id=eraqpsaqfsdqaglfyncbaubwiocpdn&pause=
342 23/Sep/05 13:54  /cgi-bin/chat/chat.cgi?action=chat&id=qouczcndyksenjdenlvyhrrwoquvpb&pause=
340 19/Sep/05 19:44  /cgi-bin/chat/chat.cgi?action=chat&id=idhbljciimmmxwfnabvogwhdmpzzwu&pause=
339 25/Sep/05 13:59  /cgi-bin/chat/chat.cgi?action=chat&id=uaklhiywuvebgubmhbdewqtbbrpkug
339  1/Sep/05 18:22  /cgi-bin/chat/chat.cgi?action=chat&id=jsmtrnxcfxdjwynnbcqniuyaajqimn&pause=
339 12/Sep/05 19:13  /cgi-bin/chat/chat.cgi?action=chat&id=eglsbdfpvvyhjxtiktlqllenmwctak&pause=
337 27/Sep/05 19:58  /cgi-bin/chat/chat.cgi?action=chat&id=bxqegjlvriknmrgckdumqrncjyppvj
335 18/Sep/05 20:26  /cgi-bin/chat/chat.cgi?action=chat&id=sbmfkqwwebfuxtcugjdzjzonebyxaf
335 19/Sep/05 19:34  /cgi-bin/chat/chat.cgi?action=chat&id=byizbgaqgojszwuvuovysxdwfuaqud&pause=
334  3/Sep/05 16:04  /cgi-bin/chat/chat.cgi?action=chat&id=dugkzwhvhepmrgdzicrxonkbomzphd&pause=
333 23/Sep/05 16:34  /cgi-bin/chat/chat.cgi?action=chat&id=jobplskkzcipteiabmemskjvlabbuf&pause=
333  2/Sep/05 18:04  /cgi-bin/chat/chat.cgi?action=chat&id=ddpmfphhtpafgttvvmayljqxqgqrsd&pause=
332 18/Sep/05 17:09  /cgi-bin/chat/chat.cgi?action=chat&id=yuasxifigcoeogxiwenifnqdmvouje&pause=
332 20/Sep/05 19:13  /cgi-bin/chat/chat.cgi?action=chat&id=ypbeeetnilplkyuwvqqcowrrkwmcmr&pause=
332  7/Sep/05 20:33  /cgi-bin/chat/chat.cgi?action=chat&id=fkxcofdcnrlufzzijesnyzlbpwwgza&pause=
330 18/Sep/05 13:40  /cgi-bin/chat/chat.cgi?action=chat&id=xyzbqsnbvspcoeqzondnzvrqpjefat&pause=
329 16/Sep/05 20:12  /cgi-bin/chat/chat.cgi?action=chat&id=abesgtzubnrdyqghpcjufsutlnbpwl&pause=
328  1/Sep/05 08:04  /cgi-bin/chat/chat.cgi?action=chat&id=xogfedmeytaldkilxnaonbtshvsdtp&pause=
328 25/Sep/05 14:09  /cgi-bin/chat/chat.cgi?action=chat&id=zsrkhstbrjbqnduwdrppwdrxoyeayi
325  9/Sep/05 19:13  /cgi-bin/chat/chat.cgi?action=chat&id=mmvrbmbezahvznckgnbsnsbmlnteba&pause=
324  1/Sep/05 19:58  /cgi-bin/chat/chat.cgi?action=chat&id=gkrspxyahtfqkawdatwvbqrsmqbtdp&pause=
323 15/Sep/05 19:04  /cgi-bin/chat/chat.cgi?action=chat&id=trvsimefldemxwxrmkpqzubomkoirh&pause=
321  9/Sep/05 20:24  /cgi-bin/chat/chat.cgi?action=chat&id=wzllgqrwgryyysioohzogpejyxcony&pause=
321 24/Sep/05 14:51  /cgi-bin/chat/chat.cgi?action=chat&id=cvvfhctkwvdcztgpvvqpospvxgxwub&pause=
321 29/Sep/05 20:48  /cgi-bin/chat/chat.cgi?action=chat&id=syehwttqndymjrsadzmujaqtlqypkn&pause=
321  2/Sep/05 19:18  /cgi-bin/chat/chat.cgi?action=chat&id=sjssbsymunvusdyxxopahwfsmhatjy&pause=
320 24/Sep/05 09:00  /cgi-bin/chat/chat.cgi?action=chat&id=szaqxtwttkaffuyupoyblmpprpzprv
320  4/Sep/05 17:06  /cgi-bin/chat/chat.cgi?action=chat&id=zjqpcvhwzfypaefrtiafpwerqwokgn
320 19/Sep/05 19:51  /cgi-bin/chat/chat.cgi?action=chat&id=dqnmznietsyjexzycnfweqrfmlrayv&pause=
319  1/Sep/05 18:26  /cgi-bin/chat/chat.cgi?action=chat&id=twexznbeqjwvxhhkejbjbfjnibtirw&pause=
319 17/Sep/05 18:50  /cgi-bin/chat/chat.cgi?action=chat&id=iqotoskammslwppsvvitnidgxjciir&pause=
316 25/Sep/05 14:25  /cgi-bin/chat/chat.cgi?action=chat&id=vdlstujouydbhvbjwlejmoyagaglog
314 27/Sep/05 15:15  /cgi-bin/chat/chat.cgi?action=chat&id=snvbfeykfrqhthnnqpxukgkjnyvwzv&pause=
314 20/Sep/05 20:27  /cgi-bin/chat/chat.cgi?action=chat&id=xsbvriacpxjwzrewmrjkzfvtzwgsdc
313 29/Sep/05 20:53  /cgi-bin/chat/chat.cgi?action=chat&id=csolsuxynludykwqcibdjwkknvfaux&pause=
313 24/Sep/05 16:19  /cgi-bin/chat/chat.cgi?action=chat&id=inmuqgdcafyayrvvjggcyypgxssnlb
309  4/Sep/05 18:34  /cgi-bin/chat/chat.cgi?action=chat&id=rexkyrxxzrgjylgnaolyidcbkgedxi
309  7/Sep/05 19:44  /cgi-bin/chat/chat.cgi?action=chat&id=bmtsscoidjnmjljgmdzdjrngxfvjkp&pause=
309  2/Sep/05 19:59  /cgi-bin/chat/chat.cgi?action=chat&id=gajfvlwfyuesphiooktzcdbowoyhat&pause=
306 28/Sep/05 16:54  /cgi-bin/chat/chat.cgi?action=chat&id=oyxtsbdtxoxcefysfdntnqsdhouofw
305  3/Sep/05 21:07  /cgi-bin/chat/chat.cgi?action=chat&id=haqmilwkjdmdakbgkdricivrunvagp
305 25/Sep/05 18:55  /cgi-bin/chat/chat.cgi?action=chat&id=npaexgadohzgdlwrlaoqsjkjrfpcmw&pause=
300  5/Sep/05 20:17  /cgi-bin/chat/chat.cgi?action=chat&id=ksuvkfiplidhpjtuyuaikopzmdwwys
300 19/Sep/05 18:30  /cgi-bin/chat/chat.cgi?action=chat&id=tqisccggolgvpwsivqkrpwpfxgsoov&pause=
299 25/Sep/05 08:47  /cgi-bin/chat/chat.cgi?action=chat&id=ksggqomhhvhknxcfkodewsbpsvgmst&pause=
298 19/Sep/05 20:46  /cgi-bin/chat/chat.cgi?action=chat&id=dqnmznietsyjexzycnfweqrfmlrayv
297 18/Sep/05 20:25  /cgi-bin/chat/chat.cgi?action=chat&id=gpovbeinndztifelnczjnzpbgswfpg&pause=
296 25/Sep/05 14:32  /cgi-bin/chat/chat.cgi?action=chat&id=raltgqjjputujugywhqmwsjvptksbv&pause=
296 23/Sep/05 20:38  /cgi-bin/chat/chat.cgi?action=chat&id=hhhncjjoxshdbhpwrkrvuqbggoqsfe
296 11/Sep/05 20:39  /cgi-bin/chat/chat.cgi?action=chat&id=tzgbgwgjomtrugfqnojhgzkntxeirv&pause=
293 20/Sep/05 19:17  /cgi-bin/chat/chat.cgi?action=chat&id=htjkhnlhlqoubgwftmkwthtqqsqaal&pause=
292  2/Sep/05 22:28  /cgi-bin/chat/chat.cgi?action=chat&id=eftzlhwigwdliskhfbgovxtguqmguh
289 23/Sep/05 17:22  /cgi-bin/chat/chat.cgi?action=chat&id=gsreaksdfwelmwltjrntxpkircwrcn
289  5/Sep/05 19:55  /cgi-bin/chat/chat.cgi?action=chat&id=rfrdfnsjokdtkyllzjsbaoclctkaga
287  3/Sep/05 20:34  /cgi-bin/chat/chat.cgi?action=chat&id=fzxlxgujebyvrgokmspiwxtkwscywc&pause=
284 21/Sep/05 18:23  /cgi-bin/chat/chat.cgi?action=chat&id=bdjfaexsprujfuxfaawrlwndhlpnxg
284  2/Sep/05 20:36  /cgi-bin/chat/chat.cgi?action=chat&id=zmnketnrblwuklrlmobdehqzqsvozk&pause=
284 29/Sep/05 21:08  /cgi-bin/chat/chat.cgi?action=chat&id=yfvbaznmzqsuthjtpzhdeyfcwgpbls
283  7/Sep/05 20:41  /cgi-bin/chat/chat.cgi?action=chat&id=jcecptwtxzwybzhznffcqnocnvuhiq&pause=
282  1/Sep/05 20:06  /cgi-bin/chat/chat.cgi?action=chat&id=vdmntdhgitmhnxfdonphpuidyuvgko&pause=
282 12/Sep/05 20:40  /cgi-bin/chat/chat.cgi?action=chat&id=syhzfjwbffwdfoimolpvnkemyrkydj&pause=
282 20/Sep/05 17:27  /cgi-bin/chat/chat.cgi?action=chat&id=fjlndqlbeinoswuothfojebsepfvyl&pause=
281  1/Sep/05 14:53  /cgi-bin/chat/chat.cgi?action=chat&id=ovbycarnwklpbdihunperikawiqyiu
281 16/Sep/05 19:57  /cgi-bin/chat/chat.cgi?action=chat&id=vvlamykjagrakcluafxhulaqykyfjj&pause=
281  5/Sep/05 21:01  /cgi-bin/chat/chat.cgi?action=chat&id=yprvuidzwgpdzwecglljgxihmolxuv&pause=
280  1/Sep/05 15:08  /cgi-bin/chat/chat.cgi?action=chat&id=alorhpirnockcrpirfhqswoobuwppx&pause=
280 17/Sep/05 16:33  /cgi-bin/chat/chat.cgi?action=chat&id=zbvczomzallashwwndwjbthncusgjy
280 21/Sep/05 21:23  /cgi-bin/chat/chat.cgi?action=chat&id=omaoizmpgreyigcixaizcnojvbsujm
280 25/Sep/05 18:26  /cgi-bin/chat/chat.cgi?action=chat&id=bsmokichovkeechewvsfkfougrxbnq
279  6/Sep/05 18:34  /cgi-bin/chat/chat.cgi?action=chat&id=qyfakhbxzyatubrguilklwbrndakbn&pause=
278 17/Sep/05 19:06  /cgi-bin/chat/chat.cgi?action=chat&id=eazueahobcoffbvouwxhnodhzfgsgf
278 26/Sep/05 22:24  /cgi-bin/chat/chat.cgi?action=chat&id=nxiwnayjaiysefjethkgmdosnxcbwl
278 27/Sep/05 17:25  /cgi-bin/chat/chat.cgi?action=chat&id=otnqglkwpkgwijqajrekmerkzlnuci&pause=
276 16/Sep/05 21:38  /cgi-bin/chat/chat.cgi?action=chat&id=yuypzxgmcmtccznhctwfoqequogqko
275 23/Sep/05 19:26  /cgi-bin/chat/chat.cgi?action=chat&id=hjtlswerzrcfoagepgeeigrpyjmnaj&pause=
275 21/Sep/05 15:31  /cgi-bin/chat/chat.cgi?action=chat&id=wulyhkvwuhmouabkbvdttiobdhkics&pause=
274 19/Sep/05 20:32  /cgi-bin/chat/chat.cgi?action=chat&id=xauuwfmmwxbonqculvvgypfyxzeaso&pause=
274  6/Sep/05 02:04  /cgi-bin/chat/chat.cgi?action=chat&id=kmiigyfjrwhbkhplhytqvbqnixwayh&pause=
273  8/Sep/05 15:41  /cgi-bin/chat/chat.cgi?action=chat&id=hprymozbklrxouwubctnuhhuwrheqz&pause=
273 23/Sep/05 20:40  /cgi-bin/chat/chat.cgi?action=chat&id=qzvkwwzjtllczyvnekjxssymzwhmxt&pause=
272 12/Sep/05 13:07  /cgi-bin/chat/chat.cgi?action=chat&id=yuvxmoklujertudnpvztxgscxwmkuz&pause=
272 10/Sep/05 20:13  /cgi-bin/chat/chat.cgi?action=chat&id=kflhsrjmrvhfsfqagakhvtjudigkzl&pause=
270 28/Sep/05 11:23  /cgi-bin/chat/chat.cgi?action=chat&id=rgxtuzvgekzkejifosdqrqxlbutmty&pause=
269 19/Sep/05 19:33  /cgi-bin/chat/chat.cgi?action=chat&id=tgrvwejkfgocnunolgikvdtipbbdny&pause=
268 23/Sep/05 16:59  /cgi-bin/chat/chat.cgi?action=chat&id=ylulpglmcvvjfrewgnxsyfnxqstpba
267 12/Sep/05 19:14  /cgi-bin/chat/chat.cgi?action=chat&id=xmuersdvumvwtxbvfeunhozuwvwgis&pause=
267  7/Sep/05 21:30  /cgi-bin/chat/chat.cgi?action=chat&id=avfpmmygyzemeqmmnnvbpsyadvjabj
266 24/Sep/05 19:24  /cgi-bin/chat/chat.cgi?action=chat&id=ubkaxmkcnfmfekvqtkepnnygtkgtdz
266 21/Sep/05 00:23  /cgi-bin/chat/chat.cgi?action=chat&id=wobuavpzsohkdldebcpyctdidghewi&pause=
265 22/Sep/05 18:47  /cgi-bin/chat/chat.cgi?action=chat&id=moqgllwhytkfhlqiwgkpzzjsyxbiji&pause=
264 17/Sep/05 20:04  /cgi-bin/chat/chat.cgi?action=chat&id=cqvutvgrfdzwfnfqlmfyngrjiaogyo&pause=
263  3/Sep/05 22:38  /cgi-bin/chat/chat.cgi?action=chat&id=adujwjgypfefrrnnwyeqlaqxtriikq
262 27/Sep/05 17:37  /cgi-bin/chat/chat.cgi?action=chat&id=ycultvxkamyyvkekwcusjqwuwmdvmm&pause=
262 26/Sep/05 20:58  /cgi-bin/chat/chat.cgi?action=chat&id=wjyhvvqjjhugvtgtleyvndqqcqgtfw
262 21/Sep/05 15:29  /cgi-bin/chat/chat.cgi?action=chat&id=tuanoxnbornrmlsgggdbodawjpwnvq&pause=
262 21/Sep/05 20:07  /cgi-bin/chat/chat.cgi?action=chat&id=taxmoznwljyufgzimubpbcvdgnsqvg&pause=
261 11/Sep/05 19:50  /cgi-bin/chat/chat.cgi?action=chat&id=opzlfwzdlxvsvztkhvhvjaymxjhwtd&pause=
258 15/Sep/05 18:57  /cgi-bin/chat/chat.cgi?action=chat&id=tvwlxjqjfcszxpqgxjpaemykehdmfw&pause=
258 16/Sep/05 21:21  /cgi-bin/chat/chat.cgi?action=chat&id=lotygdljtfchbgwtudsaagjhpryyfv
256 25/Sep/05 14:18  /cgi-bin/chat/chat.cgi?action=chat&id=tbkuzpqizyirpadplpvhvezrttapix
256 19/Sep/05 18:52  /cgi-bin/chat/chat.cgi?action=chat&id=eonvaijejdeplpvaqlhurmlhocjwaf&pause=
253  3/Sep/05 19:58  /cgi-bin/chat/chat.cgi?action=chat&id=esqlmeagzrqtfwzfmsntdrdlhmlyxu&pause=
252 22/Sep/05 20:03  /cgi-bin/chat/chat.cgi?action=chat&id=pzmrcsvmbvygntorrvyazrsabjmtjv
251 29/Sep/05 18:20  /cgi-bin/chat/chat.cgi?action=chat&id=udhkuhelthrpfrxhokloyckwppzqgo&pause=
250 27/Sep/05 15:41  /cgi-bin/chat/chat.cgi?action=chat&id=ewkawawslkbocreqnmabxnkrijuxtc&pause=
248  1/Sep/05 17:00  /cgi-bin/chat/chat.cgi?action=chat&id=ztvlrlszkvoaujfzufaxzddkjxumnk&pause=
248 18/Sep/05 16:30  /cgi-bin/chat/chat.cgi?action=chat&id=rbxwmhlnnidrndmzihwrxwleiqpjgi
248 19/Sep/05 20:33  /cgi-bin/chat/chat.cgi?action=chat&id=xdkgxjdmvsxbxeropfdtwlicygwalt
248 14/Sep/05 20:39  /cgi-bin/chat/chat.cgi?action=chat&id=egpkdxsxiewnrbglsansyjbxvcibel
248 14/Sep/05 20:04  /cgi-bin/chat/chat.cgi?action=chat&id=urdopijamxbafzidpcngirtjxdnyns&pause=
247 23/Sep/05 18:05  /cgi-bin/chat/chat.cgi?action=chat&id=iggmjqjuzwdvriyqxonnanzykcwlbx
247 21/Sep/05 20:16  /cgi-bin/chat/chat.cgi?action=chat&id=gzrglflisfllysezfmirasymeoqrjx&pause=
246 19/Sep/05 18:30  /cgi-bin/chat/chat.cgi?action=chat&id=cgvruppqdchheirdleimgugnhzrclj
246  7/Sep/05 20:19  /cgi-bin/chat/chat.cgi?action=chat&id=ofjkspsmniyxdmydyfnnacetkowwls
246 26/Sep/05 13:42  /cgi-bin/chat/chat.cgi?action=chat&id=llzgfzttzhwarddyhoocjiydmkmnuf
245 15/Sep/05 21:01  /cgi-bin/chat/chat.cgi?action=chat&id=rtlfavdqahqhdcvptaeydivkdtwyaq&pause=
244  7/Sep/05 20:24  /cgi-bin/chat/chat.cgi?action=chat&id=wbtbmjlqiyevhamjfxppntflwvwspx&pause=
244 25/Sep/05 19:56  /cgi-bin/chat/chat.cgi?action=chat&id=vnmvcwkvgivdtghpodufhdnlkqyxuj&pause=
243 25/Sep/05 17:22  /cgi-bin/chat/chat.cgi?action=chat&id=chkjantqynrxwizsyifsclqgzngdjp
243 28/Sep/05 20:01  /cgi-bin/chat/chat.cgi?action=chat&id=sgxfpfkcxxivhjhgysfcjjwbohfhsl&pause=
242 18/Sep/05 18:23  /cgi-bin/chat/chat.cgi?action=chat&id=esnxzzokvzsunkaxcfynbrtagebspi&pause=
242  5/Sep/05 14:27  /cgi-bin/chat/chat.cgi?action=chat&id=nahrrwzlblufwpmnxhvvnlkqhukxol&pause=
242  7/Sep/05 19:20  /cgi-bin/chat/chat.cgi?action=chat&id=hmjjrockxmdtwfptjfgkjoxkjukpwq
240 13/Sep/05 19:58  /cgi-bin/chat/chat.cgi?action=chat&id=higlxqrerclwwvpembqqghdwhpgpji
239  8/Sep/05 19:14  /cgi-bin/chat/chat.cgi?action=chat&id=reeawjunnvcoxovldxtclpleakebqr&pause=
238  7/Sep/05 20:06  /cgi-bin/chat/chat.cgi?action=chat&id=mihzvgjsfiyybfcwffpuqlzmyhkocy&pause=
236 13/Sep/05 20:27  /cgi-bin/chat/chat.cgi?action=chat&id=ftgjfboqxjaotwyzmhjiuicacjthlx&pause=
234 22/Sep/05 20:01  /cgi-bin/chat/chat.cgi?action=chat&id=senqepyhhymjhnxqchawzdqihujvug&pause=
231 27/Sep/05 17:42  /cgi-bin/chat/chat.cgi?action=chat&id=rqhyrjmifhwfiqcqdayjrqvnwczxru&pause=
231 23/Sep/05 20:39  /cgi-bin/chat/chat.cgi?action=chat&id=bweagaogjoygjdzouugxfwllgybvbz&pause=
231  9/Sep/05 19:54  /cgi-bin/chat/chat.cgi?action=chat&id=cruszztiqiozahieiujbqlevkzbuol&pause=
230 26/Sep/05 19:22  /cgi-bin/chat/chat.cgi?action=chat&id=xlbkkdoggkaiomhwrzkwcwcckphsjk&pause=
230 20/Sep/05 17:26  /cgi-bin/chat/chat.cgi?action=chat&id=mvdqfngzluteefjpldbltlmfzptnso&pause=
230 26/Sep/05 19:20  /cgi-bin/chat/chat.cgi?action=chat&id=zicjjyfzvjvlbjghvegiqxwjfuxcaz&pause=
229 28/Sep/05 17:19  /cgi-bin/chat/chat.cgi?action=chat&id=elmniyaxmxgthykhngwyurhfiyncdd
229  4/Sep/05 20:38  /cgi-bin/chat/chat.cgi?action=chat&id=swwzrbfnyfvfrctglgwdatsoreevun
228 17/Sep/05 19:49  /cgi-bin/chat/chat.cgi?action=chat&id=vrnwftbjiykexlhvbdogbkfvehtkov&pause=
228 28/Sep/05 19:20  /cgi-bin/chat/chat.cgi?action=chat&id=tkozgfhvuorfqcjcdodxcydehvwvlk&pause=
228 22/Sep/05 17:11  /cgi-bin/chat/chat.cgi?action=chat&id=zpnnsmkmaybjnowlrkgvvplkxdblzw
226 26/Sep/05 20:00  /cgi-bin/chat/chat.cgi?action=chat&id=bjqovgysywfdpxgvrtndhngpwaxxhy&pause=
224  9/Sep/05 19:34  /cgi-bin/chat/chat.cgi?action=chat&id=bhuxethzwxybyxtqbplybrrrxwkqww
224 25/Sep/05 18:42  /cgi-bin/chat/chat.cgi?action=chat&id=oxjdmfrbykwhhklzclvsqlkzgknznd
223 27/Sep/05 19:47  /cgi-bin/chat/chat.cgi?action=chat&id=sdtpfsimixsfoplahvpuryvsumuhdt
222  4/Sep/05 17:46  /cgi-bin/chat/chat.cgi?action=chat&id=fcsagxrupvdpvqtsapqonejivehkfl
222 17/Sep/05 18:46  /cgi-bin/chat/chat.cgi?action=chat&id=ldwqbfgkgxrxofzigvuvflxyjxdoib
221 11/Sep/05 20:47  /cgi-bin/chat/chat.cgi?action=chat&id=cbwogjsrqfwyjuoloosadvqcwkaekz&pause=
218 29/Sep/05 20:42  /cgi-bin/chat/chat.cgi?action=chat&id=jkketbilkhxtdfkwudspdvorsetrto&pause=
217 14/Sep/05 17:15  /cgi-bin/chat/chat.cgi?action=chat&id=qgrntyintirmlmnqsxrceesbgaybdr
217 20/Sep/05 17:45  /cgi-bin/chat/chat.cgi?action=chat&id=tpypkzcsebqwrwhyndhcadbtatgdho&pause=
217 29/Sep/05 15:31  /cgi-bin/chat/chat.cgi?action=chat&id=ypeeoygqqqrpiyldadlnffxkimmchd&pause=
217 27/Sep/05 19:53  /cgi-bin/chat/chat.cgi?action=chat&id=npkazrsiagrhqdlpjfabunlfihutaz&pause=
215  8/Sep/05 20:03  /cgi-bin/chat/chat.cgi?action=chat&id=kybqtalvhtrlxoaxfdegxpwglodjsq&pause=
215 17/Sep/05 21:00  /cgi-bin/chat/chat.cgi?action=chat&id=atwymmqkaiunibxqnppafnrzoiptlw
214 22/Sep/05 19:30  /cgi-bin/chat/chat.cgi?action=chat&id=agehegclhzogvmmfllhefvbfmgiatf&pause=
214 26/Sep/05 16:53  /cgi-bin/chat/chat.cgi?action=chat&id=pxzlpqntsrywpsnynefphbgbdcvaxp&pause=
214 27/Sep/05 16:44  /cgi-bin/chat/chat.cgi?action=chat&id=dqtrhssdayywhiqfidiewuyvrqllvu
213 21/Sep/05 21:35  /cgi-bin/chat/chat.cgi?action=chat&id=yjacujunvjbmrjwsrfwvhunnrwptbv
213  6/Sep/05 18:33  /cgi-bin/chat/chat.cgi?action=chat&id=amvqgokoctnhcnvodpirzyhstucasd
212 23/Sep/05 17:00  /cgi-bin/chat/chat.cgi?action=chat&id=bkgqvvnfzgtqncxdsvzwzmjdrlkidj&pause=
211 16/Sep/05 15:07  /cgi-bin/chat/chat.cgi?action=chat&id=aewkgywttubzcfcdemtsysviiaaxmy&pause=
211 23/Sep/05 16:43  /cgi-bin/chat/chat.cgi?action=chat&id=sbplduqloscegpsrztrbkqiurjoyng
210 28/Sep/05 19:16  /cgi-bin/chat/chat.cgi?action=chat&id=wqataaxgaiedlpiyeuvgjuvxwagcrz&pause=
210  2/Sep/05 19:40  /cgi-bin/chat/chat.cgi?action=chat&id=qreloriajeaqdwsabutufrdfnbgufb&pause=
208 23/Sep/05 19:37  /cgi-bin/chat/chat.cgi?action=chat&id=ezbyypkobplprnhcyqiqjovuightgu&pause=
207 28/Sep/05 16:34  /cgi-bin/chat/chat.cgi?action=chat&id=fmahbhtrzwtifzozjjrrgdxlvlngxw&pause=
205 28/Sep/05 21:23  /cgi-bin/chat/chat.cgi?action=chat&id=ltcelqglunndnmttsbjhxkjauqkncn&pause=
204 24/Sep/05 19:48  /cgi-bin/chat/chat.cgi?action=chat&id=ecpzqdqzfdvlsrirurmtxoegpbrxui&pause=
204 23/Sep/05 20:46  /cgi-bin/chat/chat.cgi?action=chat&id=lqhtjsopqoyuqgkkadaakwsnwjnkeq
201 17/Sep/05 19:09  /cgi-bin/chat/chat.cgi?action=chat&id=xlvzjjbwwcrwuckviwyrjvkuoshgud&pause=
200 27/Sep/05 19:21  /cgi-bin/chat/chat.cgi?action=chat&id=kbnvnfsxnaiyblvhtihthonnfymufy&pause=
200  1/Sep/05 17:22  /cgi-bin/chat/chat.cgi?action=chat&id=kdfpdjhezlfsdzitkmbzqdnjnowdcn
200 27/Sep/05 19:37  /cgi-bin/chat/chat.cgi?action=chat&id=tgplnhnvcxraminuftzjykczinirpf&pause=
200 23/Sep/05 18:31  /cgi-bin/chat/chat.cgi?action=chat&id=bkcsbfscieecdgdcuqdsbgivdcomif
199 23/Sep/05 21:17  /cgi-bin/chat/chat.cgi?action=chat&id=nlibgdpwgvnsluklpjqoifunuaxpvq&pause=
199 21/Sep/05 18:49  /cgi-bin/chat/chat.cgi?action=chat&id=cpmqcwhajemjlywbzbabgrqqnlpznv&pause=
198 27/Sep/05 18:29  /cgi-bin/chat/chat.cgi?action=chat&id=pzyljvocohnyjdfqvurnxuxfxahxnh&pause=
198  9/Sep/05 19:40  /cgi-bin/chat/chat.cgi?action=chat&id=qyucnkropztfewweflkwirxtqqulgx
196 26/Sep/05 18:11  /cgi-bin/chat/chat.cgi?action=chat&id=mryxmnftlitelsamjgdobecqpcaxuu
195 20/Sep/05 18:17  /cgi-bin/chat/chat.cgi?action=chat&id=dlmgxkroyqhtqkzqixvtvhfvtxjwkz&pause=
195 12/Sep/05 21:04  /cgi-bin/chat/chat.cgi?action=chat&id=uhjopxmejevgierwwdxaxcpojhxrra
195 17/Sep/05 18:50  /cgi-bin/chat/chat.cgi?action=chat&id=kzdsidnaczxnyicqhpkbwajeoftjpf&pause=
195  1/Sep/05 20:56  /cgi-bin/chat/chat.cgi?action=chat&id=emimzbvpvdtgqugtwglzaggdydvdvp
194 10/Sep/05 20:43  /cgi-bin/chat/chat.cgi?action=chat&id=onwloalymtgorvhvsohfmhlwgmqamb&pause=
194 11/Sep/05 21:18  /cgi-bin/chat/chat.cgi?action=chat&id=vkueqrjkqmlkfazklyohrczlbpeowp
193 26/Sep/05 20:00  /cgi-bin/chat/chat.cgi?action=chat&id=xlbkkdoggkaiomhwrzkwcwcckphsjk
193 23/Sep/05 21:37  /cgi-bin/chat/chat.cgi?action=chat&id=udjeorwlnuyvrusjpblsrbpqhcdhsj&pause=
192 26/Sep/05 16:52  /cgi-bin/chat/chat.cgi?action=chat&id=ligomccscanxoafxqobrspuqhqdzgj&pause=
192 17/Sep/05 16:45  /cgi-bin/chat/chat.cgi?action=chat&id=imehduprwijelbkffrawymetqriqpi&pause=
192 15/Sep/05 16:41  /cgi-bin/chat/chat.cgi?action=chat&id=qzscytztlhgqfouwhoagsxpfvpuglt
191 16/Sep/05 19:21  /cgi-bin/chat/chat.cgi?action=chat&id=kdnuvonxblupnwjxyscpoagdkqybjb&pause=
190  1/Sep/05 20:17  /cgi-bin/chat/chat.cgi?action=chat&id=gxcudskxkxbbmdpbstgxccbifzcvfo&pause=
189 22/Sep/05 20:38  /cgi-bin/chat/chat.cgi?action=chat&id=ycgxtpvsjqthrexyxgdfjjwkfmevwd
189 24/Sep/05 17:10  /cgi-bin/chat/chat.cgi?action=chat&id=bjgasuzqmjtsxnmlxjxlvffhiolgok&pause=
188 25/Sep/05 21:17  /cgi-bin/chat/chat.cgi?action=chat&id=xozzitaktsooopicajwmkqpoefbwxm&pause=
187 27/Sep/05 11:45  /cgi-bin/chat/chat.cgi?action=chat&id=grfkrqholrrnjjxnvapuuiocahikhr&pause=
183 20/Sep/05 19:03  /cgi-bin/chat/chat.cgi?action=chat&id=rbydqfsiyvfpapqubyeqitgzgqudcn&pause=
183  8/Sep/05 18:53  /cgi-bin/chat/chat.cgi?action=chat&id=riyqytkhuxluqldgsrkavuzpqxxhvp&pause=
183 27/Sep/05 11:20  /cgi-bin/chat/chat.cgi?action=chat&id=bykduzysfbujcozjwxuyivsyslgasv
182 25/Sep/05 16:25  /cgi-bin/chat/chat.cgi?action=chat&id=ipgmdhqaklfwsrkgxrsbrbyazrmuee&pause=
181  7/Sep/05 18:29  /cgi-bin/chat/chat.cgi?action=chat&id=xfzugilkucbichuamgwrvuxzmrdddl
180  4/Sep/05 19:06  /cgi-bin/chat/chat.cgi?action=chat&id=rcspiifdzwpxdsvmwjjospmnqnwpgm&pause=
179 15/Sep/05 19:24  /cgi-bin/chat/chat.cgi?action=chat&id=ltscmbeyqueemhvribolwatjncjqnh&pause=
178 23/Sep/05 16:20  /cgi-bin/chat/chat.cgi?action=chat&id=qtigyivhwcxwmbdkhapcqhdpbiieho
178 24/Sep/05 12:09  /cgi-bin/chat/chat.cgi?action=chat&id=wccdxazpgoevxewyrjumgigtmuugtl
178 25/Sep/05 17:40  /cgi-bin/chat/chat.cgi?action=chat&id=qmddbrgwallcpezqjdcqdqarndyhfq
177 19/Sep/05 19:43  /cgi-bin/chat/chat.cgi?action=chat&id=awzkjzjvquenmqvzutcbzgjxpwtyrb&pause=
177 17/Sep/05 22:13  /cgi-bin/chat/chat.cgi?action=chat&id=qfobybctkrjqhmbqgkrecokhwhublg&pause=
175 26/Sep/05 16:29  /cgi-bin/chat/chat.cgi?action=chat&id=ersxlqvznamsxfktcgdijymjlxnzll
174  3/Sep/05 11:57  /cgi-bin/chat/chat.cgi?action=chat&id=fzguqvlxulqrhtnytutnmfjlqgkxks
173 13/Sep/05 18:35  /cgi-bin/chat/chat.cgi?action=chat&id=wcriattzhuzmzdufxbtxedvfpstfrn&pause=
171  4/Sep/05 20:11  /cgi-bin/chat/chat.cgi?action=chat&id=znctlgtuztnskvyzxsirgpkrztlasx
171 28/Sep/05 11:59  /cgi-bin/chat/chat.cgi?action=chat&id=utmddydbdxaegbgbfguycszaopcgqy&pause=
170 19/Sep/05 21:08  /cgi-bin/chat/chat.cgi?action=chat&id=xauuwfmmwxbonqculvvgypfyxzeaso
170 23/Sep/05 16:07  /cgi-bin/chat/chat.cgi?action=chat&id=oovgnxrlskxcsnkdxheiapvimmlnlx
169  6/Sep/05 02:00  /cgi-bin/chat/chat.cgi?action=chat&id=jzqvrwxdzmdbozbrnjpqnovcbhfelh&pause=
169 27/Sep/05 14:10  /cgi-bin/chat/chat.cgi?action=chat&id=wfwcuytnroujoysnzmcfahqccynnjj
168  2/Sep/05 21:18  /cgi-bin/chat/chat.cgi?action=chat&id=obtjjvceobqlnvavnenxfzbgkdedgc
167 11/Sep/05 21:21  /cgi-bin/chat/chat.cgi?action=chat&id=mdgfzskiamlgldpcnvqpmkprskxmad&pause=
167 18/Sep/05 12:27  /cgi-bin/chat/chat.cgi?action=chat&id=piovwwpltucxefevegmgbhtjbcrhrh
167 27/Sep/05 20:42  /cgi-bin/chat/chat.cgi?action=chat&id=wekdrtxchacrlonqcuvgwzxejwbatr&pause=
165  3/Sep/05 19:51  /cgi-bin/chat/chat.cgi?action=chat&id=dgygicuvupnyirooqbyomdcchorguj
165 15/Sep/05 11:22  /cgi-bin/chat/chat.cgi?action=chat&id=whruwwtnrrcxdyigolgvexmlkhwsdu&pause=
163 22/Sep/05 21:50  /cgi-bin/chat/chat.cgi?action=chat&id=dhwhglehggjzeiwhmacrhyqxcijwdb
163 18/Sep/05 18:57  /cgi-bin/chat/chat.cgi?action=chat&id=ndekvayesraryutemyzpwvrycrpnuf&pause=
163 28/Sep/05 21:12  /cgi-bin/chat/chat.cgi?action=chat&id=eoxzkcihhkpnpozffyqvmfdnguswdv&pause=
163 17/Sep/05 20:20  /cgi-bin/chat/chat.cgi?action=chat&id=dnfdzflldtestmnrdmnuiygwekhlyh&pause=
162 16/Sep/05 20:37  /cgi-bin/chat/chat.cgi?action=chat&id=vbjnbwneuzqyxoidlpretmtanblabg
162 27/Sep/05 20:34  /cgi-bin/chat/chat.cgi?action=chat&id=jrbajdzbfjqpijxqgxssdjisodxklc
161  2/Sep/05 21:08  /cgi-bin/chat/chat.cgi?action=chat&id=evkloiwiodvymasruohmmmwmqnyzzx&pause=
160  7/Sep/05 19:40  /cgi-bin/chat/chat.cgi?action=chat&id=tkisqagdhhjnmskvhdnyngjnembkav
160 24/Sep/05 16:00  /cgi-bin/chat/chat.cgi?action=chat&id=aymgxjynbhmmrarxkjejiafbvgjgwk&pause=
160 23/Sep/05 20:33  /cgi-bin/chat/chat.cgi?action=chat&id=dcwkiivfqrtlhblgkdekumdmyjecqm&pause=
160 26/Sep/05 17:28  /cgi-bin/chat/chat.cgi?action=chat&id=mryxmnftlitelsamjgdobecqpcaxuu&pause=
160  1/Sep/05 20:07  /cgi-bin/chat/chat.cgi?action=chat&id=ntvzlznznyvwnelcjlasachfklxhok&pause=
159 27/Sep/05 21:15  /cgi-bin/chat/chat.cgi?action=chat&id=sbofygbpkhwtnhrniobjzwupnjsudk
159 20/Sep/05 20:21  /cgi-bin/chat/chat.cgi?action=chat&id=jaorinkjlrlwcacxqqjubqqztxijyf
158 27/Sep/05 19:27  /cgi-bin/chat/chat.cgi?action=chat&id=kgusrlfwcoonrlagipgyysdcjoeedo&pause=
157 22/Sep/05 17:42  /cgi-bin/chat/chat.cgi?action=chat&id=pufscparwfazegbdsjywufgbegfmzs
157  8/Sep/05 15:45  /cgi-bin/chat/chat.cgi?action=chat&id=vdurikqgrzqiqddjkekpadqeyfsdbt&pause=
157 22/Sep/05 17:36  /cgi-bin/chat/chat.cgi?action=chat&id=hfopnnbdtxiqboufkmfrqudshjihjl
156  2/Sep/05 20:42  /cgi-bin/chat/chat.cgi?action=chat&id=rdoihhqixtrnjstwgfmspmfzfxjgwz&pause=
156 19/Sep/05 16:22  /cgi-bin/chat/chat.cgi?action=chat&id=zsxnrbkhsrwfinwiltqoybqbaevkwc&pause=
155 28/Sep/05 20:01  /cgi-bin/chat/chat.cgi?action=chat&id=tnbxanjtsdecsohytheudkcdrerglq&pause=
153 28/Sep/05 15:50  /cgi-bin/chat/chat.cgi?action=chat&id=rfxgxllgexgdpkusmfkjfbzloycsys
152 14/Sep/05 17:50  /cgi-bin/chat/chat.cgi?action=chat&id=sftunjdocvmurkoyrvgaszzjvazvqq&pause=
152 21/Sep/05 20:13  /cgi-bin/chat/chat.cgi?action=chat&id=fddqeisstvdcughjkobtsujuyfxipj&pause=
151  1/Sep/05 18:17  /cgi-bin/chat/chat.cgi?action=chat&id=lcvxagadidbtjspwssedkqyixdmtvz&pause=
151 26/Sep/05 18:00  /cgi-bin/chat/chat.cgi?action=chat&id=itstfnjofzvfwiyjxmoucwpdypkgal&pause=
150 29/Sep/05 19:05  /cgi-bin/chat/chat.cgi?action=chat&id=cikokhfqmjogdufsnvlawlxqphdmpz
149  2/Sep/05 20:58  /cgi-bin/chat/chat.cgi?action=chat&id=rdoihhqixtrnjstwgfmspmfzfxjgwz
149 26/Sep/05 18:52  /cgi-bin/chat/chat.cgi?action=chat&id=nmgmeonimgkoyvtfgowxbywyejdmam&pause=
149  6/Sep/05 19:33  /cgi-bin/chat/chat.cgi?action=chat&id=vagugjmmqijoqbekalsjspvbqjtbwe&pause=
148  8/Sep/05 21:23  /cgi-bin/chat/chat.cgi?action=chat&id=cliijlzrtyzhsrphhcmawtlqyduqkz&pause=
148 28/Sep/05 19:15  /cgi-bin/chat/chat.cgi?action=chat&id=tpwkosilkrsftlvqdscwbnrirqzcqc&pause=
147 28/Sep/05 12:04  /cgi-bin/chat/chat.cgi?action=chat&id=vysmtxotgvsulfniqpvjhckmhzvkkx&pause=
145 11/Sep/05 21:12  /cgi-bin/chat/chat.cgi?action=chat&id=ophsfkdrxjgprbdcpttmdfphszkpkg
145 21/Sep/05 20:10  /cgi-bin/chat/chat.cgi?action=chat&id=ccxlyrlxzaejjinkmvzfsinjmdpady
145 23/Sep/05 19:23  /cgi-bin/chat/chat.cgi?action=chat&id=jnoqulgxbrbxfnjwfqrgjritjzuigb&pause=
145 25/Sep/05 19:21  /cgi-bin/chat/chat.cgi?action=chat&id=dohdidxtlyxwpgivgciqjxyhaqzycz&pause=
143 21/Sep/05 18:58  /cgi-bin/chat/chat.cgi?action=chat&id=dijlnxpabvrzsiuzhjvnwtheocxzio&pause=
143 28/Sep/05 15:39  /cgi-bin/chat/chat.cgi?action=chat&id=hetxlncxyfmkhnzknkcufnofwclbep
143 17/Sep/05 17:45  /cgi-bin/chat/chat.cgi?action=chat&id=degkriipmxtseuarevwfzznwfhyldr&pause=
142 27/Sep/05 16:39  /cgi-bin/chat/chat.cgi?action=chat&id=sufhghynivzurcicowlswdqgnrumvt
142  8/Sep/05 18:27  /cgi-bin/chat/chat.cgi?action=chat&id=sjglkboxbsqgvobwxamxbjhieiozir&pause=
141 22/Sep/05 21:10  /cgi-bin/chat/chat.cgi?action=chat&id=ohaqempqepacsehkzfyhawcodggyzj&pause=
140 11/Sep/05 17:26  /cgi-bin/chat/chat.cgi?action=chat&id=wnpoqhlqytewpexjtktkwzwxpvtael&pause=
140  3/Sep/05 21:10  /cgi-bin/chat/chat.cgi?action=chat&id=axtgxgvfozccyuklqkxzjjziyyvblg
139  2/Sep/05 20:00  /cgi-bin/chat/chat.cgi?action=chat&id=ykhghkofjxwjcnznrnskewcjkijuhv&pause=
139  5/Sep/05 16:51  /cgi-bin/chat/chat.cgi?action=chat&id=ixbekcskfdpkpopryasxextuadnfzc&pause=
138 16/Sep/05 20:23  /cgi-bin/chat/chat.cgi?action=chat&id=vvlamykjagrakcluafxhulaqykyfjj
138 28/Sep/05 10:53  /cgi-bin/chat/chat.cgi?action=chat&id=xmbgdnyyfxlfbtezsjfqzdtngbjxpp&pause=
137 29/Sep/05 21:37  /cgi-bin/chat/chat.cgi?action=chat&id=ldfasqeejvyviashpkeninyrappaka
136 15/Sep/05 17:14  /cgi-bin/chat/chat.cgi?action=chat&id=xchfrzkdizdtgujlitopvaqsvuuljq&pause=
135  4/Sep/05 19:59  /cgi-bin/chat/chat.cgi?action=chat&id=aszmyykfwujvispxcambkwgemuhiyx&pause=
135 21/Sep/05 15:33  /cgi-bin/chat/chat.cgi?action=chat&id=hhdeoksdrgtsvmmsxibvzkyjrqjucv
135 26/Sep/05 16:50  /cgi-bin/chat/chat.cgi?action=chat&id=mzrqnlfabswaklfidhkhdxkdfuxnqt
134 24/Sep/05 22:25  /cgi-bin/chat/chat.cgi?action=chat&id=uhdqokonhvkeyztwduthcfveidndew
134  2/Sep/05 19:14  /cgi-bin/chat/chat.cgi?action=chat&id=vnlcqdzhxbhdovaunjunkoeqyorwuh
133 15/Sep/05 16:51  /cgi-bin/chat/chat.cgi?action=chat&id=nupwuiowbusaejyoccumxeohcxjqtj
131 20/Sep/05 14:30  /cgi-bin/chat/chat.cgi?action=chat&id=omeiftpkyglzpyoqzlpxeniojntaaf&pause=
131 21/Sep/05 19:04  /cgi-bin/chat/chat.cgi?action=chat&id=pmduzgmfjnksbdgqnizcyqmzsenddi
130 11/Sep/05 19:36  /cgi-bin/chat/chat.cgi?action=chat&id=otatlqskkxxxsdcljylmnwcagmhslp&pause=
129 19/Sep/05 18:36  /cgi-bin/chat/chat.cgi?action=chat&id=sjxwbcfrzbjrdgobureanosvggoqmc&pause=
129 26/Sep/05 11:59  /cgi-bin/chat/chat.cgi?action=chat&id=btvhwbuvalxucwqfnnshoezksjkapd&pause=
127 27/Sep/05 18:24  /cgi-bin/chat/chat.cgi?action=chat&id=rtmyynfxcrjcldkboqgxfkuvuvhbzx&pause=
127  2/Sep/05 19:38  /cgi-bin/chat/chat.cgi?action=chat&id=dgohcfurkidjzyhwchzpkoyvoronzs&pause=
127 27/Sep/05 19:16  /cgi-bin/chat/chat.cgi?action=chat&id=npkazrsiagrhqdlpjfabunlfihutaz
127 27/Sep/05 21:49  /cgi-bin/chat/chat.cgi?action=chat&id=pnlxoeevtsrtiosghukqbmitskmabh&pause=
125 20/Sep/05 18:29  /cgi-bin/chat/chat.cgi?action=chat&id=diebjkuyovdtfneejskkexfjpmqeaf&pause=
125  4/Sep/05 20:25  /cgi-bin/chat/chat.cgi?action=chat&id=yqnsmgvgycrdsvjpwmkysmbwnybsda
124 24/Sep/05 16:57  /cgi-bin/chat/chat.cgi?action=chat&id=acangtemxeoszgqnlbjtihywdetflr&pause=
124 19/Sep/05 17:02  /cgi-bin/chat/chat.cgi?action=chat&id=clgnbwgmzijenmqrhiybwtwootbdey&pause=
124 24/Sep/05 20:45  /cgi-bin/chat/chat.cgi?action=chat&id=qunfhgiwhrbthgnfxpgjdywkpkxasx&pause=
123  2/Sep/05 21:19  /cgi-bin/chat/chat.cgi?action=chat&id=ewvdisvzhvkvciipvuqqegtwtrihiw&pause=
121 24/Sep/05 14:51  /cgi-bin/chat/chat.cgi?action=chat&id=zkdogjqnwcizkdgwslcgvgefadujge&pause=
121 26/Sep/05 21:02  /cgi-bin/chat/chat.cgi?action=chat&id=yktmljorxcgiodftpbreskegptnsab
121  1/Sep/05 16:30  /cgi-bin/chat/chat.cgi?action=chat&id=eskchxvgzdnoyqsevmfsayuslphouk
120 22/Sep/05 18:18  /cgi-bin/chat/chat.cgi?action=chat&id=yxpbleoiittxhpwtyvrwiqypoyhivr&pause=
119 23/Sep/05 12:34  /cgi-bin/chat/chat.cgi?action=chat&id=zvkfxwfsdofpzhwdzdjakyvctrwsjo&pause=
117  1/Sep/05 20:22  /cgi-bin/chat/chat.cgi?action=chat&id=gxcudskxkxbbmdpbstgxccbifzcvfo
116  8/Sep/05 20:35  /cgi-bin/chat/chat.cgi?action=chat&id=cxegamuexalyiuoigorlelvwwaqlrx
115  1/Sep/05 18:27  /cgi-bin/chat/chat.cgi?action=chat&id=efrtyokkydqsdmjsxpcpxfdldqmqcj
115  8/Sep/05 20:13  /cgi-bin/chat/chat.cgi?action=chat&id=uwubynhjuamiiwnjvsjsrnhzwlquvy&pause=
115 28/Sep/05 21:27  /cgi-bin/chat/chat.cgi?action=chat&id=vfxldxwtwhcrfilzdyiufyfdbmnjki
114 24/Sep/05 16:57  /cgi-bin/chat/chat.cgi?action=chat&id=uomymaaeddimvyfbfounfofqprdbuh&pause=
113 16/Sep/05 20:04  /cgi-bin/chat/chat.cgi?action=chat&id=vbjnbwneuzqyxoidlpretmtanblabg&pause=
111 27/Sep/05 19:43  /cgi-bin/chat/chat.cgi?action=chat&id=kbnvnfsxnaiyblvhtihthonnfymufy
111 28/Sep/05 12:07  /cgi-bin/chat/chat.cgi?action=chat&id=razokjaaorylndfwoyvtdbcwuutjik
111 17/Sep/05 19:57  /cgi-bin/chat/chat.cgi?action=chat&id=fipoqscpalcdmbkmeemnxbenvbsylj&pause=
111 19/Sep/05 20:14  /cgi-bin/chat/chat.cgi?action=chat&id=xhcueyfpbduldhnrrfyutjgkbkozht&pause=
110 13/Sep/05 21:12  /cgi-bin/chat/chat.cgi?action=chat&id=lvyqxuwwhhgbllzqqpsciyvyyuagyj&pause=
110 16/Sep/05 19:48  /cgi-bin/chat/chat.cgi?action=chat&id=tbocllzviancoqetkumfspyzqogeto&pause=
110 29/Sep/05 19:51  /cgi-bin/chat/chat.cgi?action=chat&id=lrhghofelqiejyivcbntlxyqxrorwy&pause=
110 27/Sep/05 16:27  /cgi-bin/chat/chat.cgi?action=chat&id=ehdiljbhquxotpolbkfxemgizaihtn&pause=
109 25/Sep/05 11:38  /cgi-bin/chat/chat.cgi?action=chat&id=bqbndcmrnqsigtmoqrekqnuaxhahvu&pause=
109 28/Sep/05 11:07  /cgi-bin/chat/chat.cgi?action=chat&id=trzcyzlnutxpxdshjjomhbmrdeixhu&pause=
109  4/Sep/05 22:26  /cgi-bin/chat/chat.cgi?action=chat&id=lbomgcbmgwsskbubvnfbcvprvzjbbm&pause=
107 17/Sep/05 18:09  /cgi-bin/chat/chat.cgi?action=chat&id=irrczkjtcsynjuaungriszklwqrbxy&pause=
107  9/Sep/05 20:22  /cgi-bin/chat/chat.cgi?action=chat&id=kvplydnpqmykcppeutxfjiumygbxmr
106 27/Sep/05 15:47  /cgi-bin/chat/chat.cgi?action=chat&id=yrbsegookutuhoextntnqaawswijrs&pause=
106 22/Sep/05 18:41  /cgi-bin/chat/chat.cgi?action=chat&id=izxzrieppzadhfmqcfxtdiujaxzetk&pause=
105 28/Sep/05 19:34  /cgi-bin/chat/chat.cgi?action=chat&id=wqataaxgaiedlpiyeuvgjuvxwagcrz
104 15/Sep/05 20:49  /cgi-bin/chat/chat.cgi?action=chat&id=vurjeifpzfzaoeuklxladpgstpcpmm&pause=
103 13/Sep/05 18:48  /cgi-bin/chat/chat.cgi?action=chat&id=wcriattzhuzmzdufxbtxedvfpstfrn
102  1/Sep/05 18:41  /cgi-bin/chat/chat.cgi?action=chat&id=lntscsnovsnquhqpnvuuwglznvhgar
102 14/Sep/05 17:15  /cgi-bin/chat/chat.cgi?action=chat&id=noxbuamjlucizznhonmiigvayyprsx&pause=
102 15/Sep/05 20:43  /cgi-bin/chat/chat.cgi?action=chat&id=qfyhcwjzrnqrghwxtkfvccogmsvbfo
102 26/Sep/05 17:49  /cgi-bin/chat/chat.cgi?action=chat&id=uwpuzmtbbswbkjxblyobdtccpptpnu
101 29/Sep/05 18:05  /cgi-bin/chat/chat.cgi?action=chat&id=heotdaicnptbcxkdaamysyeeyzhjya&pause=
101 24/Sep/05 19:07  /cgi-bin/chat/chat.cgi?action=chat&id=wzttflzdrylkmgakgfybticrpswwmv&pause=
101 27/Sep/05 19:09  /cgi-bin/chat/chat.cgi?action=chat&id=xmyfvnztfaqbmbkvikqqqutvrhojek&pause=
101 19/Sep/05 14:21  /cgi-bin/chat/chat.cgi?action=chat&id=aahwfdelcasksmmdbyezycwwsvbtuw&pause=
100 25/Sep/05 13:52  /cgi-bin/chat/chat.cgi?action=chat&id=ztoypdoacpeygfnvkzkugaagmcieam&pause=
99  2/Sep/05 19:59  /cgi-bin/chat/chat.cgi?action=chat&id=fwayvgtjapmgsqyxqtburwkverjhlr&pause=
98 21/Sep/05 20:20  /cgi-bin/chat/chat.cgi?action=chat&id=thclnzdyrfwghgwusfqpazxshoizbl&pause=
98  9/Sep/05 20:25  /cgi-bin/chat/chat.cgi?action=chat&id=wpwwgavvebqnfvfwfurinvadindtyn
98 23/Sep/05 22:57  /cgi-bin/chat/chat.cgi?action=chat&id=ytfzrutcmsldhsxhexngrwyuukhoqx
98 26/Sep/05 20:21  /cgi-bin/chat/chat.cgi?action=chat&id=ongoznhsphnonofrjdhuofkvxofnhd&pause=
98  8/Sep/05 19:57  /cgi-bin/chat/chat.cgi?action=chat&id=qakkqdhquqsvgcmxvzohsnshjvrefd&pause=
97 18/Sep/05 14:14  /cgi-bin/chat/chat.cgi?action=chat&id=peseqlsfjfqirpkumrsolrkkscgzau&pause=
97 22/Sep/05 20:09  /cgi-bin/chat/chat.cgi?action=chat&id=wtnauychocwtxuaahcccovdniogbkf&pause=
96  8/Sep/05 20:06  /cgi-bin/chat/chat.cgi?action=chat&id=qakkqdhquqsvgcmxvzohsnshjvrefd
96 28/Sep/05 20:01  /cgi-bin/chat/chat.cgi?action=chat&id=txwryyaudvorisgpwzcmxrivikdtmx&pause=
96 28/Sep/05 18:02  /cgi-bin/chat/chat.cgi?action=chat&id=njnnknrlcovuvrwfgcucxjnqmrbkfe&pause=
95 24/Sep/05 18:28  /cgi-bin/chat/chat.cgi?action=chat&id=elwbwzlkzpblfxttbtsoriwmyxhwee&pause=
95 18/Sep/05 14:24  /cgi-bin/chat/chat.cgi?action=chat&id=hueytrwtyocvrpalyuvsvjjhyfuiuo
94  5/Sep/05 21:48  /cgi-bin/chat/chat.cgi?action=chat&id=izduanoggitywktcljlyenqawclsas
94 12/Sep/05 20:02  /cgi-bin/chat/chat.cgi?action=chat&id=noksrifbydqcxoiboshbghhqnackew
94 21/Sep/05 18:51  /cgi-bin/chat/chat.cgi?action=chat&id=rrirzstycpncynhcuzxaarmwourepk&pause=
93 23/Sep/05 18:36  /cgi-bin/chat/chat.cgi?action=chat&id=hmqpampqezmsieqajcinslhoztjnee&pause=
93 20/Sep/05 16:48  /cgi-bin/chat/chat.cgi?action=chat&id=jnxxlhnpknievlgwxcvgyuevkldkyr
92  5/Sep/05 21:46  /cgi-bin/chat/chat.cgi?action=chat&id=kttzgdhabtevhycxtpmhguqqfdoocj&pause=
91 24/Sep/05 17:52  /cgi-bin/chat/chat.cgi?action=chat&id=ddqnkhhhkztnbesrzxsmcfztjvgnrl&pause=
91  3/Sep/05 20:32  /cgi-bin/chat/chat.cgi?action=chat&id=haqmilwkjdmdakbgkdricivrunvagp&pause=
91 16/Sep/05 20:39  /cgi-bin/chat/chat.cgi?action=chat&id=lcxbbircfsdyowqlhebdvongynacij&pause=
91 24/Sep/05 20:32  /cgi-bin/chat/chat.cgi?action=chat&id=miextgzddxtybzgtcwzgvlpukufiee&pause=
91 28/Sep/05 19:35  /cgi-bin/chat/chat.cgi?action=chat&id=crrzwiflvfuaibfyrntsgwcxpmhddz&pause=
91  3/Sep/05 19:07  /cgi-bin/chat/chat.cgi?action=chat&id=jstdlzdovgidxzjzbnzgwpfaoqnvdf
90 22/Sep/05 19:29  /cgi-bin/chat/chat.cgi?action=chat&id=hkggzgwudlxzlsqeikumrnjszaxnmp
90  3/Sep/05 22:10  /cgi-bin/chat/chat.cgi?action=chat&id=kduocaovrdgqrsuygbmyomhangtczh
89 26/Sep/05 18:26  /cgi-bin/chat/chat.cgi?action=chat&id=svtxucdeldcxvcnhrzmvkxuxuhyqpe&pause=
89 28/Sep/05 11:23  /cgi-bin/chat/chat.cgi?action=chat&id=nfgvmvgvemhcqodnqwjdpzfpddzpfk&pause=
88 11/Sep/05 21:20  /cgi-bin/chat/chat.cgi?action=chat&id=cbwogjsrqfwyjuoloosadvqcwkaekz
88 22/Sep/05 17:01  /cgi-bin/chat/chat.cgi?action=chat&id=hfopnnbdtxiqboufkmfrqudshjihjl&pause=
87 18/Sep/05 16:14  /cgi-bin/chat/chat.cgi?action=chat&id=rwfhyuxmzzgkbnqbufnvabtsugfhdw
87 26/Sep/05 11:52  /cgi-bin/chat/chat.cgi?action=chat&id=uzrkrcklowepztzjnlrlssbldmlkzd&pause=
86 12/Sep/05 19:32  /cgi-bin/chat/chat.cgi?action=chat&id=mtmxemjucdoewmfqjpsgjswcvljwim&pause=
86  4/Sep/05 20:56  /cgi-bin/chat/chat.cgi?action=chat&id=frorjnimuwturpqqfwulgmufvfodwt
86  3/Sep/05 11:37  /cgi-bin/chat/chat.cgi?action=chat&id=bujjwskyiacbvswwemojnnzertacix&pause=
85  1/Sep/05 20:37  /cgi-bin/chat/chat.cgi?action=chat&id=xrxuvjlpgugnowvrmhuburiircvlrp
84 19/Sep/05 19:49  /cgi-bin/chat/chat.cgi?action=chat&id=fpsdkrdedwzkbynbxtjyybvujxohpi&pause=
83  8/Sep/05 21:41  /cgi-bin/chat/chat.cgi?action=chat&id=qcwekttrjqetiwqrehqhesovganhqr
83 28/Sep/05 20:45  /cgi-bin/chat/chat.cgi?action=chat&id=bnfswwlxalzywrgeacygdqvzzrfmbc&pause=
82  7/Sep/05 18:51  /cgi-bin/chat/chat.cgi?action=chat&id=hswgvbfkzeosruuymrzbzdttazjeun&pause=
82 23/Sep/05 20:24  /cgi-bin/chat/chat.cgi?action=chat&id=luzwzleiskwacivdxtnrjqbewqnebv&pause=
80 29/Sep/05 19:43  /cgi-bin/chat/chat.cgi?action=chat&id=lrhghofelqiejyivcbntlxyqxrorwy
80 27/Sep/05 15:38  /cgi-bin/chat/chat.cgi?action=chat&id=tkasisuuqmrctfhciwrgaumtnbxitd&pause=
80 11/Sep/05 21:01  /cgi-bin/chat/chat.cgi?action=chat&id=zlvquvfydgndzyrqerosromppgeohy
80  8/Sep/05 12:06  /cgi-bin/chat/chat.cgi?action=chat&id=deoymwmdfsubpgvmwjellsaxildyyy&pause=
79 28/Sep/05 12:24  /cgi-bin/chat/chat.cgi?action=chat&id=inmlqiduzjmhlnhivfpsnruvpazhxy
79 18/Sep/05 17:46  /cgi-bin/chat/chat.cgi?action=chat&id=cdlaejxdvpxamdooqbzdvhedkabaqk&pause=
78 25/Sep/05 14:28  /cgi-bin/chat/chat.cgi?action=chat&id=gesjuhhhsttlizzhilkrditnrkbhva&pause=
77 19/Sep/05 20:23  /cgi-bin/chat/chat.cgi?action=chat&id=gujeyrmwwdrsvlzougimjpbdvmbjor&pause=
77 27/Sep/05 11:25  /cgi-bin/chat/chat.cgi?action=chat&id=fazfaclldlpccfdlnvryhumediupuz&pause=
77 28/Sep/05 19:21  /cgi-bin/chat/chat.cgi?action=chat&id=tefkblimaexfexuauludqvkhqguxzz
76 20/Sep/05 14:31  /cgi-bin/chat/chat.cgi?action=chat&id=rdmtyarhrmmgrixwirdznlribfkvke&pause=
76 27/Sep/05 16:27  /cgi-bin/chat/chat.cgi?action=chat&id=zifozjalunacqyxhgggnnpafftdvbh&pause=
76  3/Sep/05 17:19  /cgi-bin/chat/chat.cgi?action=chat&id=fhsmlhxxwekgmusbssavosybdprcrz&pause=
76 23/Sep/05 15:30  /cgi-bin/chat/chat.cgi?action=chat&id=oovgnxrlskxcsnkdxheiapvimmlnlx&pause=
76 15/Sep/05 20:10  /cgi-bin/chat/chat.cgi?action=chat&id=pzxeghbjbebrztycwwzqzobwkzpbrw
76  3/Sep/05 19:20  /cgi-bin/chat/chat.cgi?action=chat&id=vlhukawilnvetthtjltjcyulaotyzc
75 10/Sep/05 17:57  /cgi-bin/chat/chat.cgi?action=chat&id=pkkalcsznvnedmstdjrmxgquhlvnga&pause=
75  5/Sep/05 16:50  /cgi-bin/chat/chat.cgi?action=chat&id=bdxjxvpmxbrgonyzkprotknffdlpkc&pause=
74 18/Sep/05 17:25  /cgi-bin/chat/chat.cgi?action=chat&id=pwbexyqsvoxvqqnqmkqgrlehjjfnwx&pause=
74 27/Sep/05 16:00  /cgi-bin/chat/chat.cgi?action=chat&id=yrbsegookutuhoextntnqaawswijrs
74  5/Sep/05 19:31  /cgi-bin/chat/chat.cgi?action=chat&id=cpsjhvrtirckpfniwnwegdvxhfchjn&pause=
73 23/Sep/05 15:34  /cgi-bin/chat/chat.cgi?action=chat&id=occxzixdmirrxmlrapnvdmecnsthuh&pause=
73 14/Sep/05 16:58  /cgi-bin/chat/chat.cgi?action=chat&id=xdbhempohcsibwpsatrolhocymgcyg
71 22/Sep/05 16:29  /cgi-bin/chat/chat.cgi?action=chat&id=zpnnsmkmaybjnowlrkgvvplkxdblzw&pause=
71 24/Sep/05 17:26  /cgi-bin/chat/chat.cgi?action=chat&id=snfhjydgraydspmeyhdtillvvrhnrh&pause=
70 24/Sep/05 14:46  /cgi-bin/chat/chat.cgi?action=chat&id=dqdaarzwqfobmursuppbtgprorphme
68 14/Sep/05 14:24  /cgi-bin/chat/chat.cgi?action=chat&id=krqeqhfbeknhzncgpfdctbbhvlcfpk&pause=
67 19/Sep/05 21:05  /cgi-bin/chat/chat.cgi?action=chat&id=rkuumrrozuyxurvsrifwjzhtdzlwfg
67 23/Sep/05 13:58  /cgi-bin/chat/chat.cgi?action=chat&id=lwzuusibijdxqyhekrbvlqxkcaakff&pause=
67  2/Sep/05 10:48  /cgi-bin/chat/chat.cgi?action=chat&id=grffrvvmywrlpgcrcbtqiiywiugncv&pause=
67 10/Sep/05 10:33  /cgi-bin/chat/chat.cgi?action=chat&id=zaneqoqzfuhdutjqvbkkxbmvqsonhq
66  1/Sep/05 09:47  /cgi-bin/chat/chat.cgi?action=chat&id=sczjwdktjcqlhqnialxuncbkzajwec
66 13/Sep/05 18:03  /cgi-bin/chat/chat.cgi?action=chat&id=snqxxbptamnlacxaxbavsxqzehymbc&pause=
65 22/Sep/05 15:48  /cgi-bin/chat/chat.cgi?action=chat&id=yukfgcyrojytzchzyshgahfyfbcojm
65 19/Sep/05 19:28  /cgi-bin/chat/chat.cgi?action=chat&id=qrlkcvjouwzcqwgfievunfzocmfnux
65 23/Sep/05 19:15  /cgi-bin/chat/chat.cgi?action=chat&id=etojoztxuwrftlyyufkmmyrupyqnjz
64 17/Sep/05 19:33  /cgi-bin/chat/chat.cgi?action=chat&id=uvlmftqqsffeevnvokbjumxrcjrvwt&pause=
64 21/Sep/05 18:30  /cgi-bin/chat/chat.cgi?action=chat&id=zmctljvoabbluufurfhzpkottbysph&pause=
64 24/Sep/05 13:52  /cgi-bin/chat/chat.cgi?action=chat&id=irhpubkltapmmssvlfhyhtanbzwelz&pause=
63 20/Sep/05 20:47  /cgi-bin/chat/chat.cgi?action=chat&id=tcrnploqzpfpfvzxfqiedlurktwfee&pause=
63 24/Sep/05 20:02  /cgi-bin/chat/chat.cgi?action=chat&id=jtqmrxrnyydptetazdrbabaosfzrge&pause=
63 26/Sep/05 12:06  /cgi-bin/chat/chat.cgi?action=chat&id=uzrkrcklowepztzjnlrlssbldmlkzd
63 27/Sep/05 20:03  /cgi-bin/chat/chat.cgi?action=chat&id=jrbajdzbfjqpijxqgxssdjisodxklc&pause=
62 21/Sep/05 09:20  /cgi-bin/chat/chat.cgi?action=chat&id=cylpibyzprvyrduxvcwhsyhuqhekmx
62 23/Sep/05 19:48  /cgi-bin/chat/chat.cgi?action=chat&id=znjdylgdljiitmlvurcggaxqfcwgjl&pause=
62 24/Sep/05 21:44  /cgi-bin/chat/chat.cgi?action=chat&id=ubnkxayvyfhqjhjzaqxssnlrhfsaft
62 22/Sep/05 18:36  /cgi-bin/chat/chat.cgi?action=chat&id=muasuuyckalnxigkblwbnnzcsetewd&pause=
62  1/Sep/05 21:27  /cgi-bin/chat/chat.cgi?action=chat&id=kgjjjkqzwibhugqesrltgsbexgdkbl&pause=
62 26/Sep/05 18:31  /cgi-bin/chat/chat.cgi?action=chat&id=roagnxmyrpriyebogovbdgdiyqlujk&pause=
61 23/Sep/05 19:30  /cgi-bin/chat/chat.cgi?action=chat&id=ambpobhvbcgrdjzanqxfhuxyoquemw&pause=
61  5/Sep/05 18:15  /cgi-bin/chat/chat.cgi?action=chat&id=jveguedwptpczwptpauoeahhoocbzr&pause=
61  1/Sep/05 16:09  /cgi-bin/chat/chat.cgi?action=chat&id=eskchxvgzdnoyqsevmfsayuslphouk&pause=
60 26/Sep/05 11:57  /cgi-bin/chat/chat.cgi?action=chat&id=mjsuulxpeyoacmdyllclqohlegarco&pause=
60  6/Sep/05 16:16  /cgi-bin/chat/chat.cgi?action=chat&id=uumdfnxtmehwgucrwuanrvtzdrtyhv
59  1/Sep/05 21:24  /cgi-bin/chat/chat.cgi?action=chat&id=zfettvjhoyyhbqsjbrbapjvarobyrv&pause=
59 20/Sep/05 16:39  /cgi-bin/chat/chat.cgi?action=chat&id=jnxxlhnpknievlgwxcvgyuevkldkyr&pause=
59 24/Sep/05 20:45  /cgi-bin/chat/chat.cgi?action=chat&id=oyeqlcbhsrfdyqaotinltlrjqdbmfd
59 22/Sep/05 17:35  /cgi-bin/chat/chat.cgi?action=chat&id=iojsguufakbjlckfthsyrnpdfqdtfd&pause=
58  5/Sep/05 18:27  /cgi-bin/chat/chat.cgi?action=chat&id=zsgwfwsrmgujkncqbpessxypbfnvar&pause=
57  6/Sep/05 15:09  /cgi-bin/chat/chat.cgi?action=chat&id=flqjrjvkwlmdexgpjhdhejdmkegmap
56 18/Sep/05 16:56  /cgi-bin/chat/chat.cgi?action=chat&id=xdezunfzmfotklxcihnwulsdrflxvr&pause=
55 27/Sep/05 06:24  /cgi-bin/chat/chat.cgi?action=chat&id=waiudtvdaplzdmwanihauaxhoyervu&pause=
55 26/Sep/05 15:46  /cgi-bin/chat/chat.cgi?action=chat&id=xgnqvqlutlnalbnzrxvgyfecjqesbf
55 29/Sep/05 20:21  /cgi-bin/chat/chat.cgi?action=chat&id=rqrktllkkdvadsjwmukledkixakpex
55  3/Sep/05 20:47  /cgi-bin/chat/chat.cgi?action=chat&id=zlxomhyjndqmtaneatumtcshxkommz&pause=
55  6/Sep/05 19:38  /cgi-bin/chat/chat.cgi?action=chat&id=qoystlpvirhuqqvgaekpbssmxueprd
54  1/Sep/05 15:21  /cgi-bin/chat/chat.cgi?action=chat&id=nomtyopmluqildfcxmaszwklzxyaqm
54 28/Sep/05 11:59  /cgi-bin/chat/chat.cgi?action=chat&id=vsribkqjjlkavnjkiyrzbvsxofuwsv&pause=
53 23/Sep/05 13:16  /cgi-bin/chat/chat.cgi?action=chat&id=jmnwttakzlvybzquimcgkytlecufsf&pause=
53 21/Sep/05 15:01  /cgi-bin/chat/chat.cgi?action=chat&id=fqanfhfzqxdgqprulghophgtszegqi
53 11/Sep/05 19:47  /cgi-bin/chat/chat.cgi?action=chat&id=ucmppvcypusugurfbzzuyostlfllsv&pause=
52 19/Sep/05 19:23  /cgi-bin/chat/chat.cgi?action=chat&id=anlslebempfkxqzsejxigfgvxklinz&pause=
52 12/Sep/05 19:54  /cgi-bin/chat/chat.cgi?action=chat&id=ftyjnhvnriqpatsidajarycrtmyzkp&pause=
52 15/Sep/05 19:56  /cgi-bin/chat/chat.cgi?action=chat&id=pzxeghbjbebrztycwwzqzobwkzpbrw&pause=
51  1/Sep/05 07:14  /cgi-bin/chat/chat.cgi?action=chat&id=nhsayjoelwnxnntoosqhboqmslpsql&pause=
51 24/Sep/05 16:11  /cgi-bin/chat/chat.cgi?action=chat&id=xwzoqxcfopngadpyvgbnfivipkptuo&pause=
51 22/Sep/05 16:10  /cgi-bin/chat/chat.cgi?action=chat&id=dodcmjkbocpjvlcnowmbwhwcyvwivb&pause=
50 20/Sep/05 01:38  /cgi-bin/chat/chat.cgi?action=chat&id=klnkjafofihvspubnetfoziymhthsa&pause=
50 19/Sep/05 20:20  /cgi-bin/chat/chat.cgi?action=chat&id=ubnkxayvyfhqjhjzaqxssnlrhfsaft&pause=
50 26/Sep/05 12:48  /cgi-bin/chat/chat.cgi?action=chat&id=ppmrfqodxsqyyrfinabhwcausopyif
50  4/Sep/05 22:14  /cgi-bin/chat/chat.cgi?action=chat&id=hcgqnqcfjqecskmcugaamwtctseama
49  9/Sep/05 19:50  /cgi-bin/chat/chat.cgi?action=chat&id=bvxevrzypulddmbylronosjntpeszv&pause=
49  8/Sep/05 18:41  /cgi-bin/chat/chat.cgi?action=chat&id=gkqgxgsgtwyepycznfqugerqkhvuke
48 17/Sep/05 17:04  /cgi-bin/chat/chat.cgi?action=chat&id=jhcotvwcqekvjsuujgkfusnkwokzdc
48 24/Sep/05 18:51  /cgi-bin/chat/chat.cgi?action=chat&id=zcdbqfqykdpywtrplmegujvlpgthrx&pause=
48 29/Sep/05 18:31  /cgi-bin/chat/chat.cgi?action=chat&id=uffqpizwgdwztpsigrfiyrpfujkhaf&pause=
48  6/Sep/05 16:07  /cgi-bin/chat/chat.cgi?action=chat&id=rsmpnouamhdcdtglgsgkwfpwsootwi&pause=
47 19/Sep/05 17:47  /cgi-bin/chat/chat.cgi?action=chat&id=cgvruppqdchheirdleimgugnhzrclj&pause=
47 28/Sep/05 09:36  /cgi-bin/chat/chat.cgi?action=chat&id=nkncbxnbidiuvhxhpvdgajeownzyyn
46  3/Sep/05 21:13  /cgi-bin/chat/chat.cgi?action=chat&id=cgwphdkgigwqhxnprvjrcocoodwdpl
46 28/Sep/05 15:22  /cgi-bin/chat/chat.cgi?action=chat&id=aibkbcuptcatkjevadcodvulwldvpb&pause=
46  7/Sep/05 12:17  /cgi-bin/chat/chat.cgi?action=chat&id=jsnazizlqrjobnbuyfhpmubegoeqca
45 20/Sep/05 18:34  /cgi-bin/chat/chat.cgi?action=chat&id=xpmmfpdwoblatnvsopqoeoxglnsfib
45 19/Sep/05 16:09  /cgi-bin/chat/chat.cgi?action=chat&id=heulxuizjtyrlniolwcglzkwskqyhu&pause=
45 23/Sep/05 20:52  /cgi-bin/chat/chat.cgi?action=chat&id=ycywgsslpuntoehctdzlcusrsilgyv
44 26/Sep/05 17:30  /cgi-bin/chat/chat.cgi?action=chat&id=uwpuzmtbbswbkjxblyobdtccpptpnu&pause=
44 29/Sep/05 14:57  /cgi-bin/chat/chat.cgi?action=chat&id=ptzpeltutllvuvopwcxaltjiuneerw&pause=
44  8/Sep/05 15:11  /cgi-bin/chat/chat.cgi?action=chat&id=jfszrvmirvugketdswgsmynfgmatpq&pause=
43  3/Sep/05 23:24  /cgi-bin/chat/chat.cgi?action=chat&id=keoxcdafxzbjjwosbeklopfelvvsxb&pause=
42 12/Sep/05 09:31  /cgi-bin/chat/chat.cgi?action=chat&id=vgjssnmoivhzpomwlxnecivixohxcs&pause=
42 24/Sep/05 18:59  /cgi-bin/chat/chat.cgi?action=chat&id=zcdbqfqykdpywtrplmegujvlpgthrx
42  8/Sep/05 13:44  /cgi-bin/chat/chat.cgi?action=chat&id=qymnjbhpwycrdojadfakkvpqymitgg&pause=
42 27/Sep/05 07:50  /cgi-bin/chat/chat.cgi?action=chat&id=gtaaiiojcbipqcpuhkodmkkxkinwzs&pause=
41  5/Sep/05 19:15  /cgi-bin/chat/chat.cgi?action=chat&id=boottpwudxcuktutplkujacletdfby&pause=
41  2/Sep/05 01:29  /cgi-bin/chat/chat.cgi?action=chat&id=gzdgczmfxqxgxmhbjyghgxizzfbkzd&pause=
41 27/Sep/05 06:45  /cgi-bin/chat/chat.cgi?action=chat&id=oasjyqabxwoskogrreotynyfgdswap&pause=
41 24/Sep/05 19:44  /cgi-bin/chat/chat.cgi?action=chat&id=rkftsmzieulqgfonderyygalqpgdhw
41 19/Sep/05 16:00  /cgi-bin/chat/chat.cgi?action=chat&id=sftnpumhiiikjrfcujvvqtrbotgpwx&pause=
40  3/Sep/05 10:25  /cgi-bin/chat/chat.cgi?action=chat&id=xaerajakavmdtcuylboweiusrrerpn&pause=
40 22/Sep/05 19:50  /cgi-bin/chat/chat.cgi?action=chat&id=wtnauychocwtxuaahcccovdniogbkf
39 21/Sep/05 20:33  /cgi-bin/chat/chat.cgi?action=chat&id=zezeedejhkdtqntickuvtirkkrjajw
39 28/Sep/05 17:56  /cgi-bin/chat/chat.cgi?action=chat&id=ucbevkesaxudurvibwujzcllfgkbcf&pause=
39 17/Sep/05 12:07  /cgi-bin/chat/chat.cgi?action=chat&id=lsspamapspelnumtxbpfduoixvakjt&pause=
38  6/Sep/05 12:48  /cgi-bin/chat/chat.cgi?action=chat&id=gudghmqosrkonzskubtrqkhdtqpbbg&pause=
38 11/Sep/05 18:04  /cgi-bin/chat/chat.cgi?action=chat&id=xorzgcoyttezgstksdhotmxlxqpdjb&pause=
38 21/Sep/05 18:32  /cgi-bin/chat/chat.cgi?action=chat&id=uhakidrnqzzoakppmxgxkajohjdntn&pause=
38  2/Sep/05 20:39  /cgi-bin/chat/chat.cgi?action=chat&id=obtjjvceobqlnvavnenxfzbgkdedgc&pause=
38 15/Sep/05 21:00  /cgi-bin/chat/chat.cgi?action=chat&id=vaccvlikvfjwalxzbdkevjnzxmlspo
37 24/Sep/05 16:04  /cgi-bin/chat/chat.cgi?action=chat&id=cinfzyfssloroocmtdwnydqjivjhtf
37 25/Sep/05 13:55  /cgi-bin/chat/chat.cgi?action=chat&id=rphcmwmmuqrpfsemhbkwfuvyisrbdb&pause=
37 23/Sep/05 16:51  /cgi-bin/chat/chat.cgi?action=chat&id=algdjprcbnabkgoxfnwdxgkdkihgcw&pause=
37  4/Sep/05 17:56  /cgi-bin/chat/chat.cgi?action=chat&id=qrwtsaywyjjjpqcqjizebackbucobz
37 26/Sep/05 16:36  /cgi-bin/chat/chat.cgi?action=chat&id=mzrqnlfabswaklfidhkhdxkdfuxnqt&pause=
37  9/Sep/05 19:56  /cgi-bin/chat/chat.cgi?action=chat&id=ygsjxwzfjitoxxaqpxoumvshkpfnmb&pause=
37 15/Sep/05 20:17  /cgi-bin/chat/chat.cgi?action=chat&id=hvvkglsyemhjwhwijzbectdogofkss
36 11/Sep/05 18:04  /cgi-bin/chat/chat.cgi?action=chat&id=nexeqpbgewnhqbiyacqpyehztwqkwx&pause=
36 22/Sep/05 17:25  /cgi-bin/chat/chat.cgi?action=chat&id=pufscparwfazegbdsjywufgbegfmzs&pause=
36 15/Sep/05 20:34  /cgi-bin/chat/chat.cgi?action=chat&id=qfyhcwjzrnqrghwxtkfvccogmsvbfo&pause=
36 21/Sep/05 20:42  /cgi-bin/chat/chat.cgi?action=chat&id=exohkpbnunwycmxkaryskigamvuyjt
35 29/Sep/05 16:14  /cgi-bin/chat/chat.cgi?action=chat&id=yolszquhddxqkihczdawzduofnqaoe
35 17/Sep/05 19:21  /cgi-bin/chat/chat.cgi?action=chat&id=crloyauoppiwgkxvbmyrfprngrkhdc&pause=
35 20/Sep/05 20:45  /cgi-bin/chat/chat.cgi?action=chat&id=ssoqxegvccpeygioveeloaukjuolrh&pause=
34 18/Sep/05 11:58  /cgi-bin/chat/chat.cgi?action=chat&id=ergqjdfwtnzeuztwxqsyepzgqbrgzn&pause=
34 22/Sep/05 14:23  /cgi-bin/chat/chat.cgi?action=chat&id=bmyppmjkmoyewdfrkqzqlzzfposvsb&pause=
34 26/Sep/05 20:49  /cgi-bin/chat/chat.cgi?action=chat&id=rlbwfsmvdvprsnktxdtbjdsjkqzpln&pause=
33 21/Sep/05 12:53  /cgi-bin/chat/chat.cgi?action=chat&id=rrppjskrdmjrjzfootmsqbjyegkcat&pause=
33  6/Sep/05 16:05  /cgi-bin/chat/chat.cgi?action=chat&id=uumdfnxtmehwgucrwuanrvtzdrtyhv&pause=
33 27/Sep/05 11:35  /cgi-bin/chat/chat.cgi?action=chat&id=fazfaclldlpccfdlnvryhumediupuz
33  2/Sep/05 22:08  /cgi-bin/chat/chat.cgi?action=chat&id=dxzxebkvgnarukrpwhdlakrifuynia
33 29/Sep/05 19:06  /cgi-bin/chat/chat.cgi?action=chat&id=wabfagoezsawdnheqkctllhqjczbkk&pause=
33 22/Sep/05 16:42  /cgi-bin/chat/chat.cgi?action=chat&id=aeoohejjzuoxvhurzswharqlfbulwl&pause=
33  6/Sep/05 15:36  /cgi-bin/chat/chat.cgi?action=chat&id=jhdxvhcbndkocdddsibobpddbsoiup&pause=
32 17/Sep/05 17:15  /cgi-bin/chat/chat.cgi?action=chat&id=jhcotvwcqekvjsuujgkfusnkwokzdc&pause=
32 23/Sep/05 13:42  /cgi-bin/chat/chat.cgi?action=chat&id=lwzuusibijdxqyhekrbvlqxkcaakff
32 25/Sep/05 20:01  /cgi-bin/chat/chat.cgi?action=chat&id=naaxcikrbakcsmkdxampkuijqzmomj&pause=
32 11/Sep/05 21:09  /cgi-bin/chat/chat.cgi?action=chat&id=tderbeuhjqquqgspckwruqgwiiutii
32 14/Sep/05 16:54  /cgi-bin/chat/chat.cgi?action=chat&id=qgrntyintirmlmnqsxrceesbgaybdr&pause=
32 18/Sep/05 13:56  /cgi-bin/chat/chat.cgi?action=chat&id=hueytrwtyocvrpalyuvsvjjhyfuiuo&pause=
32  5/Sep/05 18:20  /cgi-bin/chat/chat.cgi?action=chat&id=qsuovplvlqtgcqstizcfkzuabrnkvc
31  5/Sep/05 19:11  /cgi-bin/chat/chat.cgi?action=chat&id=ksuvkfiplidhpjtuyuaikopzmdwwys&pause=
31 26/Sep/05 17:17  /cgi-bin/chat/chat.cgi?action=chat&id=cqpaattjofeovbeojcosdldncxmdzu&pause=
31 23/Sep/05 19:40  /cgi-bin/chat/chat.cgi?action=chat&id=ezbyypkobplprnhcyqiqjovuightgu
30 19/Sep/05 15:23  /cgi-bin/chat/chat.cgi?action=chat&id=lwvnwneimbksccknjhtvlnhlodnrwa
30 19/Sep/05 20:05  /cgi-bin/chat/chat.cgi?action=chat&id=itxkpbhqysqhytmtidkvdfomskjsol&pause=
30 19/Sep/05 20:49  /cgi-bin/chat/chat.cgi?action=chat&id=whkqewyofifxoyyorgoalpzpekiubj
30 22/Sep/05 21:21  /cgi-bin/chat/chat.cgi?action=chat&id=yeorptdouhxzimjkluwlbhdsxgpzhg
30 24/Sep/05 16:58  /cgi-bin/chat/chat.cgi?action=chat&id=tkxdvypuckahoxthnaalxjfwgogmmx&pause=
30 20/Sep/05 15:18  /cgi-bin/chat/chat.cgi?action=chat&id=kowpabnojzkbrqocrvegirpljhgtod&pause=
30  4/Sep/05 22:36  /cgi-bin/chat/chat.cgi?action=chat&id=btfgilzpywgjzfzrtbmhxvgfimmfyo&pause=
30  8/Sep/05 15:47  /cgi-bin/chat/chat.cgi?action=chat&id=hprymozbklrxouwubctnuhhuwrheqz
29 21/Sep/05 03:22  /cgi-bin/chat/chat.cgi?action=chat&id=cqlhdyoecdyhnvwpbjadybgvfsvofe
29 25/Sep/05 18:03  /cgi-bin/chat/chat.cgi?action=chat&id=yxaiwragqsdcfulbvfmadadcxucmcu&pause=
29 18/Sep/05 16:17  /cgi-bin/chat/chat.cgi?action=chat&id=altvefofldefawavpambipugjsmabj
29 24/Sep/05 21:06  /cgi-bin/chat/chat.cgi?action=chat&id=nardikccpegxnxwgkptainmmprvsoy&pause=
29 26/Sep/05 15:35  /cgi-bin/chat/chat.cgi?action=chat&id=bcrabdupvduhrctcjvrczrpgiwyzek
28 20/Sep/05 11:30  /cgi-bin/chat/chat.cgi?action=chat&id=tbyklcvqdxawwmzlcgjyztosbemxkp
28 24/Sep/05 12:23  /cgi-bin/chat/chat.cgi?action=chat&id=ihxgxjdeknyatvgyytmiecnzdnueka&pause=
28  1/Sep/05 18:09  /cgi-bin/chat/chat.cgi?action=chat&id=wablvjxfnxoswgekypnxggsfvqeyar&pause=
28 27/Sep/05 16:05  /cgi-bin/chat/chat.cgi?action=chat&id=dqtrhssdayywhiqfidiewuyvrqllvu&pause=
28  9/Sep/05 18:06  /cgi-bin/chat/chat.cgi?action=chat&id=hcpphuiyeiafjqtzqjkpgigonezirl&pause=
28 22/Sep/05 13:59  /cgi-bin/chat/chat.cgi?action=chat&id=wujwhobrqryuixhejbygpjzwxbzxrn&pause=
27  3/Sep/05 15:21  /cgi-bin/chat/chat.cgi?action=chat&id=jceyaxihuksvyyptwfszvhnrmzbfni&pause=
27  9/Sep/05 19:11  /cgi-bin/chat/chat.cgi?action=chat&id=lzmdhyqjegqkyzvewmosjzqnyrvgrh&pause=
27 26/Sep/05 19:24  /cgi-bin/chat/chat.cgi?action=chat&id=bxtwxuccsxcmbcefwxxqfwmkthzcsk&pause=
27 27/Sep/05 11:25  /cgi-bin/chat/chat.cgi?action=chat&id=jdwjosxrarqkvzgtztabxtqyoskzia&pause=
27 12/Sep/05 12:51  /cgi-bin/chat/chat.cgi?action=chat&id=apcnhoygsltkgtczsuhgalmwgxabdc
27  4/Sep/05 23:00  /cgi-bin/chat/chat.cgi?action=chat&id=lfefvpcfwgfsrfhxbxahsswfohpgwe
26  1/Sep/05 20:51  /cgi-bin/chat/chat.cgi?action=chat&id=bslquwppmlkzquqeqtsgezkwqjtuoc&pause=
26 14/Sep/05 06:43  /cgi-bin/chat/chat.cgi?action=chat&id=espbhnsbakpqeptblzjwfkavkjiqqv&pause=
26  9/Sep/05 19:08  /cgi-bin/chat/chat.cgi?action=chat&id=tqapwywhgiyqkvxigrjfnlllddsdvb&pause=
25 18/Sep/05 19:33  /cgi-bin/chat/chat.cgi?action=chat&id=xvamamcpkxojdnybluyjxujmlwdcgd&pause=
25 24/Sep/05 16:05  /cgi-bin/chat/chat.cgi?action=chat&id=rfqhsvkktdvoeqrchsrhuymhxadqgy&pause=
25 24/Sep/05 22:29  /cgi-bin/chat/chat.cgi?action=chat&id=rfrdfoktdqgstzmhagbswbrzicehep&pause=
25 27/Sep/05 20:04  /cgi-bin/chat/chat.cgi?action=chat&id=xszfwcrfinzyvizrvfupidzhmukula&pause=
25 17/Sep/05 19:07  /cgi-bin/chat/chat.cgi?action=chat&id=pmzunbdxvjbxmnhdewakmlltnrpmhy&pause=
24 24/Sep/05 16:35  /cgi-bin/chat/chat.cgi?action=chat&id=rbnasyumtldpdkkztnpneomwdrfchq&pause=
24 21/Sep/05 19:55  /cgi-bin/chat/chat.cgi?action=chat&id=ccxlyrlxzaejjinkmvzfsinjmdpady&pause=
24 15/Sep/05 20:04  /cgi-bin/chat/chat.cgi?action=chat&id=mnrhmqheacbofkqkmggbbzxvujewfv&pause=
24 16/Sep/05 14:39  /cgi-bin/chat/chat.cgi?action=chat&id=zsisqzmkyjafulxecyncvomlocmlln
24 11/Sep/05 16:01  /cgi-bin/chat/chat.cgi?action=chat&id=zyycvuytfdnwzgsrmecyujtfyfqakv&pause=
24 19/Sep/05 18:35  /cgi-bin/chat/chat.cgi?action=chat&id=xlvtnyhkkbxlwasssloxdzidqgefuf
24 22/Sep/05 18:40  /cgi-bin/chat/chat.cgi?action=chat&id=muasuuyckalnxigkblwbnnzcsetewd
24  4/Sep/05 16:24  /cgi-bin/chat/chat.cgi?action=chat&id=mxukvxlucsdigwnfghvuixcixarxve&pause=
24  6/Sep/05 01:16  /cgi-bin/chat/chat.cgi?action=chat&id=venazthbqheqyfxpktbvucoiawgula&pause=
24 10/Sep/05 15:41  /cgi-bin/chat/chat.cgi?action=chat&id=lainbnherdqlnkxbpdncqemylhtxmc&pause=
24 24/Sep/05 18:35  /cgi-bin/chat/chat.cgi?action=chat&id=elwbwzlkzpblfxttbtsoriwmyxhwee
23 18/Sep/05 19:51  /cgi-bin/chat/chat.cgi?action=chat&id=sbmfkqwwebfuxtcugjdzjzonebyxaf&pause=
23 27/Sep/05 20:03  /cgi-bin/chat/chat.cgi?action=chat&id=fqzijhgwxaejsfjglvdsedvcveacca
23 12/Sep/05 18:05  /cgi-bin/chat/chat.cgi?action=chat&id=zpgdiaphiwbmcwsgokrlishxbzbgvz&pause=
23 23/Sep/05 13:02  /cgi-bin/chat/chat.cgi?action=chat&id=xnaxzcugmyfbejjmnnskbyuyqocpuj
23 17/Sep/05 09:09  /cgi-bin/chat/chat.cgi?action=chat&id=ndejktpykobtuqreoeccjxquqsokmu&pause=
23  6/Sep/05 23:42  /cgi-bin/chat/chat.cgi?action=chat&id=ujzjcqyqbrkjwfizwucnguybojkgfk&pause=
22 20/Sep/05 02:57  /cgi-bin/chat/chat.cgi?action=chat&id=kntztrzoxscrobeskewthxytfpaftw&pause=
22 19/Sep/05 18:35  /cgi-bin/chat/chat.cgi?action=chat&id=xlvtnyhkkbxlwasssloxdzidqgefuf&pause=
22 25/Sep/05 13:38  /cgi-bin/chat/chat.cgi?action=chat&id=zsrkhstbrjbqnduwdrppwdrxoyeayi&pause=
22 23/Sep/05 21:11  /cgi-bin/chat/chat.cgi?action=chat&id=vbnptgtjotygspxmgejvncctehmhpl&pause=
22 22/Sep/05 04:26  /cgi-bin/chat/chat.cgi?action=chat&id=tyzsdrmepdfbjmnhzflfavwdsbgfcz
21 16/Sep/05 20:06  /cgi-bin/chat/chat.cgi?action=chat&id=hovstivivnjaubbynxbvdozyrnxkzw&pause=
21 27/Sep/05 07:48  /cgi-bin/chat/chat.cgi?action=chat&id=idgqliqzpmoyirynnxgywgukipawsz&pause=
21 18/Sep/05 12:09  /cgi-bin/chat/chat.cgi?action=chat&id=dirpanzzacmtlbechdpswqdzjxibta&pause=
21 17/Sep/05 16:18  /cgi-bin/chat/chat.cgi?action=chat&id=mqasfyijcofylthdevdlswijfpspzz&pause=
21 27/Sep/05 07:44  /cgi-bin/chat/chat.cgi?action=chat&id=gsxqzmsuztlnpqpabxedoqtpdttkbz&pause=
21  9/Sep/05 18:39  /cgi-bin/chat/chat.cgi?action=chat&id=yftniqrtuvwuqibezqisyicrgawskh&pause=
20  2/Sep/05 16:46  /cgi-bin/chat/chat.cgi?action=chat&id=mahfrqqdkupqxllnybwneldzolgnxa&pause=
20 21/Sep/05 09:18  /cgi-bin/chat/chat.cgi?action=chat&id=yzlbcoqompxnufcchgzjdrfqsqzvlf&pause=
20 24/Sep/05 23:21  /cgi-bin/chat/chat.cgi?action=chat&id=mhdodbfzmzqjgudkjboqsnxvevwutb&pause=
20  3/Sep/05 20:25  /cgi-bin/chat/chat.cgi?action=chat&id=znboygaecmpsmzimxjgtvjztfjncjv&pause=
20 25/Sep/05 08:47  /cgi-bin/chat/chat.cgi?action=chat&id=gsdyawlnknjuvxhtvwiyqbfiwtkefw
20  1/Sep/05 20:36  /cgi-bin/chat/chat.cgi?action=chat&id=emimzbvpvdtgqugtwglzaggdydvdvp&pause=
20  1/Sep/05 14:26  /cgi-bin/chat/chat.cgi?action=chat&id=ysstxamtozmwlwrmviewndaaunltib&pause=
19  4/Sep/05 17:27  /cgi-bin/chat/chat.cgi?action=chat&id=pqktxswzyklwufumdarapkquqrhxqy&pause=
19 28/Sep/05 17:35  /cgi-bin/chat/chat.cgi?action=chat&id=nphlgftxnccsqbcgqufucdrrorbnvg&pause=
19 21/Sep/05 14:27  /cgi-bin/chat/chat.cgi?action=chat&id=wdjqstdasbqboykbictmpdiuojbxhq&pause=
19  8/Sep/05 17:44  /cgi-bin/chat/chat.cgi?action=chat&id=hpecyaggcevayyxkkrjfajfbphoxlk&pause=
19 24/Sep/05 11:21  /cgi-bin/chat/chat.cgi?action=chat&id=cfpbkwpczzeegvqvgnychxxvjgnuaq&pause=
19 20/Sep/05 15:27  /cgi-bin/chat/chat.cgi?action=chat&id=abiisysmcsorhinxsnxxzlkambjjse&pause=
19 25/Sep/05 20:14  /cgi-bin/chat/chat.cgi?action=chat&id=vmgprhabwcbpziwlyomimoauczrazj&pause=
19 24/Sep/05 15:57  /cgi-bin/chat/chat.cgi?action=chat&id=cinfzyfssloroocmtdwnydqjivjhtf&pause=
19 16/Sep/05 17:21  /cgi-bin/chat/chat.cgi?action=chat&id=ldobheyostrgoovjqdkfnfwtugzjbm&pause=
19 13/Sep/05 16:49  /cgi-bin/chat/chat.cgi?action=chat&id=kfmevqakjdsvzacqqvdubfvfumvlen&pause=
19 29/Sep/05 17:05  /cgi-bin/chat/chat.cgi?action=chat&id=dpbcjhbfpcnwcftrfsarpobbwpoyhp&pause=
19 21/Sep/05 03:27  /cgi-bin/chat/chat.cgi?action=chat&id=goqjrxpsguwteqmlzbczrwczjmlscd&pause=
18 29/Sep/05 16:02  /cgi-bin/chat/chat.cgi?action=chat&id=nctnsfdxiuavfwymjwmrikltiefqng
18 11/Sep/05 08:25  /cgi-bin/chat/chat.cgi?action=chat&id=pjjsgxwdgczhvinmnxgqjxzsgfattd&pause=
18 25/Sep/05 07:02  /cgi-bin/chat/chat.cgi?action=chat&id=xcqibavglpigdqqvshqzyyqgjnptjz&pause=
17 27/Sep/05 17:53  /cgi-bin/chat/chat.cgi?action=chat&id=bopaitagizfrazernqfyohzxnzreln&pause=
17  7/Sep/05 12:13  /cgi-bin/chat/chat.cgi?action=chat&id=jsnazizlqrjobnbuyfhpmubegoeqca&pause=
17 29/Sep/05 18:01  /cgi-bin/chat/chat.cgi?action=chat&id=ipmxylprmsoxsifbuwsdzwhrbvpmyr&pause=
17  7/Sep/05 16:21  /cgi-bin/chat/chat.cgi?action=chat&id=qyvsdqcxjxmvmgbcdeybsbhcqcjiur&pause=
17 21/Sep/05 17:11  /cgi-bin/chat/chat.cgi?action=chat&id=xdjjbmhtvgmabudfuuekcjeafxcolp&pause=
17  4/Sep/05 14:08  /cgi-bin/chat/chat.cgi?action=chat&id=diqevmfkrscnrpgxlwuwhvefoglxwv&pause=
17 11/Sep/05 17:20  /cgi-bin/chat/chat.cgi?action=chat&id=uhyeeegcilmgmazdmgxprndeoukxbg&pause=
17 23/Sep/05 09:56  /cgi-bin/chat/chat.cgi?action=chat&id=nnyacerkgcjtcnmfgswvmrgmhmzttx&pause=
17  4/Sep/05 20:08  /cgi-bin/chat/chat.cgi?action=chat&id=yqnsmgvgycrdsvjpwmkysmbwnybsda&pause=
17 12/Sep/05 23:22  /cgi-bin/chat/chat.cgi?action=chat&id=cxpftpbadeizjmpeiubvqkdiwrlunc&pause=
17 25/Sep/05 21:08  /cgi-bin/chat/chat.cgi?action=chat&id=frjuyjadmibtbxwgebbhlhtvdlckzy
17 29/Sep/05 16:59  /cgi-bin/chat/chat.cgi?action=chat&id=xrcbnifgorsuekprwmrmbguvedmalk
17 14/Sep/05 20:09  /cgi-bin/chat/chat.cgi?action=chat&id=egpkdxsxiewnrbglsansyjbxvcibel&pause=
17 11/Sep/05 18:58  /cgi-bin/chat/chat.cgi?action=chat&id=kijdgbkifppaownmmutkpwwcaxejfy&pause=
16 19/Sep/05 20:54  /cgi-bin/chat/chat.cgi?action=chat&id=jwtznbmkvnwadosfqyaltbmqwxaqwo&pause=
16 18/Sep/05 16:35  /cgi-bin/chat/chat.cgi?action=chat&id=fgjulxodjuyxlsukwivgokltqxrwzb
16  9/Sep/05 19:06  /cgi-bin/chat/chat.cgi?action=chat&id=qyucnkropztfewweflkwirxtqqulgx&pause=
16 17/Sep/05 17:36  /cgi-bin/chat/chat.cgi?action=chat&id=ehqdeyjtvnjpyxlvzkorltzbhrsvko&pause=
16 21/Sep/05 20:35  /cgi-bin/chat/chat.cgi?action=chat&id=omaoizmpgreyigcixaizcnojvbsujm&pause=
16 18/Sep/05 10:54  /cgi-bin/chat/chat.cgi?action=chat&id=gzeinrxxixnlwtcuumiuqjcttwxslz&pause=
16 26/Sep/05 16:33  /cgi-bin/chat/chat.cgi?action=chat&id=ffwmgvtgleskkmyhkutzbcyqllfzdd&pause=
16 15/Sep/05 20:51  /cgi-bin/chat/chat.cgi?action=chat&id=srmjyfnxwlpwghdjlvfhtnlkmcpsmf&pause=
16 28/Sep/05 17:49  /cgi-bin/chat/chat.cgi?action=chat&id=tpsczsayuegwvdvtvuoaaqjopcjzeq&pause=
16 17/Sep/05 20:24  /cgi-bin/chat/chat.cgi?action=chat&id=rxidgqykduplrtnoaodmxljtbotuil&pause=
16 22/Sep/05 01:39  /cgi-bin/chat/chat.cgi?action=chat&id=erlgsvtghiwkqxegrlmytzbgmtugpi
16 25/Sep/05 09:36  /cgi-bin/chat/chat.cgi?action=chat&id=vzczpnhjqxnjvggxhdefqsgeisbesf&pause=
16 24/Sep/05 16:28  /cgi-bin/chat/chat.cgi?action=chat&id=xhuygekllkqpffsfklxqlcmapmbgfo&pause=
15 21/Sep/05 13:48  /cgi-bin/chat/chat.cgi?action=chat&id=furtbmxycbkmscxypuwzgyhasspgja
15 26/Sep/05 21:14  /cgi-bin/chat/chat.cgi?action=chat&id=pxbigszgbexoupolwqafnrbzmfxbia&pause=
15 15/Sep/05 17:26  /cgi-bin/chat/chat.cgi?action=chat&id=aicmvezkhrhcpmkbetmgzvhwvfeajx&pause=
15  9/Sep/05 23:31  /cgi-bin/chat/chat.cgi?action=chat&id=tssvphumounkmfvttlnumrchynmwbk&pause=
15  4/Sep/05 21:03  /cgi-bin/chat/chat.cgi?action=chat&id=wrbpknzfulmkllszallrkxtcupkuec
15 14/Sep/05 17:19  /cgi-bin/chat/chat.cgi?action=chat&id=sfbyrcysrfgknoktufjmzybubuwryx&pause=
15 18/Sep/05 16:13  /cgi-bin/chat/chat.cgi?action=chat&id=clukhpskerrhbekipktftfuwrykgij&pause=
15 27/Sep/05 06:24  /cgi-bin/chat/chat.cgi?action=chat&id=qnjavgmcieupowylubfdyivubtwsec&pause=
15 29/Sep/05 05:43  /cgi-bin/chat/chat.cgi?action=chat&id=sssndcmhsoytweyekjvzlrnszbpqii&pause=
15 28/Sep/05 17:59  /cgi-bin/chat/chat.cgi?action=chat&id=aafqwjgxehhhyuoylikwubqcmszqdo&pause=
15 29/Sep/05 16:58  /cgi-bin/chat/chat.cgi?action=chat&id=qttdudmgtmclxcjbtdoohomdrmdkjg&pause=
15 21/Sep/05 12:57  /cgi-bin/chat/chat.cgi?action=chat&id=furtbmxycbkmscxypuwzgyhasspgja&pause=
14 29/Sep/05 15:34  /cgi-bin/chat/chat.cgi?action=chat&id=zyzngiavuswbavksgvbdywgehykfyo&pause=
14 18/Sep/05 13:29  /cgi-bin/chat/chat.cgi?action=chat&id=shtrozduenifcpdwczamzugicufokr&pause=
14 10/Sep/05 19:29  /cgi-bin/chat/chat.cgi?action=chat&id=xepjnuhcphmpcuwsodvowhvdmofrmq&pause=
14 22/Sep/05 01:43  /cgi-bin/chat/chat.cgi?action=chat&id=erlgsvtghiwkqxegrlmytzbgmtugpi&pause=
14  6/Sep/05 20:35  /cgi-bin/chat/chat.cgi?action=chat&id=xqsautnmhptdjanzaxxeeuyxcfpajw
14 22/Sep/05 21:00  /cgi-bin/chat/chat.cgi?action=chat&id=cpmqcwhajemjlywbzbabgrqqnlpznv
14 13/Sep/05 12:11  /cgi-bin/chat/chat.cgi?action=chat&id=etvknmskceqhtktzsefbopdzlbvlmm&pause=
14  3/Sep/05 11:29  /cgi-bin/chat/chat.cgi?action=chat&id=fzguqvlxulqrhtnytutnmfjlqgkxks&pause=
14 21/Sep/05 17:43  /cgi-bin/chat/chat.cgi?action=chat&id=nmgqgzglbaqkcveeiyeeaycngksvse&pause=
13 21/Sep/05 19:04  /cgi-bin/chat/chat.cgi?action=chat&pause=1&id=nmgqgzglbaqkcveeiyeeaycngksvse
13  5/Sep/05 17:02  /cgi-bin/chat/chat.cgi?action=chat&id=lkewttzhqgartlekvqlahdkvoyqjfd
13 16/Sep/05 12:39  /cgi-bin/chat/chat.cgi?action=chat&id=rogczffbeocqudrbdtoevecnajklhm&pause=
13  2/Sep/05 14:21  /cgi-bin/chat/chat.cgi?action=chat&id=skexdtbicgzvbrzvvxychlakhqufgx&pause=
13 21/Sep/05 16:21  /cgi-bin/chat/chat.cgi?action=chat&id=qiajzzesdvuasjawderfxpipcprlpr&pause=
13 29/Sep/05 20:28  /cgi-bin/chat/chat.cgi?action=chat&id=ndkdvrwnlktsbgrraentdgroofghba
13  1/Sep/05 16:41  /cgi-bin/chat/chat.cgi?action=chat&id=usvggzjsbijunyhdhwwhzeughyhthv&pause=
13 24/Sep/05 14:18  /cgi-bin/chat/chat.cgi?action=chat&id=dqdaarzwqfobmursuppbtgprorphme&pause=
13 22/Sep/05 06:14  /cgi-bin/chat/chat.cgi?action=chat&id=vrvfbsobsbkqqemmggfnlsxtybxeyq&pause=
13 27/Sep/05 06:24  /cgi-bin/chat/chat.cgi?action=chat&id=ktbqkwibnpoiekcgwgcqaelqvpzjgs&pause=
13 17/Sep/05 08:40  /cgi-bin/chat/chat.cgi?action=chat&id=jrpjbxnnizawclllkekhbwgeniiolx&pause=
12 21/Sep/05 20:18  /cgi-bin/chat/chat.cgi?action=chat&id=gzrglflisfllysezfmirasymeoqrjx
12  6/Sep/05 15:09  /cgi-bin/chat/chat.cgi?action=chat&id=flqjrjvkwlmdexgpjhdhejdmkegmap&pause=
12 25/Sep/05 13:57  /cgi-bin/chat/chat.cgi?action=chat&id=rphcmwmmuqrpfsemhbkwfuvyisrbdb
12 29/Sep/05 08:22  /cgi-bin/chat/chat.cgi?action=chat&id=efrpdectfjmstarzkmrenltjrqgmwa&pause=
12 25/Sep/05 19:29  /cgi-bin/chat/chat.cgi?action=chat&pause=1&id=lhkrcpresnlwbahqlmncmabbvwukfy
12 28/Sep/05 10:30  /cgi-bin/chat/chat.cgi?action=chat&id=nizcsnrbcygmqxzpceeqomhwrevbcx&pause=
12 21/Sep/05 15:22  /cgi-bin/chat/chat.cgi?action=chat&id=xqcvdwuktxftzkxsdhupfsageywrgd
12  6/Sep/05 15:19  /cgi-bin/chat/chat.cgi?action=chat&id=hclfvsmcaaytzpdajcbvpmjcvhgyef
12 20/Sep/05 21:00  /cgi-bin/chat/chat.cgi?action=chat&id=zmfosnrgpvsibijlwknuccnqgjcyax
12 11/Sep/05 17:09  /cgi-bin/chat/chat.cgi?action=chat&id=pzryeultqihcbzphblhpnuggmzllzd&pause=
12 12/Sep/05 14:42  /cgi-bin/chat/chat.cgi?action=chat&id=dxlpkqzlfqwdjrgrpgrzcukakabzot&pause=
12 27/Sep/05 14:58  /cgi-bin/chat/chat.cgi?action=chat&id=sumwxqutxmuffwcbpjkxlkhqxyuydo
12 26/Sep/05 13:33  /cgi-bin/chat/chat.cgi?action=chat&id=vqvyutqldqwpnpnyjwcsqksnefqaep
12 28/Sep/05 19:14  /cgi-bin/chat/chat.cgi?action=chat&id=rvirmvcpkbghktvdaxzkcnvhzvwdum&pause=
12 11/Sep/05 18:23  /cgi-bin/chat/chat.cgi?action=chat&id=vmhxtlrgfozpdcbnxmutbknysbsdbu
11 28/Sep/05 15:55  /cgi-bin/chat/chat.cgi?action=chat&id=ncrlprfnmtjjsbbdzjpaipsshdhsxi&pause=
11 29/Sep/05 15:33  /cgi-bin/chat/chat.cgi?action=chat&id=hdpuwnhlxvhdlvsrgtfsiqhxfnldqu
11 11/Sep/05 17:04  /cgi-bin/chat/chat.cgi?action=chat&id=jpgrjwecucoilsjurqnrotkpfojuem&pause=
11 22/Sep/05 15:52  /cgi-bin/chat/chat.cgi?action=chat&id=gwexmxcqfmfwkxxenluhxievkkfooy&pause=
11  6/Sep/05 21:08  /cgi-bin/chat/chat.cgi?action=chat&id=noqvcaeqgfoucxokxlmebbedigvipz&pause=
11  8/Sep/05 13:57  /cgi-bin/chat/chat.cgi?action=chat&id=qhkmzkozrgtszikifdakrpkywhqdyi&pause=
11  3/Sep/05 21:27  /cgi-bin/chat/chat.cgi?action=chat&id=kxtnzatfcoktyxkhzktkgixvbqirpm&pause=
11  1/Sep/05 09:39  /cgi-bin/chat/chat.cgi?action=chat&id=sczjwdktjcqlhqnialxuncbkzajwec&pause=
11 29/Sep/05 20:15  /cgi-bin/chat/chat.cgi?action=chat&id=qnjpbhhnvrlcwlqynpstlppgbmigvu&pause=
11 25/Sep/05 22:14  /cgi-bin/chat/chat.cgi?action=chat&id=txfpexcdeydwkfrqpkmbfhjczyhhba&pause=
11 12/Sep/05 14:20  /cgi-bin/chat/chat.cgi?action=chat&id=tcexyjwzpqkqoucppcntnjkgddjfhz
11  7/Sep/05 21:13  /cgi-bin/chat/chat.cgi?action=chat&id=vnxedotawgzhgvhlxakbrhlowklfgj&pause=
11 24/Sep/05 15:22  /cgi-bin/chat/chat.cgi?action=chat&id=jyefqqwhmqxipknyyajvnrwvxwytjf&pause=
10 20/Sep/05 19:42  /cgi-bin/chat/chat.cgi?action=chat&pause=1&id=tcrnploqzpfpfvzxfqiedlurktwfee
10 27/Sep/05 14:05  /cgi-bin/chat/chat.cgi?action=chat&id=sxunsoailcqavutfdecgmunxvouvpq&pause=
10  8/Sep/05 20:35  /cgi-bin/chat/chat.cgi?action=chat&id=rwztunudzuvwlqrzjgeexqlzridqjb&pause=
10  9/Sep/05 17:44  /cgi-bin/chat/chat.cgi?action=chat&id=bhuxethzwxybyxtqbplybrrrxwkqww&pause=
10 23/Sep/05 20:43  /cgi-bin/chat/chat.cgi?action=chat&id=adxrztnruruiajvzcgboziqbzzzotv&pause=
10  3/Sep/05 23:19  /cgi-bin/chat/chat.cgi?action=chat&id=oyzfsmqjdlmirkqggrkyjapubyuneo
10  6/Sep/05 17:59  /cgi-bin/chat/chat.cgi?action=chat&id=iuyjzovkgmukzuzyelykdcdcocedgz&pause=
10 16/Sep/05 20:42  /cgi-bin/chat/chat.cgi?action=chat&id=yuypzxgmcmtccznhctwfoqequogqko&pause=
10  9/Sep/05 20:08  /cgi-bin/chat/chat.cgi?action=chat&id=wpwwgavvebqnfvfwfurinvadindtyn&pause=
10  3/Sep/05 15:27  /cgi-bin/chat/chat.cgi?action=chat&id=dneinfiycfigcrfknquyjjnjdtztan&pause=
10 11/Sep/05 18:19  /cgi-bin/chat/chat.cgi?action=chat&id=dzepvukolgtlmghshladdzcfjicrpo&pause=
10  6/Sep/05 15:23  /cgi-bin/chat/chat.cgi?action=chat&id=oclexwyfsoewraqecgdezymfvjsfse&pause=
10 19/Sep/05 18:56  /cgi-bin/chat/chat.cgi?action=chat&id=eonvaijejdeplpvaqlhurmlhocjwaf
10 12/Sep/05 17:32  /cgi-bin/chat/chat.cgi?action=chat&id=ssngqcahppqctrrwumpaimfeialfez
221388 0.01%30/Sep/05 00:06/graphics/resources/pixel.gif
209181 0.55%30/Sep/05 00:07/graphics/logo-footer.gif
195917 0.02%30/Sep/05 00:07/graphics/foot-line.gif
193885 0.11%30/Sep/05 00:07/graphics/banners/bottom.gif
193328 0.30%30/Sep/05 00:07/graphics/banners/top.gif
123430 0.22%30/Sep/05 00:06/graphics/he.gif
111244 0.02%30/Sep/05 00:05/graphics/email-text.gif
111174 0.02%30/Sep/05 00:05/graphics/print-text.gif
104207 0.18%29/Sep/05 21:41/cgi-bin/chat/chatsa.cgi
103718 0.16%30/Sep/05 00:05/graphics/helpinglogo1.gif
99812 0.07%30/Sep/05 00:06/spam_vaccine/spam_vaccine.js
97003 0.01%30/Sep/05 00:07/graphics/triangle.gif
91929 2.29%30/Sep/05 00:06/
12 24/Sep/05 21:58  /?wb_co=excitejapan
77291 0.02%30/Sep/05 00:06/graphics/banners/fun-r.gif
77060 0.11%30/Sep/05 00:06/graphics/banners/fun-l.gif
60569 0.42%30/Sep/05 00:06/graphics/homepage/hrs-bannerc.gif
60277 0.02%30/Sep/05 00:06/graphics/notify-me.gif
60203 0.26%30/Sep/05 00:06/joinsm.gif
59912 0.81%30/Sep/05 00:06/graphics/homepage/left.gif
59897 0.02%30/Sep/05 00:06/graphics/homepage/backbar2.gif
59578 1.39%30/Sep/05 00:06/graphics/homepage/right.gif
56134 0.20%30/Sep/05 00:07/graphics/banners/care-l.gif
55912 0.02%30/Sep/05 00:07/graphics/banners/care-r.gif
55675 0.17%30/Sep/05 00:05/graphics/banners/faq-l.gif
55593 0.02%30/Sep/05 00:05/graphics/banners/faq-r.gif
5242711.09%30/Sep/05 00:05/graphics/fun/netbunnies/
379 0.11%29/Sep/05 22:38  /graphics/fun/netbunnies/?M=A
110 0.03%29/Sep/05 15:28  /graphics/fun/netbunnies/?M=D
56 0.02%29/Sep/05 20:47  /graphics/fun/netbunnies/?N=D
51 0.01%29/Sep/05 20:47  /graphics/fun/netbunnies/?D=A
45 0.01%29/Sep/05 20:47  /graphics/fun/netbunnies/?S=A
38 0.01%29/Sep/05 19:18  /graphics/fun/netbunnies/?N=A
29 0.01%29/Sep/05 05:33  /graphics/fun/netbunnies/?D=D
27 0.01%29/Sep/05 16:25  /graphics/fun/netbunnies/?S=D
40614 0.07%30/Sep/05 00:06/favicon.ico
35391 0.07%29/Sep/05 21:41/cgi-bin/chat/chatpm.cgi
27 20/Sep/05 18:23  /cgi-bin/chat/chatpm.cgi?action=chatinput_html&id=sfmsxbgamtnxcgebxaufyxzywqzeju
20 19/Sep/05 18:35  /cgi-bin/chat/chatpm.cgi?action=chatinput_html&id=xlvtnyhkkbxlwasssloxdzidqgefuf
10  9/Sep/05 19:59  /cgi-bin/chat/chatpm.cgi?action=chatinput_html&id=buinacmxouiaqjgihttwdzpppivasn
29641 0.01%30/Sep/05 00:05/icons/blank.gif
29504 0.13%30/Sep/05 00:06/graphics/banners/hrs-info-l.gif
29448 0.01%30/Sep/05 00:06/graphics/banners/hrs-info-r.gif
28524 0.01%30/Sep/05 00:05/icons/image2.gif
28401 0.01%30/Sep/05 00:05/icons/back.gif
26220 0.32%30/Sep/05 00:06/fun/
25474 0.01%30/Sep/05 00:05/chapters/san-diego/subnav/sn_faqoff.gif
25472 0.01%30/Sep/05 00:05/chapters/san-diego/subnav/sn_emailoff.gif
25378 0.01%30/Sep/05 00:05/chapters/san-diego/subnav/sn_productsoff.gif
25301 0.01%30/Sep/05 00:05/chapters/san-diego/subnav/sn_homeoff.gif
25264 0.01%30/Sep/05 00:05/chapters/san-diego/buttongo.gif
24488 0.69%30/Sep/05 00:06/care/
24426 0.01%30/Sep/05 00:05/chapters/san-diego/subnav/linedown.gif
24356 0.01%30/Sep/05 00:05/chapters/san-diego/subnav/sn_aboutusoff.gif
24303 0.01%30/Sep/05 00:05/chapters/san-diego/subnav/sn_adoptionon.gif
24296 0.01%30/Sep/05 00:05/chapters/san-diego/subnav/sn_healthon.gif
23397 0.01%30/Sep/05 00:05/chapters/san-diego/subnav/sn_aboutuson.gif
23294 0.01%30/Sep/05 00:05/chapters/san-diego/subnav/sn_behavioron.gif
23134 0.01%30/Sep/05 00:05/chapters/san-diego/subnav/sn_dieton.gif
22913 0.01%30/Sep/05 00:05/chapters/san-diego/subnav/sn_dietoff.gif
22569 0.01%29/Sep/05 23:58/chapters/san-diego/subnav/sn_behavioroff.gif
22465 0.05%30/Sep/05 00:04/styles/styles.css
22448 0.01%30/Sep/05 00:05/chapters/san-diego/subnav/sn_productson.gif
22353 0.01%30/Sep/05 00:05/icons/unknown.gif
22206 0.01%30/Sep/05 00:05/chapters/san-diego/subnav/sn_faqon.gif
22058 0.01%30/Sep/05 00:05/chapters/san-diego/subnav/sn_emailon.gif
21941 0.01%30/Sep/05 00:05/chapters/san-diego/subnav/sn_homeon.gif
21903 0.01%30/Sep/05 00:05/chapters/san-diego/subnav/sn_adoptionoff.gif
20994 0.07%30/Sep/05 00:06/graphics/banners/behavior-l.gif
20910 0.01%30/Sep/05 00:06/graphics/banners/behavior-r.gif
20672 0.29%30/Sep/05 00:01/faq/
20223 0.09%30/Sep/05 00:06/easter/hrs-banner-easter.gif
18553 0.30%30/Sep/05 00:06/behavior/
18457 0.07%29/Sep/05 23:55/easter/hrs-square-easter.gif
15955 0.06%30/Sep/05 00:06/graphics/link-hrsz.gif
15506 30/Sep/05 00:05/chapters/san-diego/subnav/sn_healthoff.gif
15204 30/Sep/05 00:05/icons/folder.gif
15101 0.28%30/Sep/05 00:05/health/
14704 0.05%30/Sep/05 00:05/graphics/banners/health-l.gif
14418 0.01%30/Sep/05 00:05/graphics/banners/health-r.gif
13563 0.13%29/Sep/05 23:59/behavior/body-language.html
13429 0.02%29/Sep/05 23:59/graphics/donate.png
12376 0.50%30/Sep/05 00:00/faq/sections/orphan.html
12208 0.03%30/Sep/05 00:06/graphics/links/japanese.gif
12129 0.25%30/Sep/05 00:02/adoption/
11855 0.18%29/Sep/05 23:30/chapters/san-diego/health/graphics/health_headergraphic_v2.jpg
10762 0.03%30/Sep/05 00:02/graphics/banners/adoption-l.gif
10724 0.01%30/Sep/05 00:02/graphics/banners/adoption-r.gif
10650 0.17%30/Sep/05 00:03/faq/sections/diet.html
10303 0.39%30/Sep/05 00:01/faq/sections/litter.html
8996 0.02%29/Sep/05 21:55/cgi-bin/chat/chat2.cgi
1545 0.01%29/Sep/05 21:30  /cgi-bin/chat/chat2.cgi?action=banner
312 29/Sep/05 21:48  /cgi-bin/chat/chat2.cgi?action=register
243 29/Sep/05 21:39  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Flemishr2cool
134 27/Sep/05 19:37  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=happybunny33
130 29/Sep/05 20:21  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Rose_Luna_Puff
118 28/Sep/05 18:41  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=bingaling
106 29/Sep/05 14:56  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=rabbitlover_
104 28/Sep/05 19:06  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=JoWH
86 29/Sep/05 20:13  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=littlegem
84 29/Sep/05 20:25  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Poopybunny
84 29/Sep/05 16:58  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Legolas
79 29/Sep/05 20:25  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=hellobunny
69 29/Sep/05 20:27  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Kerrmit
56 29/Sep/05 16:58  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Coopersfostermom
55 29/Sep/05 18:45  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=mickey
54 29/Sep/05 21:41  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=SunStar85
50  4/Sep/05 23:47  /cgi-bin/chat/chat2.cgi?action=options_html&id=azffqtludmbugivjghsgwqoxbhcpno
47 21/Sep/05 15:05  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=taytay
44 22/Sep/05 04:21  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Bess
42 26/Sep/05 20:41  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=DemonGrinder
42 26/Sep/05 19:10  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Lisaxx
40 22/Sep/05 15:53  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=rabbitlover
39 26/Sep/05 18:20  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=frisco524
39 29/Sep/05 21:10  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=TJJ
38 24/Sep/05 16:37  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=nethie0
36 29/Sep/05 18:20  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Avalanche
35 28/Sep/05 21:14  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=legzandwheelz
35 29/Sep/05 20:17  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=luvbunnies
34 24/Sep/05 20:21  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=carmel
30 23/Sep/05 18:25  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Riokko
30 22/Sep/05 15:54  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=bunylover
30 29/Sep/05 08:21  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=jackismck
29 28/Sep/05 15:43  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=riley1
29 28/Sep/05 20:46  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=ganymeder
26 20/Sep/05 18:23  /cgi-bin/chat/chat2.cgi?action=rooms&id=sfmsxbgamtnxcgebxaufyxzywqzeju
26 19/Sep/05 18:35  /cgi-bin/chat/chat2.cgi?action=rooms&id=xlvtnyhkkbxlwasssloxdzidqgefuf
25 27/Sep/05 14:04  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=myangelbunny
23 27/Sep/05 20:02  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=lumpy-dumps
21 26/Sep/05 12:00  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Stavro99
21 29/Sep/05 19:02  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=midnightbaby
19 29/Sep/05 16:13  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=wtiggr
19 20/Sep/05 20:45  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=msbunnymom
18 26/Sep/05 19:23  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=beatrix
18 22/Sep/05 17:29  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=putter
17 28/Sep/05 19:49  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Hopnoodle
17 17/Sep/05 21:53  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=BekasBunnies
17 26/Sep/05 21:36  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=lilac
17 27/Sep/05 20:39  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Aura
16 28/Sep/05 17:53  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=backyardlops
16 23/Sep/05 16:01  /cgi-bin/chat/chat2.cgi?action=changeuserinfo&id=oovgnxrlskxcsnkdxheiapvimmlnlx
14 24/Sep/05 22:14  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Alfalfa.
14  5/Sep/05 12:37  /cgi-bin/chat/chat2.cgi?action=changeuserinfo&id=aqvoqvptuzacpdxxtxzuojntkihroa
13  9/Sep/05 21:31  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=mdc
13 17/Sep/05 20:09  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=binkyBunny
12 22/Sep/05 16:35  /cgi-bin/chat/chat2.cgi?action=changeuserinfo&id=dodcmjkbocpjvlcnowmbwhwcyvwivb
12 28/Sep/05 16:52  /cgi-bin/chat/chat2.cgi?action=changeuserinfo&id=oyxtsbdtxoxcefysfdntnqsdhouofw
12 23/Sep/05 20:47  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=CookiesMom
11  6/Sep/05 15:30  /cgi-bin/chat/chat2.cgi?action=changeuserinfo&id=oclexwyfsoewraqecgdezymfvjsfse
11  5/Sep/05 14:12  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=jbean2575
11 26/Sep/05 18:43  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=kittymama
11 27/Sep/05 16:28  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=rugged
11 25/Sep/05 18:29  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Jasbunny3
11 28/Sep/05 19:14  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=ashleigh
11 26/Sep/05 18:48  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=mara331
11  8/Sep/05 20:03  /cgi-bin/chat/chat2.cgi?action=options_html&id=qakkqdhquqsvgcmxvzohsnshjvrefd
10  9/Sep/05 19:59  /cgi-bin/chat/chat2.cgi?action=rooms&id=buinacmxouiaqjgihttwdzpppivasn
10 28/Sep/05 20:43  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Nanoke2004
10 29/Sep/05 20:57  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Foxx
10 22/Sep/05 04:25  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Lowlee
10 23/Sep/05 20:28  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=Besu
10 27/Sep/05 16:40  /cgi-bin/chat/chat2.cgi?action=userinfo&infoabout=trevorangelbaby
8793 0.03%29/Sep/05 23:27/graphics/banners/help-l.gif
8771 29/Sep/05 23:27/graphics/banners/help-r.gif
8306 0.08%29/Sep/05 23:58/care/new-bunny-index.html
8017 29/Sep/05 23:27/graphics/resources/red.gif
7740 0.23%30/Sep/05 00:04/graphics/fun/netbunnies/bunny-hays1.jpg
7620 0.08%29/Sep/05 23:58/journal/3-9/cute-quotes.html
7070 0.06%29/Sep/05 23:40/hrs-info/
6891 0.12%29/Sep/05 23:52/chapters/
6833 0.02%30/Sep/05 00:01/graphics/banners/opinion-l.gif
6829 30/Sep/05 00:01/graphics/banners/opinion-r.gif
6791 0.06%29/Sep/05 23:58/journal/3-9/graphics/2.gif
6729 0.02%30/Sep/05 00:06/graphics/hrs.gif
6714 0.12%29/Sep/05 23:38/faq/sections/housing.html
6678 0.07%29/Sep/05 23:58/journal/3-9/graphics/1.gif
6609 0.07%29/Sep/05 23:48/care/veggies.html
6606 0.06%29/Sep/05 23:58/journal/3-9/graphics/4.gif
6605 0.06%29/Sep/05 23:58/journal/3-9/graphics/6.gif
6592 0.06%29/Sep/05 23:58/journal/3-9/graphics/5.gif
6582 0.05%29/Sep/05 23:58/journal/3-9/graphics/3.gif
6580 0.30%29/Sep/05 23:48/graphics/fun/netbunnies/willow-having-a-chat.jpg
6560 0.07%29/Sep/05 23:58/journal/3-9/graphics/7.gif
6526 0.12%30/Sep/05 00:05/faq/sections/medical.html
6511 0.07%29/Sep/05 23:58/journal/3-9/graphics/8.gif
6397 0.14%29/Sep/05 23:53/faq/sections/spay-neuter.html
6318 0.25%29/Sep/05 23:53/graphics/babies/babiesnow.jpg
6249 0.20%30/Sep/05 00:05/graphics/fun/netbunnies/sedona-shopping.jpg
6208 0.06%30/Sep/05 00:06/journal/hrj-gallery.html
6111 0.12%30/Sep/05 00:01/care/living-with-a-house-rabbit.html
6075 30/Sep/05 00:05/robots.txt
5933 0.03%30/Sep/05 00:04/links/rabbit-pictures.html
5866 0.13%30/Sep/05 00:06/graphics/hrs-rabbits/benny.gif
5798 0.02%30/Sep/05 00:06/graphics/banners/kids-l.gif
5765 0.15%30/Sep/05 00:06/graphics/hrs-rabbits/freckels.gif
5762 30/Sep/05 00:06/graphics/banners/kids-r.gif
5719 0.02%30/Sep/05 00:06/graphics/banners/links-l.gif
5715 30/Sep/05 00:06/graphics/banners/links-r.gif
5666 0.25%29/Sep/05 23:53/care/babies.html
5657 0.01%30/Sep/05 00:05/graphics/houserabbitsociety.gif
5634 0.12%30/Sep/05 00:06/graphics/hrs-rabbits/cecil.gif
5536 0.05%30/Sep/05 00:06/graphics/hrs-rabbits/guy.gif
5531 0.07%30/Sep/05 00:06/graphics/hrs-rabbits/sara.gif
5492 0.50%30/Sep/05 00:06/graphics/hrs-rabbits/minnie-in-tunnel.gif
5474 0.10%30/Sep/05 00:06/graphics/hrs-rabbits/jimmy.gif
5453 0.07%30/Sep/05 00:06/kids/
5413 0.10%30/Sep/05 00:06/graphics/hrs-rabbits/ruby.gif
5409 0.09%30/Sep/05 00:06/graphics/hrs-rabbits/petunia.gif
5357 0.45%29/Sep/05 23:53/graphics/babies/sixteenday.jpg
5310 0.08%29/Sep/05 23:58/chapters/san-diego/adoption/graphics/adoption_headergraphic_v2.jpg
5280 0.08%30/Sep/05 00:06/graphics/hrs-rabbits/thomas.gif
5249 0.02%29/Sep/05 23:52/graphics/banners/chapters-l.gif
5241 0.09%30/Sep/05 00:06/graphics/hrs-rabbits/three-spots.gif
5203 29/Sep/05 23:52/graphics/banners/chapters-r.gif
5193 0.06%30/Sep/05 00:06/graphics/hrs-rabbits/tinket-bell.gif
5173 0.12%30/Sep/05 00:06/graphics/hrs-rabbits/vanessa.gif
5154 0.09%30/Sep/05 00:06/graphics/hrs-rabbits/walter.gif
5105 0.08%30/Sep/05 00:05/chapters/san-diego/behavior/graphics/behavior_headergraphic_v2.jpg
5085 0.17%29/Sep/05 23:44/rabbit-center/
4876 0.07%29/Sep/05 23:50/faq/sections/toys.html
4827 0.23%30/Sep/05 00:01/graphics/fun/netbunnies/3bunnies-chercat1.jpg
4759 0.06%29/Sep/05 23:48/graphics/books/hrh.gif
4679 0.08%29/Sep/05 23:38/care/vets.html
4660 0.34%30/Sep/05 00:01/graphics/mine/king-foo.gif
4622 0.02%30/Sep/05 00:01/graphics/mine/baby-zowie-profile-l.gif
4620 0.02%30/Sep/05 00:01/graphics/mine/baby-zowie-profile-r.gif
4604 0.09%30/Sep/05 00:01/graphics/mine/foo-t.jpg
4596 0.16%30/Sep/05 00:01/graphics/mine/izzy-zippy.gif
4563 0.18%30/Sep/05 00:01/graphics/mine/foo-zowie-by-tv.gif
4562 0.26%30/Sep/05 00:01/graphics/mine/foo-zippy-by-comp.gif
4538 0.29%30/Sep/05 00:01/graphics/mine/zowie-on-couch.gif
4534 0.06%29/Sep/05 23:48/care/drollery.html
4533 0.16%30/Sep/05 00:01/graphics/mine/zowie-on-bed.gif
4522 0.28%29/Sep/05 23:53/graphics/babies/nestbabyfirst.jpg
4456 0.36%30/Sep/05 00:01/graphics/mine/mom-zippy.gif
4414 0.02%29/Sep/05 23:53/graphics/babies/kplogo.gif
4397 0.06%29/Sep/05 23:52/chapters/san-diego/diet/graphics/diet_headergraphic_v2.jpg
4248 0.06%29/Sep/05 23:16/care/newborn.html
4040 0.03%29/Sep/05 23:44/rabbit-center/rabbit_ofthe_month/sept05/images/John Coltrane 003.jpg
4009 0.04%29/Sep/05 23:50/links/
3830 0.15%30/Sep/05 00:02/graphics/fun/netbunnies/lucky-nuui1.jpg
3732 0.06%29/Sep/05 23:46/faq/sections/vet.html
3721 0.13%29/Sep/05 23:39/chapters/san-diego/
3697 30/Sep/05 00:05/graphics/bunny-butt.gif
3616 0.05%29/Sep/05 23:40/vets/
3563 0.06%29/Sep/05 23:58/graphics/fun/netbunnies/Pandora-Burrascano1.jpg
3544 0.05%30/Sep/05 00:04/links/story-of-foobar-1.html
3511 0.08%30/Sep/05 00:00/journal/1/liver-disease.html
3459 0.03%29/Sep/05 23:07/care/facts.html
3445 0.07%27/Sep/05 11:58/rabbit-center/randomize/image9.gif
3436 0.08%27/Sep/05 11:58/rabbit-center/randomize/image7.gif
3431 0.07%27/Sep/05 11:58/rabbit-center/randomize/image11.gif
3409 0.09%27/Sep/05 11:58/rabbit-center/randomize/image5.gif
3399 0.07%27/Sep/05 11:58/rabbit-center/randomize/image4.gif
3395 0.03%30/Sep/05 00:06/fun/izzy-zowie/
3376 0.07%27/Sep/05 11:58/rabbit-center/randomize/image3.gif
3367 0.07%27/Sep/05 11:58/rabbit-center/randomize/image2.gif
3350 29/Sep/05 13:56/rabbit-center/graphics/resources/pixel.gif
3342 0.03%27/Sep/05 11:58/rabbit-center/randomize/image10.jpg
3336 0.51%29/Sep/05 23:49/rabbit-center/adoptables/
3328 0.07%29/Sep/05 23:47/links/mail-order-resources.html
3326 0.10%29/Sep/05 23:37/graphics/fun/netbunnies/annie-berrie1.jpg
3313 0.12%27/Sep/05 11:58/rabbit-center/graphics/bun.gif
3295 0.06%27/Sep/05 11:58/rabbit-center/randomize/image1.gif
3289 0.03%27/Sep/05 11:58/rabbit-center/graphics/adoption-center-banner_gr.gif
3273 0.44%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Monty_1_29Aug05.jpg
3252 0.06%27/Sep/05 11:58/rabbit-center/randomize/image8.gif
3252 27/Sep/05 11:58/rabbit-center/graphics/icon_rabbit_r.gif
3237 27/Sep/05 11:58/rabbit-center/graphics/icon_news_update.gif
3227 27/Sep/05 11:58/rabbit-center/graphics/icon_events.gif
3222 0.03%28/Sep/05 18:26/rabbit-center/events/images/arf.jpg
3218 0.08%28/Sep/05 23:53/rabbit-center/retail/images/lavbun.jpg
3216 0.03%30/Sep/05 00:04/graphics/mine/foo/3-under-bed-50.jpg
3213 0.01%27/Sep/05 11:58/rabbit-center/graphics/icon_donation.gif
3207 0.03%30/Sep/05 00:04/graphics/mine/foo/2-pumpkin-foo-50.jpg
3206 0.07%29/Sep/05 23:46/chapters/san-diego/health/sick.html
3203 0.09%30/Sep/05 00:04/graphics/mine/foo/gifs/1-baby-foo-25.gif
3190 0.01%27/Sep/05 11:58/rabbit-center/graphics/icon_boarding.gif
3189 0.05%30/Sep/05 00:04/graphics/mine/foo/4-under-bed-50.jpg
3189 0.01%27/Sep/05 11:58/rabbit-center/graphics/icon_adopt_rabbit.gif
3181 27/Sep/05 11:58/rabbit-center/graphics/icon_services.gif
3177 0.01%27/Sep/05 11:58/rabbit-center/graphics/icon_bunny_buddy.gif
3177 27/Sep/05 11:58/rabbit-center/graphics/icon_get_involved.gif
3173 0.05%30/Sep/05 00:04/graphics/mine/foo/6-licking-50.jpg
3173 0.05%30/Sep/05 00:04/graphics/mine/foo/5-under-table-50.jpg
3166 0.04%30/Sep/05 00:01/easter/
3160 0.04%30/Sep/05 00:04/graphics/mine/foo/8-zowie-holiday-inn-50.jpg
3149 0.04%30/Sep/05 00:04/graphics/mine/foo/7-by-couch-50.jpg
3058 0.01%27/Sep/05 11:58/rabbit-center/resources/images/PICT0184_8W77.jpg
2993 0.04%30/Sep/05 00:04/fun/izzy-zowie/izzy-t.jpg
2871 0.06%29/Sep/05 23:07/faq/sections/groom.html
2836 29/Sep/05 23:15/chapters/san-diego/navfront_dietoff.gif
2831 0.01%29/Sep/05 23:15/chapters/san-diego/navfront_productsoff.gif
2825 0.01%29/Sep/05 23:15/chapters/san-diego/navfront_healthoff.gif
2820 29/Sep/05 23:15/chapters/san-diego/navfront_behavioroff.gif
2811 0.03%30/Sep/05 00:00/journal/3-11/legs.html
2805 0.06%29/Sep/05 22:11/care/orphan.html
2803 29/Sep/05 23:15/chapters/san-diego/navfront_adoptionoff.gif
2788 0.15%29/Sep/05 23:40/hrs-info/contacts.html
2786 0.01%29/Sep/05 23:45/cgi-bin/postcard.cgi
15 26/Sep/05 14:23  /cgi-bin/postcard.cgi?code=1127592748westhighcrew05@yahoogroups.com
11 10/Sep/05 06:57  /cgi-bin/postcard.cgi?code=1125831527philippa.stewart@ntlworld.com
10 22/Sep/05 15:28  /cgi-bin/postcard.cgi?code=1127221331elfen000@planet.nl
2779 0.01%29/Sep/05 23:15/chapters/san-diego/navfront_aboutusoff.gif
2760 0.06%30/Sep/05 00:06/journal/3-4/two-rabbits.html
2744 0.13%30/Sep/05 00:00/journal/3-11/graphics/feet-out-on-couch.gif
2730 0.07%29/Sep/05 23:15/chapters/san-diego/rabbits.jpg
2725 0.05%30/Sep/05 00:06/faq/sections/introductions.html
2724 0.05%30/Sep/05 00:06/fun/izzy-zowie/izzy-up-t.jpg
2723 0.03%29/Sep/05 22:55/care/fruits.html
2704 0.01%29/Sep/05 23:15/chapters/san-diego/front_top.gif
2700 0.06%29/Sep/05 23:23/faq/sections/aggression.html
2693 0.07%29/Sep/05 23:50/graphics/fun/netbunnies/cute-diva1.jpg
2684 0.01%29/Sep/05 23:15/chapters/san-diego/houserabbit.gif
2681 0.12%29/Sep/05 23:41/graphics/fun/netbunnies/2dumb.jpg
2679 0.07%30/Sep/05 00:06/links/translate.html
2678 0.01%29/Sep/05 23:15/chapters/san-diego/society.gif
2673 0.01%29/Sep/05 23:15/chapters/san-diego/donateoff.gif
2672 0.01%29/Sep/05 23:15/chapters/san-diego/sandiego_.gif
2669 29/Sep/05 23:15/chapters/san-diego/yourresource.gif
2669 0.03%30/Sep/05 00:06/fun/izzy-zowie/izzy-portrait-t.jpg
2669 0.04%30/Sep/05 00:06/fun/izzy-zowie/izzy-zowie.jpg
2669 0.01%29/Sep/05 23:15/chapters/san-diego/rabbits2.jpg
2665 0.08%30/Sep/05 00:04/faq/sections/training.html
2656 0.01%29/Sep/05 23:15/chapters/san-diego/sandieg_2.gif
2654 0.01%29/Sep/05 22:50/graphics/banners/vets-l.gif
2640 0.05%30/Sep/05 00:06/fun/izzy-zowie/zowie2-t.jpg
2636 29/Sep/05 22:50/graphics/banners/vets-r.gif
2633 0.05%30/Sep/05 00:06/fun/izzy-zowie/zowie1-t.jpg
2632 0.05%30/Sep/05 00:06/fun/izzy-zowie/who-me-t.jpg
2631 0.05%30/Sep/05 00:06/fun/izzy-zowie/zowie-izzy-t.jpg
2621 0.01%29/Sep/05 23:15/chapters/san-diego/navfront_dieton.gif
2616 0.01%29/Sep/05 23:15/chapters/san-diego/navfront_behavioron.gif
2608 0.01%29/Sep/05 23:15/chapters/san-diego/navfront_adoptionon.gif
2601 0.08%30/Sep/05 00:04/fun/izzy-zowie/carl-chasing-izzy-t.jpg
2596 0.01%29/Sep/05 23:15/chapters/san-diego/navfront_healthon.gif
2577 0.04%30/Sep/05 00:00/journal/3-11/graphics/laying-out-by-wall.gif
2577 29/Sep/05 23:15/chapters/san-diego/quiz.gif
2576 0.02%30/Sep/05 00:00/journal/3-11/graphics/flopped-on-each-other.gif
2573 0.01%29/Sep/05 23:15/chapters/san-diego/navfront_productson.gif
2563 0.01%29/Sep/05 23:15/chapters/san-diego/navfront_aboutuson.gif
2562 0.05%29/Sep/05 23:41/graphics/fun/netbunnies/2bunnies8-agape1.jpg
2493 0.07%30/Sep/05 00:01/graphics/fun/netbunnies/1016sleepycuddle.jpg
2479 0.01%29/Sep/05 23:15/chapters/san-diego/donateon.gif
2478 29/Sep/05 21:41/cgi-bin/chat/chatgu.cgi
688 29/Sep/05 21:41  /cgi-bin/chat/chatgu.cgi?chat.cgi
114  7/Sep/05 18:32  /cgi-bin/chat/chatgu.cgi?http://img.photobucket.com/albums/v258/Poopybunny/dollybunny/dollynewtoys006.jpg
66  5/Sep/05 19:52  /cgi-bin/chat/chatgu.cgi?http://img.photobucket.com/albums/v258/Poopybunny/dollybunny/dollyoutside017.jpg
65  8/Sep/05 21:06  /cgi-bin/chat/chatgu.cgi?http://img.photobucket.com/albums/v258/Poopybunny/dollybunny/dollyoutside015.jpg
54  5/Sep/05 19:52  /cgi-bin/chat/chatgu.cgi?http://img.photobucket.com/albums/v328/highlandviewrabbitry/rabbitrun.jpg
49  5/Sep/05 19:23  /cgi-bin/chat/chatgu.cgi?http://img.photobucket.com/albums/v258/Poopybunny/poopy9.jpg
48 22/Sep/05 21:46  /cgi-bin/chat/chatgu.cgi?http://img.photobucket.com/albums/v258/Poopybunny/dollybunny/dollyandmax009.jpg
45  5/Sep/05 19:15  /cgi-bin/chat/chatgu.cgi?http://img.photobucket.com/albums/v258/Poopybunny/dollybunny/dollyandmax011.jpg
37  7/Sep/05 18:32  /cgi-bin/chat/chatgu.cgi?http://img.photobucket.com/albums/v258/Poopybunny/dollybunny/dollynewtoys004.jpg
35 28/Sep/05 15:34  /cgi-bin/chat/chatgu.cgi?http://photobucket.com/albums/b162/12you/?action=view&current=90.jpg
35  7/Sep/05 18:32  /cgi-bin/chat/chatgu.cgi?http://img.photobucket.com/albums/v258/Poopybunny/dollybunny/dollynewtoys001.jpg
33  5/Sep/05 19:29  /cgi-bin/chat/chatgu.cgi?http://img.photobucket.com/albums/v258/Poopybunny/dollybunny/dollynewtoys002.jpg
26 27/Sep/05 19:21  /cgi-bin/chat/chatgu.cgi?http://i11.photobucket.com/albums/a161/happybunny33/Happy bunny/Whatareyoulookingat.jpg
25 18/Sep/05 18:45  /cgi-bin/chat/chatgu.cgi?http://i6.photobucket.com/albums/y229/PouncingPaws/Rabbit2.jpg
23 29/Sep/05 21:30  /cgi-bin/chat/chatgu.cgi?http://www.ralfchat.com
20 17/Sep/05 21:44  /cgi-bin/chat/chatgu.cgi?http://talkingegg.com/humor/bunnyyawns.html
16  5/Sep/05 19:52  /cgi-bin/chat/chatgu.cgi?http://img.photobucket.com/albums/v258/Poopybunny/dollybunny/dollyoutside022.jpg
15 20/Sep/05 20:00  /cgi-bin/chat/chatgu.cgi?http://img.photobucket.com/albums/v258/Poopybunny/2003_0122poopyjack0004.jpg
15 25/Sep/05 14:21  /cgi-bin/chat/chatgu.cgi?http://i14.photobucket.com/albums/a341/123avalanche/Bunny photos/HPIM0381.jpg
14 27/Sep/05 19:28  /cgi-bin/chat/chatgu.cgi?http://i14.photobucket.com/albums/a341/123avalanche/Bunny photos/Picture001.jpg
12 20/Sep/05 18:20  /cgi-bin/chat/chatgu.cgi?http://img.photobucket.com/albums/v258/Poopybunny/Oct1294.jpg
12 26/Sep/05 20:16  /cgi-bin/chat/chatgu.cgi?http://img.photobucket.com/albums/v258/Poopybunny/103243.jpg
12 19/Sep/05 20:36  /cgi-bin/chat/chatgu.cgi?http://www.telusmobility.com/coolstuff/advertising.shtml
12 26/Sep/05 20:07  /cgi-bin/chat/chatgu.cgi?http://img.photobucket.com/albums/v258/Poopybunny/newslippers.jpg
10 25/Sep/05 13:21  /cgi-bin/chat/chatgu.cgi?http://i11.photobucket.com/albums/a161/happybunny33/Happy bunny/CamPic62.jpg
10 22/Sep/05 20:00  /cgi-bin/chat/chatgu.cgi?http://i6.photobucket.com/albums/y229/PouncingPaws/Babies1.jpg
10 26/Sep/05 17:43  /cgi-bin/chat/chatgu.cgi?http://i6.photobucket.com/albums/y229/PouncingPaws/Babies2.jpg
10 25/Sep/05 14:20  /cgi-bin/chat/chatgu.cgi?http://img.photobucket.com/albums/v258/Poopybunny/dollybunny/dollyinmyarms016.jpg
10 20/Sep/05 20:00  /cgi-bin/chat/chatgu.cgi?http://img.photobucket.com/albums/v258/Poopybunny/pootalkstoteddy1.jpg
2466 0.07%29/Sep/05 23:27/graphics/fun/netbunnies/bunnies-cook1.jpg
2457 0.05%29/Sep/05 21:46/graphics/postcard/Muggs.jpg
2457 0.05%29/Sep/05 23:50/faq/sections/hazards.html
2449 0.01%29/Sep/05 23:49/rabbit-center/adoptables/images/altimage.gif
2430 0.24%29/Sep/05 23:40/graphics/fun/netbunnies/2-rabbits-outside.jpg
2412 0.01%29/Sep/05 23:37/graphics/link-hrslogo.gif
2400 0.04%29/Sep/05 23:46/faq/sections/chewing.html
2374 0.08%29/Sep/05 23:06/graphics/fun/netbunnies/bruno+leah1-nancy1.jpg
2359 0.01%30/Sep/05 00:05/links/zippy-izzy.html
2352 0.04%29/Sep/05 23:49/rabbit-center/adoptables/images/Xanadu001.jpg
2352 29/Sep/05 23:25/graphics/babies/
15 28/Sep/05 21:31  /graphics/babies/?S=D
2339 0.08%29/Sep/05 23:49/rabbit-center/adoptables/images/ashleynew.jpg
2332 0.14%29/Sep/05 23:49/rabbit-center/adoptables/images/ronnier145709sml.jpg
2332 0.36%30/Sep/05 00:06/graphics/links/chinese.bmp
2325 0.14%29/Sep/05 23:49/rabbit-center/adoptables/images/christopherr145825sml.jpg
2319 0.10%29/Sep/05 23:47/graphics/fun/netbunnies/cute-jones1.jpg
2297 0.16%29/Sep/05 23:49/rabbit-center/adoptables/images/mrchipr145920sml.jpg
2266 0.13%29/Sep/05 23:49/rabbit-center/adoptables/images/taylorr145639sml.jpg
2263 0.03%29/Sep/05 23:07/faq/sections/outdoors.html
2258 29/Sep/05 22:03/styles/joining.css
2257 30/Sep/05 00:06/graphics/links/arneb.gif
2253 30/Sep/05 00:06/graphics/links/araanib.gif
2249 30/Sep/05 00:06/graphics/links/hebrew.gif
2249 30/Sep/05 00:06/graphics/links/Persian.gif
2244 30/Sep/05 00:06/graphics/links/youn.gif
2236 30/Sep/05 00:06/graphics/links/tibet.gif
2228 0.06%29/Sep/05 23:49/rabbit-center/adoptables/images/myra001.jpg
2208 0.05%29/Sep/05 22:11/graphics/brushbaby.jpg
2206 0.09%30/Sep/05 00:03/graphics/fun/netbunnies/GaryMaggie-Bottorff1.jpg
2196 0.06%29/Sep/05 22:58/journal/3-6/chew-stick.html
2195 0.05%29/Sep/05 23:40/graphics/fun/netbunnies/2bunnies7-agape1.jpg
2192 0.01%29/Sep/05 21:10/rabbit-center/adoptables/header_gr.gif
2182 0.05%29/Sep/05 23:49/rabbit-center/adoptables/images/seamus_r1450_10tiny.jpg
2171 0.03%29/Sep/05 23:38/journal/1/rabbit-run.html
2165 0.04%30/Sep/05 00:05/graphics/mine/zippy1-s.gif
2163 0.05%29/Sep/05 23:49/rabbit-center/adoptables/images/fiona11tiny.jpg
2162 0.04%30/Sep/05 00:05/graphics/mine/zippy2-s.gif
2158 0.01%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/baloo-tiny.jpg-41
2157 0.05%29/Sep/05 23:49/rabbit-center/adoptables/images/enzo_r1451_13tiny.jpg
2157 0.15%30/Sep/05 00:06/journal/
2153 0.04%30/Sep/05 00:05/graphics/mine/zippy3-s.gif
2153 0.02%30/Sep/05 00:05/graphics/mine/emmybunny-s.gif
2149 0.12%29/Sep/05 23:49/rabbit-center/adoptables/images/Spot.jpg
2143 0.03%29/Sep/05 23:37/fun/ascii-art.html
2142 0.12%29/Sep/05 23:49/rabbit-center/adoptables/images/Flip.jpg
2140 29/Sep/05 21:10/rabbit-center/adoptables/adopt-t.gif
2138 0.09%29/Sep/05 23:50/graphics/fun/netbunnies/0246.jpg
2135 0.02%29/Sep/05 23:49/rabbit-center/adoptables/images/Benito_000.jpg
2131 0.05%29/Sep/05 23:55/graphics/fun/netbunnies/Lapin-profil.jpg
2129 0.37%29/Sep/05 23:49/rabbit-center/adoptables/graphics/big/duncansiliconvalley.JPG
2128 0.08%29/Sep/05 23:49/rabbit-center/adoptables/images/June29th011.jpg
2112 0.04%29/Sep/05 23:25/chapters/san-diego/adoption/
2105 0.02%29/Sep/05 23:49/rabbit-center/adoptables/images/Mae.jpg
2093 0.08%29/Sep/05 23:58/chapters/san-diego/adoption/Cages/Cage-Dolce.jpg
2090 0.01%29/Sep/05 23:49/rabbit-center/adoptables/images/Roman.jpg
2087 0.05%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/dante04tiny.jpg
2065 0.12%29/Sep/05 23:49/rabbit-center/adoptables/graphics/big/artemis06sml.jpg
2053 0.08%29/Sep/05 23:49/faq/sections/children.html
2039 0.15%29/Sep/05 23:49/rabbit-center/adoptables/graphics/big/bigwig.jpg
2038 0.02%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/r835heidi25tiny.jpg
2037 0.02%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/r834hayley11tiny.jpg
2033 0.04%29/Sep/05 22:58/faq/sections/treat.html
2031 0.05%29/Sep/05 23:15/chapters/san-diego/images/Shaq_Shoe.jpg
2024 0.02%29/Sep/05 23:40/stories/
2017 0.10%29/Sep/05 23:49/rabbit-center/adoptables/graphics/big/ebony.jpg
2008 0.05%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/helga25tiny.jpg
2003 0.05%29/Sep/05 22:18/chapters/san-diego/behavior/
2000 0.05%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/natasha03tiny.jpg
1985 0.05%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/mohawk r1424 09tiny.jpg
1983 0.04%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/thomyorke r1421 39tiny.jpg
1981 0.05%29/Sep/05 23:49/rabbit-center/adoptables/images/June29th010.jpg
1974 0.04%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/lindaperry r1420 56tiny.jpg
1972 0.04%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/johncoltrane r1417 36tiny.jpg
1966 0.05%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/fred r1412-09tiny.jpg
1964 0.05%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/debbie r1411 09tiny.jpg
1957 0.05%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/tia r1409 06tiny.jpg
1953 0.02%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/sara1-tiny.jpg
1952 0.09%29/Sep/05 23:52/graphics/fun/netbunnies/bunny-wai1.jpg
1937 0.02%29/Sep/05 22:48/journal/3-6/graphics/lop-in-basket.gif
1936 0.02%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/satin-r1308-01tiny.jpg
1935 0.04%29/Sep/05 22:48/journal/3-6/graphics/basket-keys.gif
1934 0.07%29/Sep/05 22:48/journal/3-6/graphics/under-chair.gif
1932 0.02%29/Sep/05 23:49/rabbit-center/adoptables/images/venus06tiny.jpg
1931 0.03%29/Sep/05 23:46/journal/2-11/cats-and-rabbits.html
1930 0.02%29/Sep/05 23:48/journal/1/rejection.html
1930 0.01%29/Sep/05 22:48/journal/3-6/graphics/tossing-1.gif
1929 0.01%29/Sep/05 22:09/rabbit-center/graphics/header.gif
1929 0.02%29/Sep/05 23:49/rabbit-center/adoptables/images/eileen_small.gif
1928 0.16%29/Sep/05 23:40/graphics/fun/netbunnies/2-white-rabbits-cushons.jpg
1925 0.04%29/Sep/05 22:48/journal/3-6/graphics/baskets-pinecones.gif
1924 0.01%29/Sep/05 22:48/journal/3-6/graphics/tossing-4.gif
1923 0.01%29/Sep/05 22:48/journal/3-6/graphics/tossing-2.gif
1921 0.02%29/Sep/05 22:48/journal/3-6/graphics/digging.gif
1920 0.02%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/michael046tiny.jpg
1919 0.01%29/Sep/05 22:48/journal/3-6/graphics/tossing-3.gif
1918 0.03%29/Sep/05 20:14/chapters/san-diego/aboutus/graphics/aboutus_headergraphic_v2.jpg
1915 0.02%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/richard131tiny.jpg
1912 0.02%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/johanna095tiny.jpg
1911 0.03%29/Sep/05 23:49/journal/3-1/just-for-fun.html
1911 0.01%29/Sep/05 22:48/journal/3-6/graphics/batting-toys.gif
1907 0.02%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/lewis122tiny.jpg
1905 0.02%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/danny116tiny.jpg
1903 0.02%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/frankie041tiny.jpg
1900 0.02%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/angel062tiny.jpg
1899 0.11%29/Sep/05 23:49/rabbit-center/adoptables/images/mazi_000.gif
1898 0.02%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/julie03tiny.jpg
1895 0.02%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/peaches26tiny.jpg
1893 0.02%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/gretchen15tiny.jpg
1892 0.01%29/Sep/05 23:49/rabbit-center/adoptables/images/jenny_small.jpg
1891 0.02%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/ichiro12tiny.jpg
1886 0.13%29/Sep/05 23:49/rabbit-center/adoptables/images/mr_missy.gif
1885 0.02%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/valentino02tiny.jpg
1885 0.02%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/bungee08tiny.jpg
1882 0.02%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/anusha07tiny.jpg
1877 0.03%29/Sep/05 23:40/hrs-info/joining.html
1875 0.02%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/moca+bean30tiny.jpg
1867 0.02%29/Sep/05 22:59/care/box-toy.html
1865 0.03%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/Brittany.jpg
1864 0.13%29/Sep/05 23:49/rabbit-center/adoptables/images/vanzettir146502sml.jpg
1864 0.02%29/Sep/05 23:49/rabbit-center/adoptables/images/r1179josephine62tiny.jpg
1860 0.03%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/r1180anabelle40tiny.jpg
1859 0.02%29/Sep/05 23:49/rabbit-center/adoptables/images/phoebe2_64tiny.jpg
1847 0.02%29/Sep/05 23:49/rabbit-center/adoptables/images/casey43tiny.jpg
1846 0.02%29/Sep/05 23:49/rabbit-center/adoptables/images/honey32tiny.jpg
1840 0.02%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/r1017mini81tiny.jpg
1839 0.02%29/Sep/05 23:49/rabbit-center/adoptables/images/r1071honda58tiny.jpg
1839 0.02%29/Sep/05 23:49/rabbit-center/adoptables/images/r1034sergio61tiny.jpg
1839 0.02%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/r963teddy2-13tiny.jpg
1836 0.02%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/r934brownie16tiny.jpg
1834 0.02%29/Sep/05 23:49/rabbit-center/adoptables/graphics/thumb/r964emma2-21tiny.jpg
1819 0.10%29/Sep/05 23:49/rabbit-center/adoptables/images/yasur146417sml.jpg
1794 0.04%30/Sep/05 00:06/journal/2-4/emergency-preparedness.html
1785 0.02%29/Sep/05 23:32/faq/sections/handling.html
1785 0.10%29/Sep/05 23:49/rabbit-center/adoptables/images/yelenar146331sml.jpg
1782 0.03%30/Sep/05 00:07/journal/1/dogs.html
1774 0.02%29/Sep/05 23:45/graphics/fun/netbunnies/DSC00007.jpg
1773 0.02%29/Sep/05 23:40/cgi-bin/print-article.cgi
1754 0.57%29/Sep/05 23:23/chapters/san-diego/adoption/colorbook.pdf
1733 0.02%29/Sep/05 23:39/journal/2-8/honorary-rabbit.html
1711 0.03%29/Sep/05 23:27/chapters/san-diego/diet/
1701 0.03%29/Sep/05 22:11/chapters/san-diego/diet/hay_grass.html
1693 0.03%29/Sep/05 23:49/journal/3-1/graphics/trio-3.gif
1692 0.09%29/Sep/05 23:50/graphics/fun/netbunnies/1.jpg
1691 0.03%29/Sep/05 23:49/journal/3-1/graphics/trio-1.gif
1686 0.03%29/Sep/05 23:49/journal/3-1/graphics/trio-2.gif
1685 0.01%28/Sep/05 14:36/rabbit-center/graphics/header_gr.gif
1683 0.10%30/Sep/05 00:02/graphics/fun/netbunnies/2rabbitsinbasketjanwild.jpg
1683 0.04%29/Sep/05 22:47/graphics/fun/netbunnies/bunny-mirage1.jpg
1678 0.04%29/Sep/05 23:46/journal/3-7/gi.html
1655 0.04%29/Sep/05 23:15/journal/4-4/tough-bonding.html
1645 0.02%29/Sep/05 23:55/journal/4-4/pen-living.html
1640 0.06%30/Sep/05 00:02/graphics/fun/netbunnies/2buns-herrington1.jpg
1622 0.08%29/Sep/05 23:44/graphics/fun/netbunnies/Bunny-Davis1.jpg
1619 0.03%29/Sep/05 23:50/journal/3-1/red-urine.html
1607 0.02%29/Sep/05 22:46/graphics/fun/netbunnies/C-H-eating.jpg
1606 0.01%29/Sep/05 23:02/chat/
1582 0.02%29/Sep/05 22:42/faq/sections/rabbit-proofing.html
1553 0.04%29/Sep/05 23:46/journal/3-8/head-tilt.html
1544 0.02%29/Sep/05 23:47/journal/2-12/fly-strike.html
1518 0.03%29/Sep/05 23:43/links/sections/groups.html
1500 0.04%29/Sep/05 23:33/graphics/fun/netbunnies/fuzzy-link1.jpg
1499 0.08%29/Sep/05 21:16/graphics/fun/netbunnies/my bunnies-sukiennik1.jpg
1498 0.02%29/Sep/05 22:58/journal/2-7/max.html
1488 0.03%29/Sep/05 22:15/chapters/san-diego/health/
1485 0.03%29/Sep/05 23:40/hrs-info/feedback.html
1481 0.02%29/Sep/05 22:39/faq/sections/warm-weather.html
1475 0.02%29/Sep/05 23:03/fun/biscuts.html
1471 0.03%29/Sep/05 21:10/rabbit-center/adoptables/images/myra002.jpg
1469 0.02%29/Sep/05 23:47/journal/3-12/disabled-litter.html
1459 0.05%29/Sep/05 23:57/chapters/san-diego/adoption/Cages/cage.html
1456 0.03%29/Sep/05 21:10/rabbit-center/adoptables/images/myra002_000.jpg
1452 0.05%29/Sep/05 22:11/chapters/san-diego/diet/graphics/bermuda.jpg
1450 0.03%29/Sep/05 23:30/rabbit-center/lucky_rescue.html
1447 0.02%29/Sep/05 22:35/journal/4-3/new-home.html
1443 0.02%29/Sep/05 23:36/journal/2-10/mellow-lops.html
1441 0.07%29/Sep/05 23:57/graphics/fun/netbunnies/panda-rudd1.jpg
1438 0.01%29/Sep/05 23:14/graphics/banners/stories-l.gif
1437 0.03%29/Sep/05 22:11/chapters/san-diego/diet/graphics/timothy.jpg
1433 29/Sep/05 23:14/graphics/banners/stories-r.gif
1427 0.04%29/Sep/05 22:11/chapters/san-diego/diet/graphics/alfalfa.jpg
1420 0.03%29/Sep/05 22:11/chapters/san-diego/diet/graphics/oat.jpg
1420 0.01%30/Sep/05 00:01/hrs-info/whats-popular.html
1400 0.01%29/Sep/05 22:11/chapters/san-diego/diet/graphics/orchard_grass_small.jpg
1396 0.04%29/Sep/05 23:58/chapters/san-diego/adoption/Cages/Cage-LaceyBeau.jpg
1386 0.03%29/Sep/05 22:47/faq/sections/multiple.html
1385 0.03%29/Sep/05 23:50/journal/3-4/pellets.html
1380 0.05%29/Sep/05 23:41/graphics/fun/netbunnies/3bunnies-honee1.jpg
1377 0.02%29/Sep/05 22:58/journal/2-7/graphics/black-max.gif
1366 0.02%29/Sep/05 20:18/graphics/fun/netbunnies/jojo1-lauren1.jpg
1360 0.02%29/Sep/05 23:22/chapters/san-diego/health/poisonous.html
1360 0.03%29/Sep/05 23:55/graphics/fun/netbunnies/Cuddles.jpg
1356 29/Sep/05 21:33/spam_vaccine/at_medium.gif
1355 0.01%29/Sep/05 23:35/journal/3-1/games-rabbits-play.html
1353 0.03%29/Sep/05 21:10/rabbit-center/adoptables/graphics/big/Spike25sml.jpg
1353 0.11%29/Sep/05 23:28/chapters/san-diego/diet/graphics/Food_pyramid.jpg
1351 0.02%29/Sep/05 23:50/chapters/san-diego/diet/foods.html
1345 0.01%29/Sep/05 21:10/rabbit-center/adoptables/graphics/big/sasparilla22tiny.jpg
1341 0.03%29/Sep/05 23:51/graphics/misc/cable-wrap-pkg.jpg
1338 0.02%29/Sep/05 22:42/graphics/misc/wrapped-cord.jpg
1330 0.09%29/Sep/05 23:57/graphics/fun/netbunnies/2rabbitsoutsideleaves.jpg
1330 0.01%29/Sep/05 23:02/postcard/
1324 0.02%29/Sep/05 15:54/graphics/fun/netbunnies/bunny-wilt1.jpg
1321 0.01%29/Sep/05 23:50/journal/3-1/graphics/herman.gif
1318 29/Sep/05 22:55/rabbit-center/lucky/css/mm_health_nutr.css
1316 0.12%29/Sep/05 23:41/chapters/san-diego/adoption/adoption_photos.html
1313 0.04%29/Sep/05 23:09/graphics/fun/netbunnies/slinky-Smudge1.jpg
1305 0.03%29/Sep/05 23:53/chapters/san-diego/adoption/graphics/JulieJessica3-333-250.jpg
1290 0.05%29/Sep/05 23:51/graphics/fun/netbunnies/bunny-stak1.jpg
1266 0.03%28/Sep/05 16:53/rabbit-center/adoptables/graphics/thumb/berklee03tiny.jpg
1264 0.02%29/Sep/05 21:07/journal/3-8/graphics/head-tilt.gif
1264 29/Sep/05 22:55/rabbit-center/lucky/images/mm_dashed_line.gif
1257 0.02%29/Sep/05 23:43/graphics/fun/netbunnies/BomBom-Southall1.jpg
1248 0.01%29/Sep/05 23:42/graphics/fun/netbunnies/Amy2-garcia1.jpg
1247 0.32%29/Sep/05 21:55/chapters/san-diego/diet/graphics/Food_Chart.pdf
1244 29/Sep/05 22:55/rabbit-center/lucky/images/mm_spacer.gif
1239 0.09%29/Sep/05 23:41/graphics/fun/netbunnies/3rabbitsonchair.jpg
1237 0.02%29/Sep/05 23:46/journal/2-8/eye-problems.html
1237 0.02%29/Sep/05 23:00/journal/3-11/lift.html
1233 0.03%29/Sep/05 23:47/journal/3-2/e-cuniculi.html
1228 0.02%29/Sep/05 23:50/journal/1/lap-rabbit.html
1226 0.02%29/Sep/05 23:40/hrs-info/whats-new.html
1193 0.11%29/Sep/05 23:58/chapters/san-diego/adoption/Cages/Libby_cage_setup.jpg
1189 0.05%29/Sep/05 23:51/graphics/fun/netbunnies/amelia-mcsherry1.jpg
1188 0.04%29/Sep/05 23:50/graphics/fun/netbunnies/checkers-tolle1.jpg
1186 30/Sep/05 00:03/links/foo.html
1183 0.05%29/Sep/05 23:41/graphics/fun/netbunnies/6V46_003.jpg
1180 0.07%29/Sep/05 23:58/chapters/san-diego/adoption/Cages/Honey_famroom_pen.JPG
1177 0.98%29/Sep/05 20:04/flyers/rabbitadnytimes.pdf
1176 0.01%29/Sep/05 23:27/rabbit-center/retail/ani_bun.gif
1176 0.04%29/Sep/05 23:41/graphics/fun/netbunnies/6V46_006.jpg
1165 0.06%29/Sep/05 23:32/graphics/fun/netbunnies/freddy-lalonde1.jpg
1163 0.05%29/Sep/05 23:46/graphics/fun/netbunnies/Annabelle-Geisler1.jpg
1162 0.01%29/Sep/05 23:40/help/
1155 0.03%29/Sep/05 23:42/graphics/fun/netbunnies/BISCOTTO-Negro1.jpg
1151 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/babies4-ozab1.jpg
1147 0.02%29/Sep/05 23:58/chapters/san-diego/adoption/Cages/Shelley_office_1.JPG
1141 0.04%29/Sep/05 23:42/graphics/fun/netbunnies/Baby_Honey-Simon1.jpg
1138 0.02%29/Sep/05 23:03/chapters/san-diego/products/graphics/products_headergraphic_v2.jpg
1130 0.07%29/Sep/05 23:58/chapters/san-diego/adoption/Cages/Alison_pen_1.JPG
1130 0.01%30/Sep/05 00:06/links/sections/pictures.html
1130 0.07%29/Sep/05 23:58/chapters/san-diego/adoption/Cages/Alison_pen_2.JPG
1128 0.03%30/Sep/05 00:04/graphics/chinese-bunny.gif
1128 0.02%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Rachel_2_Apr05.jpg
1119 29/Sep/05 23:43/graphics/pixel.gif
1113 0.01%29/Sep/05 20:57/graphics/fun/netbunnies/Dominoe-shannon1.jpg
1113 0.01%29/Sep/05 23:42/hrs-info/site-map.html
1100 0.01%29/Sep/05 23:45/translations/japanese/
1100 0.01%29/Sep/05 20:52/graphics/postcard/Pl-sch10-tmb.jpg
1098 0.03%29/Sep/05 23:58/chapters/san-diego/adoption/Cages/Bess_cage.JPG
1096 0.20%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Lily-Luna_10Aug05.jpg
1096 0.17%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Dusty_3_3Aug05.jpg
1092 0.04%29/Sep/05 23:58/chapters/san-diego/adoption/Cages/LeithPetwerks_condo.JPG
1087 0.02%29/Sep/05 23:46/chapters/san-diego/health/vet-talk/pasteurella.html
1082 0.05%29/Sep/05 23:01/graphics/fun/netbunnies/bunny-white.jpg
1080 0.04%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Bonnie_3_Jan05.jpg
1080 0.03%29/Sep/05 23:58/chapters/san-diego/adoption/Cages/Patio_setup_1.JPG
1080 0.03%29/Sep/05 22:15/graphics/fun/netbunnies/sexy-szafranski1.jpg
1076 29/Sep/05 23:50/graphics/fun/
23 28/Sep/05 21:36  /graphics/fun/?M=A
21 29/Sep/05 06:12  /graphics/fun/?N=A
21 29/Sep/05 16:25  /graphics/fun/?N=D
20 29/Sep/05 10:47  /graphics/fun/?S=A
20 28/Sep/05 21:35  /graphics/fun/?D=A
19 28/Sep/05 21:36  /graphics/fun/?M=D
17 28/Sep/05 21:36  /graphics/fun/?S=D
1072 0.02%29/Sep/05 20:52/graphics/postcard/paddington-craddick-tmb.jpg
1072 0.02%29/Sep/05 23:53/journal/3-3/age-related-behavior.html
1071 0.04%29/Sep/05 23:11/graphics/fun/netbunnies/Athene-Owdicat1.jpg
1071 0.01%29/Sep/05 23:12/journal/2-7/letterman.html
1070 0.14%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Leeland.jpg
1064 0.04%29/Sep/05 22:56/rabbit-center/lucky/images/lucky_1_002.gif
1060 0.01%29/Sep/05 20:17/graphics/fun/netbunnies/gizmo-whissel1.jpg
1058 0.05%29/Sep/05 23:42/graphics/fun/netbunnies/BabyBunnies-Kiddazzle1.jpg
1057 0.03%29/Sep/05 23:50/rabbit-center/hayward_rabbits.html
1057 0.01%29/Sep/05 23:44/graphics/fun/netbunnies/C-H-circle.jpg
1056 0.01%30/Sep/05 00:06/care/medical-leads.html
1055 0.02%29/Sep/05 23:00/journal/3-11/graphics/pickup4.gif
1053 0.02%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_DallasRandi1_Jun05.jpg
1044 0.04%29/Sep/05 23:00/journal/3-11/graphics/pickup123.gif
1041 0.01%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Martin.jpg
1039 0.03%29/Sep/05 23:41/graphics/fun/netbunnies/8-28-20.jpg
1038 0.01%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Savannah_Feb05.jpg
1037 0.02%29/Sep/05 10:46/webmail/index.cgi
11 20/Sep/05 08:45  /webmail/index.cgi?sessionid=margo-session-0.960155170876533&sort=date&folder=INBOX&action=composemessage&firstmessage=1
1037 0.01%29/Sep/05 20:52/graphics/postcard/tracy-tmb.jpg
1035 0.01%29/Sep/05 22:35/adoption/baby-bunnies.html
1031 0.02%29/Sep/05 22:59/journal/3-3/fiber.html
1031 0.05%29/Sep/05 20:48/graphics/fun/netbunnies/BBunny17-Myers1.jpg
1028 0.01%29/Sep/05 23:48/links/sections/reference.html
1026 0.13%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Clay_Jun05.jpg
1026 0.03%29/Sep/05 23:01/graphics/fun/netbunnies/rabbit2-weinberg1.jpg
1026 0.02%29/Sep/05 20:52/graphics/postcard/strawberry-white-baby-tmb.gif
1026 0.01%29/Sep/05 23:13/fun/answer.html
1025 0.02%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/Marjorie4.jpg
1024 0.05%29/Sep/05 20:52/graphics/postcard/izzy-portrait-crop-tmb.jpg
1023 0.01%29/Sep/05 20:52/graphics/postcard/Tommy2-tmb.jpg
1021 0.01%29/Sep/05 20:52/graphics/postcard/amos-tmb.jpg
1019 0.02%29/Sep/05 20:52/graphics/postcard/lavender-tmb.jpg
1015 0.01%29/Sep/05 20:52/graphics/postcard/tabatha-tmb.jpg
1015 0.20%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Kisser_1_Apr05.jpg
1014 0.01%29/Sep/05 20:52/graphics/postcard/willow-in-bed-teddy-tmb.jpg
1013 0.03%29/Sep/05 23:44/graphics/fun/netbunnies/Bunny+Dog-Tsang1.jpg
1011 0.01%29/Sep/05 20:52/graphics/postcard/Rab1-tmb.jpg
1011 0.08%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Belinda_Jun05.jpg
1005 0.02%29/Sep/05 20:46/graphics/fun/netbunnies/DSC00020A.jpg
1003 0.01%29/Sep/05 23:38/journal/2-5/men-women-bunnies.html
997 0.02%29/Sep/05 23:42/graphics/fun/netbunnies/9.jpg
997 0.03%29/Sep/05 23:42/graphics/fun/netbunnies/BabySammy-Singleton1.jpg
996 0.19%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Annie_4_14Aug05.jpg
994 0.02%29/Sep/05 21:33/journal/3-3/digestibility.html
992 0.02%29/Sep/05 22:54/faq/sections/classroom.html
992 0.01%29/Sep/05 23:05/journal/3-6/play-ed.html
988 0.03%29/Sep/05 23:56/graphics/fun/netbunnies/spencer.jpg
988 0.02%29/Sep/05 22:56/journal/1/place-space.html
982 0.02%29/Sep/05 23:47/graphics/fun/netbunnies/Bear-Zehpyr1.jpg
981 0.01%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Ariana_Jul05.jpg
977 0.02%29/Sep/05 21:34/chapters/san-diego/behavior/dothat.html
977 0.27%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Hannah_1_29Aug05.jpg
976 0.02%29/Sep/05 20:48/graphics/fun/netbunnies/Asher2-Denise1.jpg
968 0.03%29/Sep/05 22:31/faq/sections/medicating.html
965 0.02%29/Sep/05 20:52/faq/sections/sources.html
963 0.45%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Taxi-Tuxedo_May05.jpg
963 0.07%30/Sep/05 00:05/graphics/fun/netbunnies/henrybumble-smith1.jpg
961 0.01%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Taylor_Dec04.jpg
961 0.01%29/Sep/05 22:57/adoption/why-not-to-breed.html
959 0.02%29/Sep/05 23:47/journal/4-3/maggots.html
958 0.01%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Daisy2_Jan05.jpg
954 0.01%29/Sep/05 23:43/journal/3-2/graphics/health-1.gif
951 0.02%29/Sep/05 23:43/journal/3-2/graphics/health-2.gif
948 0.15%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Peter-lop_1_31Aug05.jpg
944 0.02%29/Sep/05 23:39/graphics/fun/netbunnies/xmasweb-hyperchick1.jpg
943 0.01%29/Sep/05 22:43/graphics/fun/netbunnies/FlyingBunny-Krissy1.jpg
939 0.01%29/Sep/05 23:37/hrs-info/link-to-hrs.html
937 0.01%29/Sep/05 23:00/chapters/san-diego/health/graphics/good-teeth.jpg
935 0.02%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Jimmy_4_31Jul05.jpg
935 0.03%29/Sep/05 23:42/graphics/fun/netbunnies/BallBall-Choi1.jpg
934 0.07%29/Sep/05 23:55/graphics/fun/netbunnies/suki-1yr-rear-end.jpg
934 0.01%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Kim_Jun05.jpg
933 0.01%29/Sep/05 23:12/journal/2-7/graphics/top-10.gif
930 0.02%29/Sep/05 23:03/chapters/san-diego/products/office_store.html
929 0.01%29/Sep/05 23:49/chapters/san-diego/products/
928 0.11%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/pamela.jpg
927 0.01%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Sierra1_Jun05.jpg
924 0.02%30/Sep/05 00:03/graphics/mine/foo/9-cds-50.jpg
922 0.01%29/Sep/05 23:40/opinion/
921 0.02%30/Sep/05 00:00/graphics/fun/netbunnies/bugs-arobinson1.jpg
921 0.01%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Willow_1_31Jul05.JPG
918 0.04%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Cadbury_2_19May05.jpg
914 0.01%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Muffin_Jun05.jpg
912 0.02%29/Sep/05 22:21/graphics/fun/netbunnies/Paddington-Craddick1.jpg
910 0.02%29/Sep/05 23:38/journal/3-4/marriage.html
907 0.01%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Honey_4_11Jul03.JPG
906 0.02%29/Sep/05 22:55/journal/1/place-space-update.html
905 0.01%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Wynne_Brooks_Jan05.jpg
904 0.01%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Miranda_3_Mar05.jpg
904 0.01%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Lizetta_Dec04.jpg
904 0.01%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Lilly_2_Jun04.JPG
903 0.01%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Luke_5_Apr05.jpg
903 0.01%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Angel1_Jun05.jpg
903 0.02%29/Sep/05 22:56/rabbit-center/lucky/images/front_001.gif
903 0.01%29/Sep/05 22:46/graphics/fun/netbunnies/C-H-resting.jpg
902 0.01%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_RaindropRomeo3_Jun05.jpg
901 0.11%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Meadow_4_20Jun05.jpg
899 0.07%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/blossom1.jpg
897 0.03%29/Sep/05 22:26/graphics/fun/netbunnies/Beatrice-Pipkorn1.jpg
893 0.02%29/Sep/05 22:58/chapters/san-diego/behavior/litterbox_setup.html
893 0.01%30/Sep/05 00:04/graphics/
12 29/Sep/05 09:48  /graphics/?M=A
11 28/Sep/05 21:35  /graphics/?M=D
11 28/Sep/05 21:35  /graphics/?N=D
892 0.07%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Thor_Apr05.jpg
891 0.01%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Keera_Monroe_DEc04.jpg
890 0.01%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Georgia_4_11Jul03.JPG
887 0.06%29/Sep/05 23:43/graphics/fun/netbunnies/Buddy2-Lepage1.jpg
887 29/Sep/05 22:56/rabbit-center/lucky/images/logo-footer.gif
885 0.02%29/Sep/05 23:46/care/vhd.html
883 0.02%29/Sep/05 23:47/chapters/san-diego/health/vet-talk/spay_neuter.html
881 0.01%29/Sep/05 23:15/care/myxo.html
878 0.03%29/Sep/05 21:27/graphics/fun/netbunnies/bear1-binks1.jpg
877 0.01%29/Sep/05 23:52/care/bibliography.html
876 0.01%30/Sep/05 00:05/journal/3-5/bladder-disease.html
871 0.01%29/Sep/05 22:56/journal/2-7/chateau.html
868 0.01%29/Sep/05 23:45/journal/2-12/tools-of-the-trade.html
857 0.06%29/Sep/05 20:48/graphics/fun/netbunnies/Ben-Trent1.jpg
857 0.02%29/Sep/05 22:22/graphics/fun/netbunnies/baby3.jpg
855 0.01%29/Sep/05 23:28/adoption/hidden-cost-of-breeding.html
855 0.01%29/Sep/05 23:12/journal/3-7/graphics/gi-tract-ill.gif
854 0.01%29/Sep/05 23:51/chapters/san-francisco/graphics/wavtile.gif
854 0.02%29/Sep/05 23:04/journal/3-11/rabbits-teaching-rabbits.html
854 0.02%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Dusty_Ronan_4_Dec04.jpg
850 0.08%29/Sep/05 23:41/chapters/san-diego/adoption/Adoption_Photos/HRS_Gwen_2_17Sept04.JPG
850 0.03%29/Sep/05 23:44/graphics/fun/netbunnies/Bunnies-Cohen1.jpg
847 0.02%29/Sep/05 22:53/graphics/fun/netbunnies/molly-cathey1.jpg
844 0.02%29/Sep/05 23:40/faq/sections/rescue.html
844 0.03%29/Sep/05 23:42/graphics/fun/netbunnies/BloopButt-Altitude1.jpg
842 0.01%29/Sep/05 22:45/journal/3-3/graphics/fiber.gif
841 0.01%29/Sep/05 23:51/journal/1/aloof.html
840 0.03%29/Sep/05 23:47/graphics/fun/netbunnies/BunBun.jpg
833 0.02%29/Sep/05 20:48/graphics/fun/netbunnies/Belle-Chase1.jpg
832 0.02%29/Sep/05 23:46/care/pasteurella.html
831 29/Sep/05 23:11/graphics/banners/banner-m.gif
828 0.01%29/Sep/05 22:38/easter/hrs-square-easter-75.jpg
824 0.01%29/Sep/05 23:45/journal/2-2/mean-rabbit.html
822 0.03%29/Sep/05 22:33/graphics/fun/netbunnies/alien-tenma1.jpg
815 0.03%29/Sep/05 23:46/journal/2-6/tusks.html
813 0.01%29/Sep/05 22:33/care/poinsettia.html
807 0.02%29/Sep/05 23:26/links/sections/rabbits.html
804 0.01%29/Sep/05 20:55/journal/3-8/soft-stools.html
802 0.02%29/Sep/05 22:24/graphics/fun/netbunnies/Biba-Vangeel1.jpg
802 0.02%29/Sep/05 23:02/journal/3-4/pellet-info.html
801 0.01%30/Sep/05 00:00/rabbit-center/hayward_rescue/hayward_rabbits_media-alert.html
800 0.02%29/Sep/05 23:50/rabbit-center/hayward_rescue/hayward_graphics/first_day.jpg
800 0.01%29/Sep/05 23:50/rabbit-center/graphics/header_gr_hw.gif
799 0.04%29/Sep/05 23:56/graphics/fun/netbunnies/Bunny-Hiler1.jpg
799 0.01%29/Sep/05 22:25/journal/3-7/brandolino-poem.html
796 0.02%29/Sep/05 23:41/journal/3-2/bridging-com-gaps.html
787 0.02%29/Sep/05 21:32/graphics/fun/netbunnies/BoboIndy-Niemi1.jpg
778 0.03%29/Sep/05 20:57/graphics/fun/netbunnies/Biscotto-Negro1.jpg
777 0.03%29/Sep/05 21:44/journal/2-7/graphics/iowa-house.gif
770 0.01%29/Sep/05 23:51/chapters/san-diego/diet/graphics/cecals.jpg
769 0.01%29/Sep/05 23:40/journal/1/cage-manufacturers.html
768 0.01%29/Sep/05 23:45/chapters/san-diego/health/graphics/Bad_teeth_2.JPG
768 0.03%29/Sep/05 23:43/graphics/fun/netbunnies/Bunnies-Catmichel1.jpg
767 0.01%29/Sep/05 23:12/journal/4-5/bunny-rules.html
766 0.05%29/Sep/05 23:43/graphics/fun/netbunnies/Buddy1-Lepage1.jpg
757 0.04%29/Sep/05 23:43/graphics/fun/netbunnies/BubbaPinky-Ervin1.jpg
755 0.02%29/Sep/05 22:40/journal/3-9/graphics/mouth.gif
751 0.02%29/Sep/05 23:44/graphics/fun/netbunnies/Bunny-Mbhjch1.jpg
750 0.01%29/Sep/05 23:51/chapters/san-diego/diet/graphics/poops.jpg
750 0.12%29/Sep/05 22:58/chapters/san-diego/behavior/graphics/fresh_hay.JPG
748 0.05%29/Sep/05 22:09/rabbit-center/hayward_rescue/hayward_graphics/hayward_bunnies_1.jpg
746 0.02%29/Sep/05 23:43/graphics/fun/netbunnies/Bub&Pink-Ervin1.jpg
745 0.01%29/Sep/05 22:09/rabbit-center/hayward_rescue/hayward_graphics/abscess.jpg
744 0.02%29/Sep/05 23:54/graphics/fun/netbunnies/FIONA-Primrose1.jpg
737 0.01%29/Sep/05 23:27/journal/2-7/bringing-baby-home.html
734 29/Sep/05 20:52/graphics/postcard/rabbit-stamp.gif
729 0.04%29/Sep/05 23:43/graphics/fun/netbunnies/Buddy-Rowan1.jpg
726 0.01%29/Sep/05 23:03/chapters/san-diego/products/graphics/HRS_Office_5_Jan04.JPG
726 0.02%29/Sep/05 23:03/chapters/san-diego/products/graphics/HRS_Office_4_Jan04.JPG
725 0.01%29/Sep/05 23:04/journal/3-11/graphics/one-in-one-out-crate.gif
725 29/Sep/05 23:44/rabbit-center/images/mm_spacer.gif
724 29/Sep/05 23:44/rabbit-center/css/mm_graphic.css
723 0.04%29/Sep/05 23:44/graphics/fun/netbunnies/BunniesBasket-Krissy1.jpg
723 0.03%29/Sep/05 23:59/chapters/san-francisco/adoptables.html
723 0.02%29/Sep/05 23:49/rabbit-center/adoptables/images/calypsoclara39tiny_000.jpg
722 0.03%29/Sep/05 23:44/graphics/fun/netbunnies/Bunnies02.jpg
722 0.01%29/Sep/05 23:04/journal/3-11/graphics/2by-crate-gate.gif
721 0.04%29/Sep/05 23:45/graphics/fun/netbunnies/Cappuccino-Philips1.jpg
721 0.04%29/Sep/05 23:43/graphics/fun/netbunnies/BunBun-Kelly1.jpg
720 0.01%29/Sep/05 20:13/graphics/fun/netbunnies/licorice-gluck1.jpg
720 0.01%29/Sep/05 23:04/journal/3-11/graphics/peering-above-crate.gif
720 0.01%29/Sep/05 23:03/chapters/san-diego/products/graphics/HRS_Office_boxed_hay_Jan04.JPG
719 0.02%29/Sep/05 23:49/rabbit-center/adoptables/images/calypsoclara39tiny.jpg
718 0.01%29/Sep/05 23:43/graphics/fun/netbunnies/Bun-hahn1.jpg
718 0.03%29/Sep/05 23:03/chapters/san-diego/products/graphics/HRS_Office_Cages_Jan04.JPG
717 0.11%29/Sep/05 22:46/graphics/fun/netbunnies/bunnikins.jpg
716 0.01%29/Sep/05 23:04/journal/3-11/graphics/looking-in-crate.gif
713 0.05%29/Sep/05 23:03/chapters/san-diego/products/graphics/HRS_Office_toys_supplies_Jan04.JPG
712 0.01%30/Sep/05 00:05/journal/3-5/graphics/stone.gif
710 0.04%29/Sep/05 23:57/graphics/fun/netbunnies/Charming2-christina1.jpg
710 0.05%29/Sep/05 22:58/chapters/san-diego/behavior/graphics/large_catpan.JPG
710 0.01%29/Sep/05 23:03/chapters/san-diego/products/graphics/HRS_Office_CF_Jan04.JPG
707 0.03%29/Sep/05 21:40/graphics/fun/netbunnies/Cuddles-Barker1.jpg
707 0.04%29/Sep/05 23:03/chapters/san-diego/products/graphics/HRS_Office_Books_1_Jan04.JPG
707 0.01%29/Sep/05 23:46/graphics/fun/netbunnies/tinker-heinsma1.jpg
706 0.02%29/Sep/05 23:03/chapters/san-diego/products/graphics/HRS_Office_crocks_1_Jan04.JPG
704 29/Sep/05 23:54/chapters/san-francisco/banner-small.gif
704 0.02%29/Sep/05 23:49/rabbit-center/adoptables/images/ashleynew_002.jpg
702 0.12%29/Sep/05 22:58/chapters/san-diego/behavior/graphics/p3130003.jpg
702 0.01%29/Sep/05 22:58/chapters/san-diego/behavior/graphics/medium_catpan.JPG
702 0.01%29/Sep/05 23:03/chapters/san-diego/products/graphics/HRS_Office_pens_Jan04.JPG
700 0.02%29/Sep/05 22:58/chapters/san-diego/behavior/graphics/used_litterbox.JPG
700 0.02%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Emily_2_Feb05.jpg
700 0.02%29/Sep/05 20:17/graphics/fun/netbunnies/barnie2-lee1.jpg
699 0.01%29/Sep/05 22:58/chapters/san-diego/behavior/graphics/fresh_cf.JPG
699 0.01%29/Sep/05 22:09/rabbit-center/hayward_rescue/hayward_graphics/rabbit.jpg
699 0.01%29/Sep/05 22:58/chapters/san-diego/behavior/graphics/giant_catpan.JPG
698 0.02%29/Sep/05 22:58/chapters/san-diego/behavior/graphics/CF_hay.JPG
697 0.03%29/Sep/05 22:28/graphics/fun/netbunnies/Fluffy1-diggins1.jpg
697 0.03%29/Sep/05 20:43/graphics/fun/netbunnies/Bunny2-Hough1.jpg
696 0.02%29/Sep/05 23:03/chapters/san-diego/products/graphics/HRS_Office_tshirts_2_Jan04.JPG
696 0.01%29/Sep/05 23:21/journal/1/history-of-easter.html
695 0.01%29/Sep/05 23:33/care/recipes.html
692 0.01%29/Sep/05 21:49/adoption/right-person.html
692 0.07%29/Sep/05 22:58/chapters/san-diego/behavior/graphics/pa140024.jpg
691 0.01%29/Sep/05 21:23/journal/3-5/calcium.html
691 0.01%29/Sep/05 23:15/chapters/san-diego/adoption/available.html
690 0.01%29/Sep/05 18:54/chapters/san-diego/health/vetlist.html
690 0.02%29/Sep/05 23:03/chapters/san-diego/products/graphics/HRS_Office_donated_toys_Jan04.JPG
689 0.01%29/Sep/05 23:10/graphics/fun/netbunnies/sassy-william1.jpg
688 0.04%29/Sep/05 22:09/rabbit-center/hayward_rescue/hayward_graphics/hayward_shelter.jpg
687 0.01%29/Sep/05 23:51/chapters/san-francisco/graphics/adoptables/SF_Sparky_2_Feb05.jpg
680 0.02%29/Sep/05 23:44/graphics/fun/netbunnies/Bunny-Sepesy1.jpg
679 0.03%29/Sep/05 20:49/graphics/fun/netbunnies/Bugsi-bc1.jpg
674 0.01%29/Sep/05 20:49/graphics/fun/netbunnies/IJOOR-Vandenberg1.jpg
673 0.02%29/Sep/05 23:53/chapters/san-diego/adoption/new_zealand_white.html
671 0.02%29/Sep/05 23:00/graphics/fun/netbunnies/Bunny1-Hough1.jpg
669 0.05%29/Sep/05 22:09/rabbit-center/hayward_rescue/hayward_graphics/boy_tumor.jpg
668 0.02%29/Sep/05 23:58/graphics/fun/netbunnies/maroon-lin1.jpg
668 29/Sep/05 22:10/graphics/books/stuparyk_small.jpg
667 0.01%29/Sep/05 23:46/journal/3-9/oral-health.html
666 0.02%29/Sep/05 20:20/graphics/fun/netbunnies/rabbits-beth1jpg.jpg
664 0.01%29/Sep/05 22:21/journal/3-5/like-a-rabbit.html
664 0.07%30/Sep/05 00:02/graphics/fun/netbunnies/blueberry-perillat1.jpg
664 0.03%29/Sep/05 23:46/chapters/san-diego/health/dental_disease.html
662 0.02%29/Sep/05 23:30/graphics/fun/netbunnies/leah-nancy1.jpg
662 29/Sep/05 10:46/webmail/images/left-grey.gif
657 0.01%29/Sep/05 22:43/care/litterbox.html
657 0.02%29/Sep/05 23:57/graphics/fun/netbunnies/Dot3-Neumann1.jpg
655 0.01%29/Sep/05 22:57/care/declawing.html
655 0.02%29/Sep/05 23:44/graphics/fun/netbunnies/Cadbury-Beckemeyer1.jpg
655 0.02%29/Sep/05 22:55/rabbit-center/lucky/images/lucky.gif
653 0.01%29/Sep/05 20:43/fun/answer1.html
652 29/Sep/05 23:13/journal/2-6/graphics/malocclusion.gif
649 0.03%29/Sep/05 23:44/graphics/fun/netbunnies/Bunny3-Hough1.jpg
648 0.02%29/Sep/05 20:56/graphics/fun/netbunnies/Samson-Yong1.jpg
647 0.02%29/Sep/05 18:47/graphics/fun/netbunnies/b31997.jpg
647 0.02%29/Sep/05 23:47/graphics/fun/netbunnies/Mister-Mizzrizz1.jpg
645 0.03%29/Sep/05 23:34/graphics/fun/netbunnies/Bunny2-Emig1.jpg
644 0.01%29/Sep/05 23:45/graphics/fun/netbunnies/Caesar-Curtis1.jpg
641 0.01%29/Sep/05 22:21/care/emergency-planning.html
639 0.01%29/Sep/05 23:53/graphics/fun/netbunnies/bunny-posey1.jpg
639 0.05%29/Sep/05 23:49/graphics/fun/netbunnies/WABBIT-Wes1.jpg
638 0.02%29/Sep/05 23:45/graphics/fun/netbunnies/Cbunny2-Easteregg1.jpg
634 0.01%29/Sep/05 21:37/graphics/fun/netbunnies/zoe-ffitch1.jpg
633 0.02%29/Sep/05 20:45/graphics/fun/netbunnies/CottonFeedcloseup1.jpg
631 0.01%29/Sep/05 21:32/faq/sections/intro.html
631 29/Sep/05 23:55/chapters/san-francisco/graphics/logo-footer.gif
630 0.01%29/Sep/05 23:30/graphics/fun/netbunnies/deliverance-avery1.jpg
628 0.02%29/Sep/05 21:18/graphics/fun/netbunnies/bianca-dudette1.jpg
628 0.05%29/Sep/05 23:46/graphics/fun/netbunnies/DSC00011.jpg
626 0.03%29/Sep/05 23:44/graphics/fun/netbunnies/CHIP1-Rappold1.jpg
624 0.02%29/Sep/05 21:37/graphics/fun/netbunnies/casey&min-Cathy1.jpg
623 0.03%29/Sep/05 23:54/graphics/fun/netbunnies/Bunny4-Hough1.jpg
621 0.02%29/Sep/05 22:32/chapters/san-diego/faq/
620 0.02%29/Sep/05 21:31/graphics/fun/netbunnies/creepy 11-khas1.jpg
620 0.02%29/Sep/05 17:38/chapters/san-diego/aboutus/bunnyfest/bunnyfest_2005_overview.html
620 0.02%29/Sep/05 23:45/graphics/fun/netbunnies/Cbunny-Easteregg1.jpg
619 0.02%29/Sep/05 20:15/graphics/fun/netbunnies/nestle-avery1.jpg
616 29/Sep/05 23:44/rabbit-center/images/logo-footer2.gif
616 0.04%29/Sep/05 21:26/hrs-info/vet-conference/attendees-by-state.html
613 0.01%29/Sep/05 23:27/journal/2-7/graphics/photo-page-1.gif
613 0.04%29/Sep/05 22:24/graphics/fun/netbunnies/bunny07-Kaldal1.jpg
612 0.02%29/Sep/05 23:01/links/sections/books.html
612 29/Sep/05 23:44/rabbit-center/images/notify-me.gif
611 0.02%29/Sep/05 22:49/graphics/fun/netbunnies/baby-Jalasco1.jpg
611 0.02%29/Sep/05 23:06/graphics/fun/netbunnies/willow-in-bed-with-teddy.jpg
611 0.02%29/Sep/05 22:14/graphics/fun/netbunnies/bunny-lee1.jpg
609 0.01%29/Sep/05 23:18/graphics/easter/anti-gabriella-circle.jpg
609 0.01%29/Sep/05 21:57/graphics/fun/netbunnies/DSC00024.jpg
607 0.01%29/Sep/05 23:11/translations/spanish/criar-o-no-criar.html
606 0.02%29/Sep/05 23:00/chapters/san-diego/behavior/bunnyproofing.html
605 0.01%29/Sep/05 22:28/graphics/fun/netbunnies/pete-guzman1.jpg
603 0.04%29/Sep/05 20:11/graphics/fun/netbunnies/beachingbunnieshenriettahon.jpg
603 0.01%29/Sep/05 23:02/adoption/overpopulation.html
600 0.01%29/Sep/05 20:57/graphics/fun/netbunnies/Choco.jpg
599 0.01%29/Sep/05 20:44/graphics/fun/netbunnies/Chad-hazelwood1.jpg
598 0.02%29/Sep/05 23:45/graphics/fun/netbunnies/Chuck&Reeses-Goldsmith1.jpg
597 0.01%29/Sep/05 23:56/journal/1/critically-ill.html
597 0.04%29/Sep/05 17:36/graphics/fun/netbunnies/kidschris1-Hunt1.jpg
594 0.01%29/Sep/05 23:58/graphics/fun/netbunnies/little punk-sukiennik1.jpg
593 0.09%29/Sep/05 22:09/rabbit-center/hayward_rescue/hayward_graphics/Toby_day1.JPG
592 29/Sep/05 10:46/webmail/images/up.gif
592 29/Sep/05 21:50/chapters/san-diego/adoption/beforeadopt.html
591 0.02%29/Sep/05 23:45/graphics/fun/netbunnies/Cinna-Bun1-cobb1.jpg
591 29/Sep/05 10:46/webmail/images/right-grey.gif
591 0.03%29/Sep/05 20:57/graphics/fun/netbunnies/SmokeyPepper-Fuzzy1.jpg
590 0.01%29/Sep/05 22:05/journal/3-10/classroom.html
590 0.03%29/Sep/05 23:01/graphics/fun/netbunnies/ChuChu1-Choi1.jpg
590 0.01%29/Sep/05 22:38/health/exotic-diseases.html
589 0.01%29/Sep/05 21:37/graphics/fun/netbunnies/ShadowToSend.jpg
589 0.03%29/Sep/05 22:18/graphics/fun/netbunnies/francois-hebble1.jpg
589 0.02%29/Sep/05 23:58/graphics/fun/netbunnies/HoneyBunny-Lud1.jpg
588 0.01%29/Sep/05 23:46/chapters/san-diego/health/vet-talk/eyes.html
587 0.02%29/Sep/05 23:46/graphics/fun/netbunnies/Dexter-Ambear1.jpg
587 29/Sep/05 10:46/webmail/images/addaddress.gif
587 0.01%29/Sep/05 20:57/graphics/fun/netbunnies/CaesarSleeping-Dawn1.jpg
586 0.01%29/Sep/05 17:27/chapters/san-diego/behavior/bonding-tips.html
584 0.01%28/Sep/05 17:01/chapters/san-diego/adoption/Adoption_Photos/HRS_NatashaBeau3_Jan05.jpg
583 0.02%29/Sep/05 22:13/graphics/fun/netbunnies/babyschmoo-Gadsby1.jpg
582 0.03%29/Sep/05 23:48/graphics/fun/netbunnies/SmellyPiglet2-Lam1.jpg
582 29/Sep/05 10:46/webmail/images/first-grey.gif
581 0.02%29/Sep/05 22:08/graphics/fun/netbunnies/kuro2-arai1.jpg
580 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/Feather-Pratt1.jpg
580 0.02%29/Sep/05 23:46/graphics/fun/netbunnies/Hera y demes-Maria1.jpg
579 0.05%29/Sep/05 23:10/graphics/fun/netbunnies/fifi-gray-lop-lying.jpg
579 0.01%29/Sep/05 21:24/graphics/easter/rabbit5.gif
579 0.01%29/Sep/05 20:11/graphics/fun/netbunnies/clooney-curtin1.jpg
577 0.02%29/Sep/05 20:53/graphics/fun/netbunnies/Cujo -marfell1.jpg
577 0.02%29/Sep/05 23:45/graphics/fun/netbunnies/Cinna-Bun4-cobb1.jpg
576 0.02%29/Sep/05 23:45/graphics/fun/netbunnies/DSC00008.jpg
575 0.02%29/Sep/05 23:57/graphics/fun/netbunnies/andrewsammy-prince1.jpg
575 0.04%29/Sep/05 21:11/graphics/fun/netbunnies/strawberry-white-baby.jpg
574 0.03%29/Sep/05 23:54/graphics/fun/netbunnies/Chuck-Goldsmith1.jpg
572 0.02%29/Sep/05 21:32/graphics/fun/netbunnies/beezle-cat.jpg
571 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/0203_triston.jpg
571 29/Sep/05 23:54/chapters/san-francisco/adoptables.gif
570 0.02%29/Sep/05 23:35/graphics/fun/netbunnies/wabbitthewefugee.jpg
569 0.01%30/Sep/05 00:00/graphics/fun/netbunnies/snowflake-Destiny1.jpg
568 0.01%25/Sep/05 18:43/rabbit-center/adoptables/images/penelope19tiny.jpg
568 29/Sep/05 10:46/webmail/images/last-grey.gif
567 0.02%30/Sep/05 00:00/graphics/fun/netbunnies/Demolition+Rabbit-Tandem1.jpg
566 0.01%29/Sep/05 23:45/journal/2-6/fear-into-play.html
566 0.03%29/Sep/05 23:47/graphics/fun/netbunnies/Penelope 2-Jones1.jpg
564 0.04%29/Sep/05 23:11/graphics/fun/netbunnies/Chippers-McConville1.jpg
564 0.03%29/Sep/05 23:50/graphics/fun/netbunnies/zzzsprite-vegetarian1.jpg
563 0.04%29/Sep/05 22:09/rabbit-center/hayward_rescue/hayward_graphics/Sweet_wht_bunny_2.jpg
561 0.01%29/Sep/05 20:21/graphics/fun/netbunnies/bertha-hogue1.jpg
561 0.03%29/Sep/05 23:09/chapters/san-diego/adoption/happy_adoptions.html
561 0.03%29/Sep/05 20:14/graphics/fun/netbunnies/saule-kat1.jpg
560 0.02%29/Sep/05 20:48/graphics/fun/netbunnies/ziggy-rebolj1.jpg
560 0.02%29/Sep/05 23:54/chapters/san-francisco/graphics/adoptables/megan.jpg
560 0.02%29/Sep/05 23:45/graphics/fun/netbunnies/Chauncy2-Pop1.jpg
559 0.01%30/Sep/05 00:05/adoption/easter.html
558 0.04%29/Sep/05 22:26/graphics/fun/netbunnies/Duke-Rowan1.jpg
558 0.01%29/Sep/05 20:45/graphics/fun/netbunnies/DSC00005.jpg
557 0.01%29/Sep/05 20:10/graphics/fun/netbunnies/a1.jpg
557 0.05%29/Sep/05 20:08/graphics/fun/netbunnies/aggie-hare-tortoise-hadawi.jpg
557 0.01%29/Sep/05 21:15/hrs-info/background.html
556 0.02%29/Sep/05 23:54/chapters/san-francisco/graphics/adoptables/dixie.jpg
555 0.01%29/Sep/05 23:57/graphics/fun/netbunnies/peach-herrington1.jpg
553 0.08%29/Sep/05 23:53/chapters/san-diego/adoption/graphics/Norm_BradyKids_10Nov01_1.JPG
552 0.03%28/Sep/05 17:02/rabbit-center/adoptables/images/FLop.jpg
552 0.07%29/Sep/05 23:53/chapters/san-diego/adoption/graphics/Gayon_Adoption.JPG
552 0.02%29/Sep/05 23:48/graphics/fun/netbunnies/Starbunny-Quatre1.jpg
552 0.01%29/Sep/05 23:46/graphics/fun/netbunnies/Flip.jpg
552 0.01%29/Sep/05 20:16/graphics/fun/netbunnies/cinnamon-Cathy1.jpg
551 0.01%29/Sep/05 22:21/journal/3-5/graphics/two-in-hole.gif
551 0.08%29/Sep/05 21:50/faq/faq.txt
550 0.06%29/Sep/05 22:19/graphics/fun/netbunnies/brown-rabbit-bricks.jpg
549 0.03%29/Sep/05 22:17/graphics/fun/netbunnies/Flopsy-Pielady1.jpg
549 0.03%29/Sep/05 21:32/graphics/fun/netbunnies/whitelopandtoilet.jpg
549 0.01%29/Sep/05 23:46/journal/1/amoxicillin-warning.html
549 0.01%29/Sep/05 23:54/chapters/san-francisco/graphics/adoptables/taylor1.jpg
548 0.02%29/Sep/05 23:54/chapters/san-francisco/graphics/adoptables/kelly_kyle.jpg
546 0.05%29/Sep/05 23:54/chapters/san-francisco/graphics/adoptables/SF_gino1.jpg
546 0.01%28/Sep/05 17:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Samantha_Nov04.jpg
545 0.02%29/Sep/05 23:54/chapters/san-francisco/graphics/adoptables/cindi.jpg
545 0.02%29/Sep/05 21:12/graphics/fun/netbunnies/GIZMO.jpg
544 0.02%29/Sep/05 23:54/chapters/san-francisco/graphics/adoptables/taylor2.jpg
544 0.03%29/Sep/05 20:36/graphics/fun/netbunnies/benjamin-donovan1.jpg
544 0.02%29/Sep/05 23:20/journal/3-10/graphics/rabbit-class.gif
544 0.04%29/Sep/05 18:23/graphics/fun/netbunnies/santarabbitandpresentkarasi.jpg
543 0.05%29/Sep/05 23:54/chapters/san-francisco/graphics/adoptables/SF_nicolas1.jpg
542 0.02%29/Sep/05 23:45/graphics/fun/netbunnies/Daisy5-Daniels1.jpg
542 0.01%29/Sep/05 20:56/graphics/fun/netbunnies/Cal2-727-1.jpg
542 0.04%29/Sep/05 23:55/graphics/fun/netbunnies/suki-gray-strectched-out.jpg
541 0.02%29/Sep/05 23:46/graphics/fun/netbunnies/DSC00002.jpg
541 0.02%29/Sep/05 23:42/graphics/fun/netbunnies/Bonbon-Kayleigh.JPG
540 0.01%29/Sep/05 23:51/chapters/san-francisco/
540 0.05%29/Sep/05 23:54/chapters/san-francisco/graphics/adoptables/SF_gino2.jpg
540 0.02%29/Sep/05 23:57/graphics/fun/netbunnies/Clive&Fletch-Kleback1.jpg
539 0.02%29/Sep/05 23:54/graphics/fun/netbunnies/Dcp67101.jpg
538 0.05%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_nicolas2.jpg
538 29/Sep/05 10:46/webmail/images/attach.gif
538 0.03%29/Sep/05 22:13/graphics/fun/netbunnies/NIJNTJE-Alewin1.jpg
537 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Nooman_2_Feb05.jpg
536 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/feb02/molly1.jpg
536 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Nooman_1_Feb05.jpg
535 0.02%29/Sep/05 23:10/graphics/fun/netbunnies/Mvc-017s.jpg
535 0.01%29/Sep/05 23:47/chapters/san-diego/health/vet-talk/coccidia.html
535 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Chloe_Chelsea_2_Feb05.jpg
534 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/feb02/molly2.jpg
533 0.01%29/Sep/05 19:27/graphics/fun/netbunnies/hugo-gruneberg1.jpg
533 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Chloe_Chelsea_1_Feb05.jpg
532 0.01%29/Sep/05 20:46/graphics/fun/netbunnies/Dggler2-Wilkinson1.jpg
531 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/Harley_Jan05.jpg
531 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/Chloe_Chelsea_1_Dec04.jpg
531 0.01%29/Sep/05 22:39/journal/3-11/scuts.html
531 0.01%29/Sep/05 20:18/graphics/fun/netbunnies/arcanist2-bun1.jpg
531 0.01%29/Sep/05 23:10/graphics/fun/netbunnies/funny.jpg
531 30/Sep/05 00:00/chapters/oakland/ystripes.gif
531 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Emily_1_FEb05.jpg
530 0.02%29/Sep/05 23:50/graphics/fun/netbunnies/zoidburg+leela-mellor1.jpg
529 0.04%30/Sep/05 00:01/graphics/fun/netbunnies/Dcp67099.jpg
529 0.07%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Mo_1_Mar04.JPG
529 29/Sep/05 23:45/graphics/postcard/postmarked-stamp.jpg
529 0.04%30/Sep/05 00:03/graphics/fun/netbunnies/frosty-santoro1.jpg
528 0.02%29/Sep/05 20:53/graphics/fun/netbunnies/Olivia-Trina1.jpg
528 0.07%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Mo_2_Mar04.JPG
528 0.04%29/Sep/05 23:34/graphics/fun/netbunnies/clover-smith1.jpg
528 0.01%28/Sep/05 18:20/rabbit-center/adoptables/graphics/thumb/hazel55tiny.jpg
527 0.01%28/Sep/05 15:41/rabbit-center/adoptables/graphics/thumb/adam r1432 32tiny.jpg
527 0.01%29/Sep/05 22:15/graphics/fun/netbunnies/Twins-Singleton1.jpg
526 0.04%29/Sep/05 23:59/graphics/fun/netbunnies/SweetyBunny-Taylor1.jpg
526 0.03%29/Sep/05 22:24/graphics/fun/netbunnies/paige-hester1.jpg
526 0.05%29/Sep/05 22:09/rabbit-center/hayward_rescue/hayward_graphics/whiterabbit.jpg
526 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Merry_Pippen_1_Dec04.jpg
526 0.02%29/Sep/05 23:46/graphics/fun/netbunnies/Hermione-Desjeunes1.jpg
526 0.02%29/Sep/05 23:46/graphics/fun/netbunnies/tumble2-idevans1.jpg
525 0.02%29/Sep/05 23:50/graphics/fun/netbunnies/zorro-hos1.jpg
524 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Merry_Pippen_2_Dec04.jpg
524 0.04%29/Sep/05 23:46/graphics/fun/netbunnies/Diggler-Wilkinson1.jpg
524 0.01%29/Sep/05 20:57/graphics/fun/netbunnies/serena-pan1.jpg
523 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Lucy-2_Feb05.jpg
523 0.01%29/Sep/05 20:14/graphics/fun/netbunnies/bobby-lomas1.jpg
523 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Higgins_1_Feb05.jpg
522 0.01%29/Sep/05 18:44/graphics/fun/netbunnies/wonton2-nadeau1.jpg
521 0.01%29/Sep/05 19:26/graphics/fun/netbunnies/gizmo-levesque1.jpg
521 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Albert_1_Feb05.jpg
521 0.01%29/Sep/05 22:28/graphics/fun/netbunnies/Spots.jpg
521 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Lucy_1_Feb05.jpg
521 0.01%29/Sep/05 23:24/graphics/fun/netbunnies/jasper-stein1.jpg
521 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/tumble-idevans1.jpg
520 0.01%29/Sep/05 23:56/graphics/fun/netbunnies/Snickers-Flanagan1.jpg
520 0.02%29/Sep/05 21:18/graphics/fun/netbunnies/PeterAmalthia-Batchelar1.jpg
520 0.09%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Maurice_1_Feb05.jpg
520 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Higgins_2_Feb05.jpg
519 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Albert_2_FEb05.jpg
518 0.05%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/11/AUT_3094.JPG
518 0.02%29/Sep/05 23:59/graphics/fun/netbunnies/Cj-mika1.jpg
518 0.02%29/Sep/05 20:55/graphics/fun/netbunnies/Rabbit1-Hogue1.jpg
518 0.01%29/Sep/05 22:13/graphics/fun/netbunnies/EasterBenny-Scollo1.jpg
517 0.06%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Maurice_2_Feb05.jpg
517 0.01%29/Sep/05 20:01/graphics/fun/netbunnies/snowball-gitter1.jpg
517 0.01%29/Sep/05 19:18/chapters/san-diego/health/sex.html
517 0.04%29/Sep/05 20:54/graphics/fun/netbunnies/white-baby-garden.jpg
517 0.01%28/Sep/05 18:20/rabbit-center/adoptables/graphics/thumb/basil46tiny.jpg
516 0.02%29/Sep/05 21:39/graphics/fun/netbunnies/arwyn-brighten1.jpg
515 0.01%29/Sep/05 17:32/graphics/fun/netbunnies/babygirl-buker1.jpg
515 0.03%29/Sep/05 21:04/graphics/fun/netbunnies/eezy1-none1.jpg
515 0.01%29/Sep/05 20:52/graphics/fun/netbunnies/MaartyLoose-Altitude1.jpg
515 0.05%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/11/AUT_3100.JPG
514 0.01%29/Sep/05 23:48/graphics/fun/netbunnies/Romeo-Mstnghthr1.jpg
513 0.02%29/Sep/05 19:09/graphics/fun/netbunnies/toby-penney1.jpg
513 0.01%28/Sep/05 16:03/rabbit-center/adoptables/graphics/thumb/eve r1433 21tiny.jpg
513 0.01%29/Sep/05 19:34/graphics/fun/netbunnies/dusty-sitsiuq1.jpg
513 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/EasterBennyScollo1.jpg
512 0.02%30/Sep/05 00:02/graphics/fun/netbunnies/beanbuff-iarrobino1.jpg
512 0.02%29/Sep/05 22:53/graphics/fun/netbunnies/zappa1-taylor1.jpg
511 30/Sep/05 00:00/chapters/oakland/bunnybak.gif
511 0.02%29/Sep/05 19:21/graphics/fun/netbunnies/hawaiibest-caulders1.jpg
511 0.01%30/Sep/05 00:01/graphics/fun/netbunnies/rabbit2-wlals1.jpg
510 0.01%29/Sep/05 23:35/graphics/fun/netbunnies/Georgariou.jpg
510 0.01%28/Sep/05 16:40/chapters/san-diego/adoption/Adoption_Photos/HRS_Ranger_4_20Oct04.JPG
510 0.01%29/Sep/05 21:39/graphics/fun/netbunnies/jack-clasby1.jpg
509 0.01%29/Sep/05 21:31/graphics/fun/netbunnies/coco-Whitehead1.jpg
509 0.01%29/Sep/05 21:02/adoption/finding-a-new-home.html
508 0.03%29/Sep/05 23:53/graphics/fun/netbunnies/HoneyBox-Melanson1.jpg
508 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/Aug02/SF_Milo_Corey_Jul02.JPG
508 0.01%29/Sep/05 23:47/chapters/san-diego/health/vet-talk/frontline.html
507 0.01%29/Sep/05 22:14/graphics/fun/netbunnies/Grey-Pratt1.jpg
506 0.01%29/Sep/05 23:54/graphics/fun/netbunnies/FoofSanta-Williford1.jpg
506 0.02%29/Sep/05 23:24/graphics/fun/netbunnies/Image05.jpg
506 0.02%29/Sep/05 23:51/graphics/fun/netbunnies/bentley-cunningham1.jpg
505 0.02%29/Sep/05 22:53/graphics/fun/netbunnies/Thumper-Goff1.jpg
505 0.03%29/Sep/05 20:07/graphics/fun/netbunnies/buddy-story1.jpg
505 0.02%29/Sep/05 23:35/graphics/fun/netbunnies/Dscf0005copia.jpg
504 0.03%30/Sep/05 00:00/graphics/fun/netbunnies/yoshi-strope1.jpg
504 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Corky_2_Feb05.jpg
503 0.02%29/Sep/05 20:48/graphics/fun/netbunnies/Gang.jpg
503 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/rex-hanson1.jpg
503 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Corky_1_Feb05.jpg
502 29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Sparky_1_Feb05.jpg
502 0.01%29/Sep/05 22:36/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Capodimonte_flower_basket.JPG
502 0.01%29/Sep/05 22:16/graphics/fun/netbunnies/bally-dellis1.jpg
501 0.02%29/Sep/05 23:46/graphics/fun/netbunnies/trin-fischer1.jpg
500 0.01%29/Sep/05 21:32/graphics/fun/netbunnies/Errol-su1.jpg
500 0.02%29/Sep/05 21:25/graphics/fun/netbunnies/turbo1-tam1.jpg
500 0.01%30/Sep/05 00:01/graphics/fun/netbunnies/r2-1-lin1.jpg
499 0.02%29/Sep/05 21:37/graphics/fun/netbunnies/FoobarNoofFriend-Yoshioka1.jpg
498 0.02%29/Sep/05 20:06/graphics/fun/netbunnies/moose-daus1.jpg
498 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/Hasi1.jpg
497 0.01%29/Sep/05 23:40/help/advanced-search.html
497 0.01%29/Sep/05 21:58/journal/1/kingdoms.html
496 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Bennet_2_Feb05.jpg
496 0.01%29/Sep/05 20:54/graphics/fun/netbunnies/Pl-sch10.jpg
495 0.02%29/Sep/05 22:28/graphics/fun/netbunnies/ambrosia-sagartz1.jpg
495 0.01%29/Sep/05 20:46/chapters/san-diego/health/graphics/morebadteeth.jpg
495 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Bennet_1_Feb05.jpg
495 0.02%29/Sep/05 20:58/graphics/fun/netbunnies/oatmeal-heather1.jpg
495 0.02%29/Sep/05 23:25/graphics/fun/netbunnies/bunny-bonniebee1.jpg
494 0.02%29/Sep/05 23:11/graphics/fun/netbunnies/haylee-imboden1.jpg
494 0.02%29/Sep/05 22:54/graphics/fun/netbunnies/rabbit-carpenter1.jpg
493 0.02%29/Sep/05 23:50/graphics/fun/netbunnies/zumi-peterson1.jpg
493 0.01%29/Sep/05 18:46/graphics/fun/netbunnies/flopser1-andiko1.jpg
492 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Amelia_2_Feb05.jpg
492 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Amelia_1_Feb05.jpg
492 0.02%29/Sep/05 23:56/graphics/fun/netbunnies/Relaxing.jpg
492 30/Sep/05 00:00/chapters/oakland/smevents.gif
491 0.02%29/Sep/05 23:47/graphics/fun/netbunnies/Penelope-colleen1.jpg
491 0.01%29/Sep/05 23:55/chapters/san-francisco/graphics/adoptables/SF_Chubby_Feb05.jpg
491 0.01%29/Sep/05 23:23/graphics/fun/netbunnies/baileybunny-Chaplin1.jpg
490 0.01%29/Sep/05 23:54/graphics/fun/netbunnies/Jewel-Pratt1.jpg
490 0.01%29/Sep/05 23:00/chapters/san-diego/aboutus/bunnyfest/bfest_photos/CCLaceyBeau55.jpg
490 0.02%29/Sep/05 23:24/graphics/fun/netbunnies/daisy5-schnellbach1.jpg
490 30/Sep/05 00:00/chapters/oakland/smadopt.gif
489 0.01%29/Sep/05 23:53/chapters/san-diego/adoption/Adoption_Photos/HRS_Molly_3_25Mar03.JPG
489 0.02%29/Sep/05 20:14/graphics/fun/netbunnies/hamilton-chercat1.jpg
489 30/Sep/05 00:00/chapters/oakland/smresour.gif
489 0.02%29/Sep/05 18:22/graphics/fun/netbunnies/benny-vanauken1.jpg
489 30/Sep/05 00:00/chapters/oakland/smarticl.gif
489 0.03%29/Sep/05 20:15/graphics/fun/netbunnies/bunny-sentient1.jpg
489 0.02%29/Sep/05 22:23/graphics/fun/netbunnies/daisy1-schnellbach1.jpg
489 30/Sep/05 00:00/chapters/oakland/smhall.gif
489 0.01%29/Sep/05 23:56/graphics/fun/netbunnies/jay-muncha1.jpg
489 0.01%29/Sep/05 23:00/chapters/san-diego/behavior/graphics/Toss_toys.JPG
489 0.03%29/Sep/05 22:54/graphics/fun/netbunnies/bunnies3-schroeder1.jpg
488 0.01%29/Sep/05 21:39/graphics/fun/netbunnies/dominoe-shannon1.jpg
488 0.01%29/Sep/05 23:47/graphics/fun/netbunnies/QueenPetricia.jpg
488 0.01%29/Sep/05 23:46/graphics/fun/netbunnies/Heaven-Sent.jpg
488 0.02%29/Sep/05 20:54/graphics/fun/netbunnies/baylee-copple1.jpg
488 0.02%29/Sep/05 22:18/graphics/fun/netbunnies/winnie-sugalski1.jpg
487 0.02%29/Sep/05 22:16/graphics/fun/netbunnies/bunny-roy1.jpg
486 0.01%29/Sep/05 23:53/chapters/san-diego/adoption/uh-oh.jpg
486 0.02%29/Sep/05 21:16/graphics/fun/netbunnies/FloydMisty.jpg
486 0.02%29/Sep/05 22:17/graphics/fun/netbunnies/floppy2-brandon1.jpg
486 29/Sep/05 22:23/graphics/fun/netbunnies/shatzie-vancott1.jpg
486 0.01%29/Sep/05 19:33/graphics/fun/netbunnies/bunny1-oneill1.jpg
486 0.02%29/Sep/05 23:56/graphics/fun/netbunnies/RosinaCarmello-Alexander1.jpg
485 0.01%29/Sep/05 20:51/graphics/fun/netbunnies/Lucek3-Anna1.jpg
485 0.01%29/Sep/05 23:42/graphics/fun/netbunnies/bubbles-ng1.jpg
485 0.01%29/Sep/05 23:24/graphics/fun/netbunnies/sleep.jpg
485 0.02%29/Sep/05 19:41/graphics/fun/netbunnies/chicha-gerald1.jpg
484 0.04%29/Sep/05 23:52/graphics/fun/netbunnies/snoopy-gurpz1.jpg
484 0.01%29/Sep/05 23:53/graphics/fun/netbunnies/tabitha2-leung1.jpg
484 0.01%29/Sep/05 23:57/graphics/fun/netbunnies/snoopy-yonezawa1.jpg
484 0.01%29/Sep/05 20:57/graphics/fun/netbunnies/Rabbits5.jpg
483 0.03%29/Sep/05 23:44/graphics/fun/netbunnies/yoki-elyn1.jpg
483 0.01%29/Sep/05 23:53/chapters/san-diego/adoption/graphics/Skye_sofa.jpg
483 0.03%30/Sep/05 00:02/graphics/fun/netbunnies/Zack-Gannon1.jpg
483 0.04%29/Sep/05 22:28/graphics/fun/netbunnies/dark-babies.jpg
482 0.01%29/Sep/05 23:58/graphics/fun/netbunnies/floppy-boleyn1.jpg
482 0.06%30/Sep/05 00:00/graphics/fun/netbunnies/brown-rabbit-bricks3.jpg
482 0.01%29/Sep/05 19:30/graphics/fun/netbunnies/matty+regina-freidel1.jpg
482 0.01%29/Sep/05 20:54/graphics/fun/netbunnies/REX-Griffin1.jpg
482 0.03%29/Sep/05 21:38/graphics/fun/netbunnies/Maggiechristmas-sandy1.jpg
482 0.01%29/Sep/05 23:11/graphics/fun/netbunnies/calista-tybor1.jpg
482 0.01%29/Sep/05 20:56/graphics/fun/netbunnies/bunnyday-bastian1.jpg
481 0.02%30/Sep/05 00:01/graphics/fun/netbunnies/lucy-rebecca1.jpg
481 0.02%29/Sep/05 22:14/graphics/fun/netbunnies/Lizzy13-Dale1.jpg
481 0.02%29/Sep/05 23:48/graphics/fun/netbunnies/Rabbit-Flanagan1.jpg
481 0.01%29/Sep/05 20:48/graphics/fun/netbunnies/Grace4-Delloli1.jpg
480 0.01%29/Sep/05 19:35/graphics/fun/netbunnies/willow-in-pool.jpg
480 0.01%29/Sep/05 22:46/graphics/fun/netbunnies/RyoOhki4-Burk1.jpg
480 0.08%29/Sep/05 23:53/chapters/san-diego/adoption/Adoption_Photos/Misty_Winter_happyadoption.jpg
480 0.01%29/Sep/05 20:00/graphics/fun/netbunnies/max3-hamilton1.jpg
478 0.02%29/Sep/05 20:50/graphics/fun/netbunnies/Izzy+Alley-habermehl1.jpg
478 0.02%29/Sep/05 20:21/graphics/fun/netbunnies/cinnamon-maddyx1.jpg
478 29/Sep/05 19:11/graphics/fun/netbunnies/r957cadbury50tiny.jpg
477 0.01%29/Sep/05 23:51/chapters/san-diego/diet/cecals.html
476 0.02%29/Sep/05 23:47/graphics/fun/netbunnies/Jamie+Bunny-lipscomb1.jpg
476 0.01%29/Sep/05 22:22/graphics/fun/netbunnies/waabooz1-erin1.jpg
476 0.01%29/Sep/05 21:37/graphics/fun/netbunnies/cumi +cheeky-lia1.jpg
476 0.02%29/Sep/05 20:53/graphics/fun/netbunnies/Foster-Edge1.jpg
475 0.02%29/Sep/05 23:43/graphics/fun/netbunnies/zippy-story1.jpg
475 0.01%29/Sep/05 21:56/journal/3-12/allergies.html
474 0.04%29/Sep/05 17:31/graphics/fun/netbunnies/wabbits-holden1.jpg
474 29/Sep/05 10:46/webmail/images/new.gif
474 0.01%29/Sep/05 20:19/graphics/fun/netbunnies/ozzy3-jodi1.jpg
474 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/LOVEBUNS-Coopers1.jpg
474 0.02%29/Sep/05 23:47/graphics/fun/netbunnies/Penelope-Jones1.jpg
474 0.03%29/Sep/05 23:47/graphics/fun/netbunnies/Lyla-Stairs1.jpg
473 0.02%29/Sep/05 23:32/graphics/fun/netbunnies/HelenPeeps-Jones1.jpg
473 0.02%29/Sep/05 23:53/chapters/san-diego/adoption/Adoption_Photos/Violet_adoption_4Aug02.JPG
473 30/Sep/05 00:00/chapters/oakland/smabout.gif
473 0.02%29/Sep/05 23:52/graphics/fun/netbunnies/hazel-raycroft1.jpg
473 0.02%29/Sep/05 23:56/graphics/fun/netbunnies/buns2-martinez1.jpg
473 0.02%29/Sep/05 21:37/graphics/fun/netbunnies/winston-phelan1.jpg
473 0.02%29/Sep/05 23:35/graphics/fun/netbunnies/spikebruiser1-hounsell1.jpg
472 0.01%29/Sep/05 23:57/graphics/fun/netbunnies/yuri-Lawson1.jpg
472 0.02%30/Sep/05 00:01/graphics/fun/netbunnies/wabbit2-luumi1.jpg
472 0.01%29/Sep/05 21:31/graphics/fun/netbunnies/little bob-odell1.jpg
471 0.01%29/Sep/05 23:43/graphics/fun/netbunnies/Bonbon.JPG
471 0.02%29/Sep/05 23:57/graphics/fun/netbunnies/foosasha-Miller1.jpg
471 0.09%29/Sep/05 23:00/chapters/san-diego/behavior/graphics/Corrugated_cord_cover.jpg
471 0.01%29/Sep/05 22:26/graphics/fun/netbunnies/hello.jpg
471 0.02%29/Sep/05 23:01/graphics/fun/netbunnies/buns-morgan1.jpg
471 0.01%29/Sep/05 21:32/graphics/fun/netbunnies/bengong.jpg
471 0.01%29/Sep/05 21:11/graphics/fun/netbunnies/peanutpeaches-potuzak1.jpg
471 0.02%29/Sep/05 23:55/graphics/fun/netbunnies/garry-2-casteneda1.jpg
470 0.01%29/Sep/05 20:17/graphics/fun/netbunnies/lilieozzycharity-lilbit1.jpg
470 0.01%29/Sep/05 21:00/graphics/fun/netbunnies/baby-sweetpea.jpg
470 0.03%29/Sep/05 21:39/graphics/fun/netbunnies/Snuggypants-Yoder1.jpg
470 0.01%29/Sep/05 22:13/graphics/fun/netbunnies/dandylion1-jessica1.jpg
470 0.04%30/Sep/05 00:02/graphics/fun/netbunnies/Sammioutondecknorth.jpg
469 0.02%29/Sep/05 21:05/graphics/fun/netbunnies/eeyore-guinn1.jpg
469 0.02%29/Sep/05 20:15/graphics/fun/netbunnies/ziggy-hansberry1.jpg
469 0.02%29/Sep/05 23:23/graphics/fun/netbunnies/Loli1-lo1.jpg
469 0.01%29/Sep/05 20:14/graphics/fun/netbunnies/kits-rowan1.jpg
469 0.03%29/Sep/05 20:59/graphics/fun/netbunnies/bunnies-borealis1.jpg
468 0.02%29/Sep/05 20:16/graphics/fun/netbunnies/miska-funcic1.jpg
468 0.03%29/Sep/05 19:21/graphics/fun/netbunnies/bucky-schaffer1.jpg
468 0.02%29/Sep/05 22:12/graphics/fun/netbunnies/cashew-qtip-ona1.jpg
468 0.02%29/Sep/05 22:19/graphics/fun/netbunnies/akira-king.jpg
467 0.01%29/Sep/05 19:34/graphics/fun/netbunnies/smokey-donovan1.jpg
467 0.02%29/Sep/05 21:38/graphics/fun/netbunnies/lulu2-giordano1.jpg
466 0.01%29/Sep/05 22:59/graphics/fun/netbunnies/ziggy2-Rebolj1.jpg
466 0.02%29/Sep/05 23:45/graphics/fun/netbunnies/tywla-lummels1.jpg
466 0.01%29/Sep/05 18:41/graphics/fun/netbunnies/annie.jpg
466 0.01%29/Sep/05 20:07/graphics/fun/netbunnies/jaz1-fraleigh1.jpg
466 0.02%29/Sep/05 18:22/graphics/fun/netbunnies/trevor+others-kiviat1.jpg
466 0.02%29/Sep/05 23:49/graphics/fun/netbunnies/WhoMe.jpg
465 0.01%29/Sep/05 23:40/graphics/fun/netbunnies/piglet-philipson1.jpg
465 0.01%29/Sep/05 21:09/graphics/fun/netbunnies/baby1-jarrett1.jpg
465 0.01%30/Sep/05 00:04/journal/3-10/pain.html
465 0.01%29/Sep/05 21:47/graphics/fun/netbunnies/buddies-broley1.jpg
465 0.01%29/Sep/05 20:13/graphics/fun/netbunnies/bunny-brown1.jpg
465 0.03%29/Sep/05 23:49/graphics/fun/netbunnies/Violets-cooke1.jpg
465 0.02%29/Sep/05 20:59/graphics/fun/netbunnies/Toffee-Batchelar1.jpg
465 0.02%29/Sep/05 23:11/graphics/fun/netbunnies/steve1-mundy1.jpg
465 0.01%29/Sep/05 23:10/graphics/fun/netbunnies/fibby2-orozco1.jpg
465 0.01%29/Sep/05 23:53/chapters/san-diego/adoption/Adoption_Photos/Mia_Jack_adoption_2_29Sept02.JPG
464 29/Sep/05 23:40/hrs-info/donation.html
464 0.01%29/Sep/05 23:00/chapters/san-diego/behavior/graphics/bunnyproofing_supplies.JPG
464 0.02%29/Sep/05 20:06/graphics/fun/netbunnies/daisy-davis1.jpg
464 0.02%29/Sep/05 22:25/graphics/fun/netbunnies/adorable-kwan1.jpg
463 0.02%29/Sep/05 21:34/graphics/fun/netbunnies/Royalty-Ttandem1.jpg
463 0.02%29/Sep/05 22:21/graphics/fun/netbunnies/Mel-cook1.jpg
463 0.01%29/Sep/05 21:40/chapters/san-diego/behavior/litter_train.html
463 0.01%29/Sep/05 18:58/graphics/fun/netbunnies/george-Ivy1.jpg
463 0.01%29/Sep/05 20:13/graphics/fun/netbunnies/bunny-gonzalez1.jpg
463 0.03%29/Sep/05 22:09/rabbit-center/hayward_rescue/hayward_graphics/hayward_bunnies_2.jpg
463 0.02%29/Sep/05 20:21/graphics/fun/netbunnies/ailey _work1.jpg
463 0.02%29/Sep/05 23:01/graphics/fun/netbunnies/babies-Kramer1.jpg
463 0.01%30/Sep/05 00:01/graphics/fun/netbunnies/att2-hotstuff1.jpg
463 0.02%29/Sep/05 23:01/graphics/fun/netbunnies/kiwi-weigert1.jpg
462 0.02%29/Sep/05 20:48/graphics/fun/netbunnies/GingerKiss-McConville1.jpg
462 0.01%29/Sep/05 18:52/graphics/fun/netbunnies/bloop-rockel1.jpg
462 0.02%29/Sep/05 20:16/graphics/fun/netbunnies/bentley1-butler1.jpg
462 0.01%29/Sep/05 22:58/graphics/fun/netbunnies/lucky-davis1.jpg
461 0.02%29/Sep/05 20:50/graphics/fun/netbunnies/Jacob2-Sullivan1.jpg
461 0.01%29/Sep/05 22:10/faq/sections/loss.html
461 0.02%30/Sep/05 00:01/graphics/fun/netbunnies/speckles+yoshi-strope1.jpg
461 0.01%29/Sep/05 18:33/rabbit-center/adoptables/graphics/big/luke3-r1396-47sml.jpg
461 0.01%29/Sep/05 19:15/graphics/fun/netbunnies/bunnies1-doerfler1.jpg
461 0.03%29/Sep/05 23:58/graphics/fun/netbunnies/PeterBowl-Melanson1.jpg
461 0.02%29/Sep/05 20:19/graphics/fun/netbunnies/poppy-howard1.jpg
461 0.02%29/Sep/05 22:54/graphics/fun/netbunnies/ShelbySnickers-Watson1.jpg
460 0.01%29/Sep/05 17:37/graphics/fun/netbunnies/gilligan-douglas1.jpg
460 0.01%29/Sep/05 23:48/graphics/fun/netbunnies/Sgt72-Jenney1.jpg
460 0.01%29/Sep/05 22:42/chapters/san-diego/aboutus/
460 29/Sep/05 23:40/cgi-bin/email-article.cgi
459 0.01%29/Sep/05 20:08/graphics/fun/netbunnies/blaze5-heldt1.jpg
459 0.01%30/Sep/05 00:04/chapters/san-diego/behavior/rabbit_digs.html
459 30/Sep/05 00:02/graphics/fun/netbunnies/fidge-n-fuzz.jpg
459 0.01%29/Sep/05 18:41/graphics/fun/netbunnies/hoppy-wood1.jpg
458 0.01%29/Sep/05 23:00/chapters/san-diego/behavior/graphics/Cord_keeper.JPG
458 0.02%29/Sep/05 22:54/graphics/fun/netbunnies/Tiara-Trina1.jpg
458 0.01%29/Sep/05 20:57/graphics/fun/netbunnies/Jake-Danner1.jpg
458 0.01%29/Sep/05 20:11/graphics/fun/netbunnies/trudy-cat1.jpg
458 0.02%29/Sep/05 22:16/graphics/fun/netbunnies/bunny-zietlow1.jpg
458 0.02%29/Sep/05 21:32/graphics/fun/netbunnies/billy2-sharwell1.jpg
458 0.01%29/Sep/05 20:51/graphics/fun/netbunnies/Lau1.jpg
458 0.02%29/Sep/05 20:59/graphics/fun/netbunnies/Tim-Oathay1.jpg
458 0.02%29/Sep/05 21:14/graphics/fun/netbunnies/marzncopper-ng1.jpg
457 0.01%29/Sep/05 20:20/graphics/fun/netbunnies/dixon-davis1.jpg
457 0.01%29/Sep/05 23:00/graphics/fun/netbunnies/rabbit-rackley1.jpg
457 0.01%29/Sep/05 20:57/graphics/fun/netbunnies/Snoopy3.jpg
457 0.01%29/Sep/05 19:09/graphics/fun/netbunnies/milo-magyar1.jpg
457 0.07%29/Sep/05 21:38/graphics/fun/netbunnies/fuzzy-lop-outside-lowe.jpg
456 0.02%29/Sep/05 23:54/graphics/fun/netbunnies/badbadbunny-Intelligoth1.jpg
456 0.02%29/Sep/05 23:57/graphics/fun/netbunnies/amos-martin1.jpg
456 0.02%29/Sep/05 20:17/graphics/fun/netbunnies/chubbs-daisy2-esquivel1.jpg
456 0.03%29/Sep/05 22:12/graphics/fun/netbunnies/lily1-rice1.jpg
456 0.01%29/Sep/05 23:24/graphics/fun/netbunnies/pintobow.jpg
455 0.02%29/Sep/05 22:12/graphics/fun/netbunnies/babybunny-doe1.jpg
455 0.01%29/Sep/05 23:11/graphics/fun/netbunnies/Myrabbit.jpg
455 0.01%29/Sep/05 19:56/graphics/fun/netbunnies/darcy-benson1.jpg
455 0.01%29/Sep/05 23:00/chapters/san-diego/behavior/graphics/Cord_clips.JPG
454 0.01%29/Sep/05 23:49/graphics/fun/netbunnies/Ted3.jpg
454 0.01%29/Sep/05 21:31/graphics/fun/netbunnies/jojo-Georgiev1.jpg
454 0.01%29/Sep/05 23:48/graphics/fun/netbunnies/Snickers-Watson1.jpg
454 0.01%29/Sep/05 22:12/graphics/fun/netbunnies/buttons1-martin1.jpg
454 0.02%29/Sep/05 20:06/graphics/fun/netbunnies/rabbits1-siaca1.jpg
454 0.01%29/Sep/05 21:13/graphics/fun/netbunnies/roozelda1-gannon1.jpg
453 0.01%29/Sep/05 22:23/graphics/fun/netbunnies/edith-Jurasinski1.jpg
453 0.01%29/Sep/05 22:53/graphics/fun/netbunnies/barnie3-lee1.jpg
453 0.01%29/Sep/05 23:09/graphics/fun/netbunnies/hobo1-candelmo1.jpg
453 0.01%29/Sep/05 20:58/graphics/fun/netbunnies/Lau3.jpg
453 0.01%29/Sep/05 20:50/graphics/fun/netbunnies/Kissin-Altitude1.jpg
453 0.01%29/Sep/05 23:24/graphics/fun/netbunnies/spencer-collins1.jpg
453 0.01%29/Sep/05 20:18/graphics/fun/netbunnies/prof-tammy1.jpg
452 0.02%29/Sep/05 23:31/graphics/fun/netbunnies/chip2-smith1.jpg
452 0.03%29/Sep/05 23:58/graphics/fun/netbunnies/Hughston-Jellison1.jpg
452 0.01%29/Sep/05 20:56/graphics/fun/netbunnies/Shadow.jpg
452 0.01%29/Sep/05 23:00/chapters/san-diego/behavior/graphics/Lamp_cord.JPG
452 0.01%30/Sep/05 00:03/graphics/fun/netbunnies/catbunny.jpg
452 0.01%29/Sep/05 22:53/graphics/fun/netbunnies/MAP0000.jpg
452 0.02%29/Sep/05 21:12/graphics/fun/netbunnies/wiggles-giles1.jpg
451 0.01%29/Sep/05 23:27/graphics/fun/netbunnies/Hasi2.jpg
451 0.01%30/Sep/05 00:00/graphics/fun/netbunnies/Pumpkin-Longview1.jpg
451 0.02%29/Sep/05 21:17/graphics/fun/netbunnies/barney-bunny2.jpg
451 0.02%29/Sep/05 23:11/graphics/fun/netbunnies/smidgen-morris1.jpg
450 0.01%29/Sep/05 23:00/graphics/fun/netbunnies/dande1-smigo1.jpg
450 0.02%29/Sep/05 20:55/graphics/fun/netbunnies/Rabbit1-Matson1.jpg
450 0.02%30/Sep/05 00:00/graphics/fun/netbunnies/furball3-lim1.jpg
450 0.02%29/Sep/05 22:54/graphics/fun/netbunnies/bailey2-smith1.jpg
450 0.02%29/Sep/05 19:09/graphics/fun/netbunnies/zippy-williams1.jpg
450 0.02%29/Sep/05 23:54/graphics/fun/netbunnies/fuzzy-ko1.jpg
450 0.01%29/Sep/05 23:47/graphics/fun/netbunnies/KUSTI1-Saisa1.jpg
450 0.01%29/Sep/05 21:53/journal/4-3/gizmo.html
450 0.02%29/Sep/05 22:27/graphics/fun/netbunnies/toby3-penney1.jpg
449 0.02%29/Sep/05 19:26/graphics/fun/netbunnies/chester-amylase1.jpg
449 0.03%29/Sep/05 23:47/graphics/fun/netbunnies/Mr. b-Barnette1.jpg
449 0.01%29/Sep/05 23:57/graphics/fun/netbunnies/molly-caulders1.jpg
449 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/dewfie-Ho1.jpg
448 0.01%29/Sep/05 22:13/graphics/fun/netbunnies/S001i001.jpg
448 0.01%29/Sep/05 23:10/graphics/fun/netbunnies/janchair2-marturano1.jpg
448 0.01%29/Sep/05 23:48/graphics/fun/netbunnies/StrepPeanutButter.jpg
448 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/littlebunbook.jpg
448 0.02%29/Sep/05 22:12/graphics/fun/netbunnies/SpotChance-Chanspan1.jpg
448 0.01%29/Sep/05 20:17/graphics/fun/netbunnies/babybunnies3-Phillips1.jpg
448 0.01%29/Sep/05 20:50/graphics/fun/netbunnies/KOOS-Alewin1.jpg
448 0.01%29/Sep/05 20:59/graphics/fun/netbunnies/dusty-castro1.jpg
447 0.02%29/Sep/05 20:11/graphics/fun/netbunnies/clover-conley1.jpg
447 0.01%29/Sep/05 20:51/graphics/fun/netbunnies/Leinie-Chloe2.jpg
447 0.01%29/Sep/05 23:35/graphics/fun/netbunnies/KlemmyInTheBag.jpg
447 0.02%29/Sep/05 19:33/graphics/fun/netbunnies/esmeralda-langseth1.jpg
447 0.03%29/Sep/05 19:11/graphics/fun/netbunnies/bunny20-Kaldal1.jpg
447 0.01%29/Sep/05 23:50/graphics/fun/netbunnies/thumper-prince1.jpg
447 0.01%29/Sep/05 23:00/chapters/san-diego/behavior/graphics/Corner_guards.jpg
446 0.01%29/Sep/05 22:53/graphics/fun/netbunnies/xpp3-huang1.jpg
446 0.01%29/Sep/05 21:32/graphics/fun/netbunnies/kaopectate-dales1.jpg
446 0.02%29/Sep/05 23:49/graphics/fun/netbunnies/amigos1-butcher1.jpg
446 0.02%29/Sep/05 20:15/graphics/fun/netbunnies/usagi-king1.jpg
446 0.01%29/Sep/05 22:16/graphics/fun/netbunnies/willow3-coder1.jpg
446 0.06%29/Sep/05 23:00/chapters/san-diego/behavior/graphics/Bitter_preparations.JPG
445 0.02%29/Sep/05 23:33/graphics/fun/netbunnies/willie-martin1.jpg
445 0.02%29/Sep/05 23:51/graphics/fun/netbunnies/SmellyPiglet-Lam1.jpg
445 0.01%29/Sep/05 23:47/graphics/fun/netbunnies/Pepper+jack-sean1.jpg
445 0.02%29/Sep/05 22:14/graphics/fun/netbunnies/miles-grubin1.jpg
445 0.02%29/Sep/05 22:17/graphics/fun/netbunnies/jb+ollie3-ozab1.jpg
445 0.02%29/Sep/05 20:57/graphics/fun/netbunnies/Silver-Hiler1.jpg
444 0.01%29/Sep/05 23:56/graphics/fun/netbunnies/tofu-kessler1.jpg
444 0.01%29/Sep/05 21:12/graphics/fun/netbunnies/basil1.jpg
444 0.05%29/Sep/05 20:18/graphics/fun/netbunnies/adrian-sifuentes1.jpg
444 0.01%29/Sep/05 22:59/graphics/fun/netbunnies/Kobe-Sumner1.jpg
443 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/Smokey-Rogers1.jpg
443 0.02%29/Sep/05 23:59/graphics/fun/netbunnies/annabelle-seitz1.jpg
443 0.01%29/Sep/05 23:00/chapters/san-diego/behavior/graphics/mats.jpg
443 0.02%29/Sep/05 20:21/graphics/fun/netbunnies/rabbit-nunes1.jpg
443 0.02%29/Sep/05 18:59/graphics/fun/netbunnies/coolrabbit.jpg
443 0.02%29/Sep/05 23:10/graphics/fun/netbunnies/peppermint-Walzer1.jpg
443 0.01%29/Sep/05 22:59/graphics/fun/netbunnies/olycloseup-melin1.jpg
443 0.01%29/Sep/05 23:47/faq/sections/disabled.html
442 0.02%29/Sep/05 20:53/graphics/fun/netbunnies/Pals-cooke1.jpg
442 0.02%29/Sep/05 21:38/graphics/fun/netbunnies/bun2-needler1.jpg
442 0.01%29/Sep/05 20:55/graphics/fun/netbunnies/bunny1-ramirez1.jpg
442 0.01%29/Sep/05 23:00/chapters/san-diego/behavior/graphics/Entertainment_center1.JPG
441 0.02%29/Sep/05 23:31/graphics/fun/netbunnies/daisy2-schnellbach1.jpg
441 0.01%29/Sep/05 23:00/chapters/san-diego/behavior/graphics/Chair_protection1.JPG
441 0.01%29/Sep/05 20:53/graphics/fun/netbunnies/Mvc-007f.jpg
441 0.02%29/Sep/05 23:56/graphics/fun/netbunnies/Siu-Choi1.jpg
441 0.01%29/Sep/05 23:00/chapters/san-diego/behavior/graphics/Chair_protection2.JPG
441 0.01%29/Sep/05 21:27/graphics/fun/netbunnies/a2.jpg
441 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/maggie-underwood1.jpg
441 0.01%29/Sep/05 23:29/graphics/fun/netbunnies/george-orell1.jpg
441 0.01%29/Sep/05 23:20/faq/sections/travel.html
440 0.01%29/Sep/05 23:42/graphics/fun/netbunnies/willow4-stardancer1.jpg
440 0.02%29/Sep/05 20:57/graphics/fun/netbunnies/RabbitsGarten-Henkel1.jpg
440 0.01%29/Sep/05 23:53/graphics/fun/netbunnies/taco-needler1.jpg
440 0.01%29/Sep/05 20:17/graphics/fun/netbunnies/babybunny-Shinelun1.jpg
440 0.01%29/Sep/05 23:50/graphics/fun/netbunnies/thumper-miller1.jpg
440 0.01%29/Sep/05 21:07/chapters/san-diego/adoption/new_zealands.html
439 0.02%29/Sep/05 23:09/graphics/fun/netbunnies/chang-dixon1.jpg
439 0.02%29/Sep/05 20:14/graphics/fun/netbunnies/arthur-lees1.jpg
439 0.02%29/Sep/05 22:21/graphics/fun/netbunnies/bunnies2-doerfler1.jpg
438 0.01%29/Sep/05 23:31/graphics/fun/netbunnies/bugzie3-ashby1.jpg
437 0.01%29/Sep/05 19:36/graphics/fun/netbunnies/hsbox-thomas1.jpg
437 0.01%29/Sep/05 18:43/graphics/fun/netbunnies/babies-chickermane1.jpg
437 0.02%29/Sep/05 20:59/graphics/fun/netbunnies/Thumper2-Hoffman1.jpg
437 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/myranda rose-odell1.jpg
437 0.01%29/Sep/05 20:54/chapters/san-diego/adoption/indoors.html
437 0.01%29/Sep/05 20:16/graphics/fun/netbunnies/fluffy-Wong1.jpg
437 0.01%29/Sep/05 17:21/chapters/san-diego/health/molting.html
437 0.01%29/Sep/05 22:59/graphics/fun/netbunnies/cadbury-budesa1.jpg
437 0.01%29/Sep/05 21:10/graphics/fun/netbunnies/bunnybutts2-spence1.jpg
437 0.01%29/Sep/05 22:15/graphics/fun/netbunnies/bunnies-stradeski1.jpg
437 0.01%29/Sep/05 20:17/graphics/fun/netbunnies/floppy-isabelle1.jpg
436 0.02%29/Sep/05 23:23/graphics/fun/netbunnies/schmoofriend-Gadsby1.jpg
436 0.01%29/Sep/05 20:56/graphics/fun/netbunnies/higgins-Dwyer1.jpg
436 0.01%29/Sep/05 21:57/graphics/fun/netbunnies/Scooter.jpg
436 0.01%29/Sep/05 21:25/journal/3-7/stray.html
436 0.01%29/Sep/05 20:56/graphics/fun/netbunnies/RyoOhki2-Burk1.jpg
436 0.01%29/Sep/05 20:55/graphics/fun/netbunnies/chashuroar-tani1.jpg
436 0.02%29/Sep/05 23:00/chapters/san-diego/behavior/graphics/Choices.JPG
435 0.05%29/Sep/05 20:19/graphics/fun/netbunnies/minnie-doe-3yr-outside.jpg
435 0.02%29/Sep/05 23:55/graphics/fun/netbunnies/auntdot-peterson1.jpg
435 0.02%29/Sep/05 23:00/chapters/san-diego/behavior/graphics/chew_toys.JPG
435 0.02%29/Sep/05 20:55/graphics/fun/netbunnies/puppy-brian1.jpg
435 0.01%29/Sep/05 19:28/journal/2-5/mr-b.html
435 0.02%29/Sep/05 21:43/journal/4-7/hay.html
435 0.01%29/Sep/05 20:56/graphics/fun/netbunnies/Sackedout.jpg
435 0.01%29/Sep/05 23:43/journal/3-12/litter-training-revisited.html
435 0.01%29/Sep/05 20:58/graphics/fun/netbunnies/Spot2-JackB1.jpg
434 0.01%29/Sep/05 22:24/graphics/fun/netbunnies/asher-underwood1.jpg
434 0.01%29/Sep/05 20:55/graphics/fun/netbunnies/Rascal-Ryska1.jpg
434 29/Sep/05 23:19/rabbit-center/updates/svhs/images/mm_arrow.gif
434 0.01%29/Sep/05 20:13/graphics/fun/netbunnies/baxter.jpg
434 0.02%29/Sep/05 20:58/graphics/fun/netbunnies/Sweet2-RustyBux1.jpg
434 0.02%29/Sep/05 22:54/graphics/fun/netbunnies/starsky-carrington1.jpg
434 0.01%30/Sep/05 00:00/graphics/fun/netbunnies/bunbun-whoknows1.jpg
434 0.02%29/Sep/05 23:00/graphics/fun/netbunnies/hazel-digicult1.jpg
434 0.01%30/Sep/05 00:00/graphics/fun/netbunnies/birdie-Saisa1.jpg
434 0.01%29/Sep/05 20:15/graphics/fun/netbunnies/cookie-mazurek1.jpg
434 0.02%29/Sep/05 22:53/graphics/fun/netbunnies/misha-tarling1.jpg
433 0.01%29/Sep/05 23:55/graphics/fun/netbunnies/bunny-karra1.jpg
433 0.01%29/Sep/05 23:24/graphics/fun/netbunnies/SuzyBetty-Harris1.jpg
433 0.01%29/Sep/05 20:10/graphics/fun/netbunnies/emma1-robinson1.jpg
433 0.01%29/Sep/05 19:43/graphics/fun/netbunnies/nicklovesannie-kyrene1.jpg
433 0.02%29/Sep/05 20:51/graphics/fun/netbunnies/Lacey-Pierce1.jpg
433 0.02%29/Sep/05 23:56/graphics/fun/netbunnies/hiphop-fischer1.jpg
433 0.02%29/Sep/05 23:34/graphics/fun/netbunnies/abbott-myers1.jpg
433 29/Sep/05 23:21/rabbit-center/retail/bunnyR.gif
433 29/Sep/05 23:00/chapters/san-diego/behavior/graphics/haytube.JPG
433 0.01%29/Sep/05 23:51/graphics/fun/netbunnies/biscuit.jpg
432 0.02%30/Sep/05 00:02/graphics/fun/netbunnies/babyandjangles2.jpg
432 0.01%29/Sep/05 22:16/graphics/fun/netbunnies/Mvc-012s.jpg
432 0.02%29/Sep/05 23:58/graphics/fun/netbunnies/bunny3-Blair1.jpg
432 0.02%29/Sep/05 18:44/graphics/fun/netbunnies/max1-hanna1.jpg
432 0.02%29/Sep/05 20:57/graphics/fun/netbunnies/yogi2-mondragon1.jpg
432 0.02%29/Sep/05 23:44/graphics/fun/netbunnies/winston-turner1.jpg
432 0.02%29/Sep/05 20:10/graphics/fun/netbunnies/scoobydoo-wilkinson1.jpg
432 0.03%29/Sep/05 21:32/graphics/fun/netbunnies/daughters-brewster1.jpg
432 0.03%29/Sep/05 20:58/graphics/fun/netbunnies/whats-up.jpg
432 0.01%29/Sep/05 20:54/graphics/fun/netbunnies/Precious.jpg
432 0.03%29/Sep/05 23:48/graphics/fun/netbunnies/Stndprty-RustyBux1.jpg
431 0.01%29/Sep/05 20:15/graphics/fun/netbunnies/alfie1-finn1.jpg
431 0.01%29/Sep/05 23:59/graphics/fun/netbunnies/p_mlou.jpg
431 0.01%29/Sep/05 23:57/graphics/fun/netbunnies/Todd2-Lonergan1.jpg
431 0.01%29/Sep/05 20:13/graphics/fun/netbunnies/joey1-cook1.jpg
431 0.02%29/Sep/05 19:35/graphics/fun/netbunnies/bun-barnett1.jpg
431 0.02%29/Sep/05 22:18/graphics/fun/netbunnies/patch_backturn-berthereau1.jpg
431 0.03%29/Sep/05 21:39/graphics/fun/netbunnies/cinderella-spotty1.jpg
431 0.02%30/Sep/05 00:02/graphics/fun/netbunnies/chocolate-ko1.jpg
431 0.01%29/Sep/05 23:00/chapters/san-diego/behavior/graphics/Basket_toys.JPG
431 0.01%29/Sep/05 22:26/graphics/fun/netbunnies/baxtersmall1.jpg
430 0.01%29/Sep/05 22:15/graphics/fun/netbunnies/rusty-forsythe1.jpg
430 0.02%29/Sep/05 20:12/graphics/fun/netbunnies/Willow-sandy1.jpg
430 0.01%29/Sep/05 22:45/graphics/fun/netbunnies/skywalker-wachowiak1.jpg
430 0.02%29/Sep/05 20:17/graphics/fun/netbunnies/bones-Chuck1.jpg
430 29/Sep/05 23:21/rabbit-center/retail/bunnyL.gif
430 0.03%29/Sep/05 22:15/graphics/fun/netbunnies/TrixieGourmet-Oathay1.jpg
430 0.01%29/Sep/05 22:13/graphics/fun/netbunnies/amelia-mel-shay1.jpg
429 0.01%29/Sep/05 23:35/graphics/fun/netbunnies/rocco-boland1.jpg
429 0.02%29/Sep/05 23:09/graphics/fun/netbunnies/chompy+zebedee-thompson1.jpg
429 0.01%29/Sep/05 20:11/graphics/fun/netbunnies/bunny2-suarez1.jpg
429 0.02%29/Sep/05 20:06/graphics/fun/netbunnies/whiterabbitbymirrorlasko.jpg
429 0.01%29/Sep/05 22:12/graphics/fun/netbunnies/harvey-Elliott1.jpg
429 0.01%29/Sep/05 19:40/graphics/fun/netbunnies/bambi-winter1.jpg
429 0.01%29/Sep/05 22:21/graphics/fun/netbunnies/mattboo-Carlson1.jpg
429 0.01%29/Sep/05 21:03/graphics/fun/netbunnies/jack-mixich1.jpg
428 0.03%29/Sep/05 20:15/graphics/fun/netbunnies/bew-asa1.jpg
428 0.02%29/Sep/05 20:19/graphics/fun/netbunnies/nibbler-jia1.jpg
428 0.01%29/Sep/05 21:09/graphics/fun/netbunnies/toto-siu1.jpg
428 0.02%29/Sep/05 21:54/graphics/fun/netbunnies/leo+gisele2-peach1.jpg
428 0.01%30/Sep/05 00:00/graphics/fun/netbunnies/layla-tori-oster1.jpg
428 0.02%29/Sep/05 19:40/graphics/fun/netbunnies/bunny7-stasinos1.jpg
428 0.05%29/Sep/05 23:09/chapters/san-diego/adoption/Adoption_Photos/Sable_adoption.jpg
428 0.02%29/Sep/05 22:53/graphics/fun/netbunnies/sandman2-wagner1.jpg
427 0.01%29/Sep/05 23:10/graphics/fun/netbunnies/bunny-yee1.jpg
427 0.03%29/Sep/05 23:11/graphics/fun/netbunnies/black-marks-rabbit-gray-lop.jpg
427 0.02%29/Sep/05 23:32/graphics/fun/netbunnies/fuzzy2-ko1.jpg
427 0.01%29/Sep/05 20:07/graphics/fun/netbunnies/abby1.jpg
427 0.01%29/Sep/05 22:53/graphics/fun/netbunnies/baxtersmall2.jpg
427 0.02%29/Sep/05 22:46/graphics/fun/netbunnies/cherrios-miller1.jpg
427 0.01%29/Sep/05 22:23/graphics/fun/netbunnies/P1010005.jpg
427 0.02%29/Sep/05 22:18/graphics/fun/netbunnies/ralph_lunn1.jpg
427 0.01%29/Sep/05 23:38/journal/3-1/learning-to-love-again.html
427 0.01%29/Sep/05 23:57/graphics/fun/netbunnies/nibblet2-ward1.jpg
427 0.01%29/Sep/05 20:11/graphics/fun/netbunnies/sammie+tigger-choy1.jpg
427 0.01%29/Sep/05 22:15/graphics/fun/netbunnies/munchkin-singer1.jpg
427 0.02%29/Sep/05 23:00/chapters/san-diego/behavior/graphics/mischief.jpg
427 0.01%29/Sep/05 23:25/graphics/fun/netbunnies/arbutus.jpg
427 0.02%29/Sep/05 21:27/graphics/fun/netbunnies/winnie-curtin1.jpg
427 0.02%29/Sep/05 22:24/graphics/fun/netbunnies/frodo-oberley1.jpg
426 0.02%29/Sep/05 21:39/graphics/fun/netbunnies/poppy1-hawes1.jpg
426 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/bunbun-young1.jpg
426 0.02%30/Sep/05 00:00/graphics/fun/netbunnies/floppy-small1.jpg
426 0.02%29/Sep/05 20:55/graphics/fun/netbunnies/Rocket1-christina1.jpg
426 0.02%29/Sep/05 23:54/graphics/fun/netbunnies/superbunny-hiebert1.jpg
426 0.01%29/Sep/05 22:11/graphics/fun/netbunnies/aberelagrupp-asa1.jpg
426 0.03%29/Sep/05 21:12/graphics/fun/netbunnies/betabrownrabbitbybookcase.jpg
426 0.01%30/Sep/05 00:03/graphics/fun/netbunnies/angus-before-a-shave.jpg
426 0.01%29/Sep/05 22:16/graphics/fun/netbunnies/trudyposa-pierguiseppe1.jpg
425 0.01%29/Sep/05 21:16/graphics/fun/netbunnies/oatmeal-lyerly1.jpg
425 0.02%29/Sep/05 23:54/graphics/fun/netbunnies/umichum2-lapitan1.jpg
425 0.01%29/Sep/05 20:01/graphics/fun/netbunnies/mokie1-lin1.jpg
425 0.01%29/Sep/05 19:40/graphics/fun/netbunnies/chaos-brammer1.jpg
425 0.02%29/Sep/05 20:10/graphics/fun/netbunnies/floppy-taylor1.jpg
425 0.01%29/Sep/05 23:56/graphics/fun/netbunnies/ruby1-strope1.jpg
425 0.03%30/Sep/05 00:02/graphics/fun/netbunnies/brushbaby.jpg
425 0.02%29/Sep/05 22:46/graphics/fun/netbunnies/frederick-sandy1.jpg
425 0.03%29/Sep/05 22:21/graphics/fun/netbunnies/P8050001.jpg
424 0.01%29/Sep/05 21:37/graphics/fun/netbunnies/spunky-miller1.jpg
424 0.01%29/Sep/05 22:29/journal/2-1/loss-support.html
424 0.01%29/Sep/05 21:41/graphics/fun/netbunnies/julius-hurley1.jpg
424 0.02%29/Sep/05 22:28/graphics/fun/netbunnies/rabbits1-deb1.jpg
424 0.02%29/Sep/05 23:01/graphics/fun/netbunnies/qt+jack2-sayles1.jpg
424 0.01%29/Sep/05 19:12/graphics/fun/netbunnies/beastd-Hawkins1.jpg
424 0.01%29/Sep/05 19:12/graphics/fun/netbunnies/flopsy-lane1.jpg
424 0.02%29/Sep/05 23:46/graphics/fun/netbunnies/tubby-tima1.jpg
424 0.05%29/Sep/05 22:28/graphics/fun/netbunnies/barney-long-lop-chair.jpg
424 0.01%29/Sep/05 20:58/graphics/fun/netbunnies/cuddles1-porter1.jpg
424 0.11%29/Sep/05 23:09/chapters/san-diego/adoption/Adoption_Photos/Marjorie_Ned_adoption_9Aug05 copy.jpg
423 0.01%29/Sep/05 20:14/graphics/fun/netbunnies/bunny3-wu1.jpg
423 0.02%29/Sep/05 20:56/graphics/fun/netbunnies/wyatt-watson1.jpg
423 0.02%29/Sep/05 22:53/graphics/fun/netbunnies/midnight1-mue1.jpg
423 0.01%29/Sep/05 22:12/graphics/fun/netbunnies/jangles2.jpg
423 29/Sep/05 18:34/graphics/books/go-button.gif
422 0.03%29/Sep/05 23:23/graphics/fun/netbunnies/basil-cook1.jpg
422 0.01%29/Sep/05 21:02/graphics/fun/netbunnies/socks_sylviaw1.jpg
422 0.02%29/Sep/05 20:17/graphics/fun/netbunnies/mushielopincorner.jpg
422 29/Sep/05 18:34/graphics/books/126X32-b-logo.gif
422 0.01%29/Sep/05 22:15/graphics/fun/netbunnies/gilligan-riso1.jpg
422 0.02%29/Sep/05 19:25/graphics/fun/netbunnies/bunny2-dibunny1.jpg
422 0.01%29/Sep/05 18:22/graphics/fun/netbunnies/bunnie2-hatton1.jpg
422 0.01%29/Sep/05 23:48/graphics/fun/netbunnies/SCHMOO.jpg
422 0.02%29/Sep/05 23:10/graphics/fun/netbunnies/honeymoon-leavitt1.jpg
422 0.03%29/Sep/05 20:57/graphics/fun/netbunnies/Rab1.jpg
422 0.02%29/Sep/05 23:48/graphics/fun/netbunnies/thumperandpaul-Mason1.jpg
422 0.02%29/Sep/05 22:13/graphics/fun/netbunnies/xmasrab-Rtocups1.jpg
422 0.02%29/Sep/05 22:54/graphics/fun/netbunnies/benny-appilini1.jpg
421 0.02%29/Sep/05 21:17/graphics/fun/netbunnies/phoebe-maines1.jpg
421 0.02%30/Sep/05 00:01/graphics/fun/netbunnies/bunny in garden-winden1.jpg
421 0.01%29/Sep/05 23:09/graphics/fun/netbunnies/bunduck1-davison1.jpg
421 0.02%29/Sep/05 23:54/graphics/fun/netbunnies/sweetie-toillon1.jpg
421 0.02%29/Sep/05 23:24/graphics/fun/netbunnies/sheba4-bushra1.jpg
421 0.04%29/Sep/05 23:55/graphics/fun/netbunnies/steve2-mundy1.jpg
421 0.01%29/Sep/05 20:06/graphics/fun/netbunnies/wiener1-sposato1.jpg
421 0.01%29/Sep/05 21:23/graphics/fun/netbunnies/beezle-hayworth1.jpg
421 0.01%29/Sep/05 20:57/graphics/fun/netbunnies/buster-macintosh1.jpg
421 0.01%29/Sep/05 22:24/graphics/fun/netbunnies/cora-winarchick1.jpg
421 0.01%29/Sep/05 23:58/graphics/fun/netbunnies/P2140007.jpg
421 0.01%29/Sep/05 22:13/graphics/fun/netbunnies/rasberry-perillat1.jpg
420 0.02%29/Sep/05 22:17/graphics/fun/netbunnies/Snugglesspagetti-Yoder1.jpg
420 0.01%29/Sep/05 20:58/graphics/fun/netbunnies/SylviaXmas.jpg
420 0.02%29/Sep/05 23:32/graphics/fun/netbunnies/mbi-moore1.jpg
420 0.01%29/Sep/05 23:23/graphics/fun/netbunnies/annie-jacquard1.jpg
420 0.02%29/Sep/05 23:49/graphics/fun/netbunnies/amigos8-butcher1.jpg
420 0.01%29/Sep/05 23:47/graphics/fun/netbunnies/tilly-macintosh1.jpg
420 0.04%29/Sep/05 20:18/graphics/fun/netbunnies/receptionist-rabbit-chen.jpg
420 0.01%29/Sep/05 20:59/graphics/fun/netbunnies/Toby3-Wingfield1.jpg
420 0.03%29/Sep/05 21:10/graphics/fun/netbunnies/nigel-hickman1.jpg
420 29/Sep/05 22:39/opinion/fur.html
420 0.01%29/Sep/05 23:50/graphics/fun/netbunnies/thumper-roxy3-bailey1.jpg
419 0.01%29/Sep/05 20:56/graphics/fun/netbunnies/Scottie-Mark1.jpg
419 0.01%29/Sep/05 23:57/graphics/fun/netbunnies/stitch-aki1.jpg
419 0.01%29/Sep/05 22:39/journal/3-11/graphics/apple-by-fence-ill.gif
419 0.01%29/Sep/05 18:30/graphics/fun/netbunnies/negao1-marcia1.jpg
419 0.02%29/Sep/05 23:55/graphics/fun/netbunnies/boys2-martin1.jpg
419 0.01%29/Sep/05 18:09/graphics/fun/netbunnies/wilshire-bugsi-dslextreme1.jpg
419 0.01%30/Sep/05 00:00/graphics/fun/netbunnies/toots1-grecco1.jpg
419 0.01%29/Sep/05 22:58/graphics/fun/netbunnies/bunhead-Wiles1.jpg
419 0.02%29/Sep/05 23:35/graphics/fun/netbunnies/harley-ko1.jpg
419 0.02%29/Sep/05 20:58/graphics/fun/netbunnies/bobby-Chuck1.jpg
419 0.01%29/Sep/05 20:15/graphics/fun/netbunnies/willby-cook1.jpg
419 0.02%29/Sep/05 22:54/graphics/fun/netbunnies/bunbun1-stone1.jpg
419 0.01%29/Sep/05 20:57/graphics/fun/netbunnies/Shelby+Sweetie-Benny1.jpg
419 0.01%29/Sep/05 19:43/care/sick.html
419 0.02%29/Sep/05 20:13/graphics/fun/netbunnies/WallyZorro-Mack1.jpg
419 0.01%30/Sep/05 00:00/graphics/fun/netbunnies/vancouver-watch1.jpg
418 0.01%29/Sep/05 20:11/graphics/fun/netbunnies/angel-jan1.jpg
418 0.01%29/Sep/05 22:28/graphics/fun/netbunnies/bunny1-vegton1.jpg
418 0.02%29/Sep/05 19:36/graphics/fun/netbunnies/pokey1-chiang1.jpg
418 0.01%29/Sep/05 21:41/graphics/fun/netbunnies/pashmina-garbos1.jpg
418 0.02%29/Sep/05 20:17/graphics/fun/netbunnies/hopalong-s1.jpg
418 0.02%29/Sep/05 20:05/graphics/fun/netbunnies/benbun-sadoway1.jpg
418 0.02%29/Sep/05 23:25/graphics/fun/netbunnies/slopers-mcconville1.jpg
417 0.03%29/Sep/05 20:17/graphics/fun/netbunnies/bunnies2-grimes1.jpg
417 0.02%29/Sep/05 23:10/graphics/fun/netbunnies/Trixie-Robinson1.jpg
417 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/daisydixon-davis1.jpg
417 0.01%29/Sep/05 22:28/graphics/fun/netbunnies/dottie-tao1.jpg
417 0.01%29/Sep/05 23:59/graphics/fun/netbunnies/dusty.jpg
417 0.01%29/Sep/05 21:17/graphics/fun/netbunnies/batuffolo1-massimo1.jpg
417 0.01%29/Sep/05 19:27/graphics/fun/netbunnies/caramel-flannery1.jpg
417 0.02%29/Sep/05 23:48/graphics/fun/netbunnies/thumper3-chandler1.jpg
417 0.02%30/Sep/05 00:01/graphics/fun/netbunnies/oreo-marroney1.jpg
417 0.02%29/Sep/05 23:54/graphics/fun/netbunnies/sully-paige1.jpg
417 0.01%29/Sep/05 21:21/graphics/fun/netbunnies/bunbun6-wendy1.jpg
417 0.02%29/Sep/05 22:15/graphics/fun/netbunnies/harley2-ko1.jpg
417 0.02%29/Sep/05 23:27/graphics/fun/netbunnies/lily1-gobler1.jpg
417 0.01%29/Sep/05 23:31/graphics/fun/netbunnies/boozie-dewhurst1.jpg
417 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/cookie-smt1.jpg
417 0.04%30/Sep/05 00:01/graphics/fun/netbunnies/funnybunny2-Willcocks1.jpg
416 0.01%29/Sep/05 23:50/graphics/fun/netbunnies/thumper-roxy4-bailey1.jpg
416 0.03%29/Sep/05 23:10/graphics/fun/netbunnies/hermelina2-braz1.jpg
416 0.01%29/Sep/05 20:15/graphics/fun/netbunnies/rabbit1-butt1.jpg
416 0.02%29/Sep/05 18:04/graphics/fun/netbunnies/butterbean2-vegton1.jpg
416 0.05%29/Sep/05 22:09/rabbit-center/hayward_rescue/hayward_graphics/corpse2.jpg
416 0.01%29/Sep/05 21:38/graphics/fun/netbunnies/pooper1-chakraverty1.jpg
416 0.03%29/Sep/05 18:17/graphics/fun/netbunnies/beachingbunnieshenriettaho.jpg
416 0.02%29/Sep/05 23:55/graphics/fun/netbunnies/sugar-wendy1.jpg
416 0.01%29/Sep/05 20:18/graphics/fun/netbunnies/pg1.jpg
416 0.01%29/Sep/05 23:32/graphics/fun/netbunnies/TakingaPowder.jpg
416 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/trixie-traylor1.jpg
415 0.03%29/Sep/05 22:54/graphics/fun/netbunnies/bugs2-Ingham1.jpg
415 0.04%29/Sep/05 18:47/graphics/fun/netbunnies/bartup.jpg
415 0.01%29/Sep/05 19:16/graphics/fun/netbunnies/pj-jun1.jpg
415 0.01%29/Sep/05 20:16/graphics/fun/netbunnies/rex-poole1.jpg
415 0.01%29/Sep/05 22:53/graphics/fun/netbunnies/pebbles-hearn1.jpg
415 0.01%29/Sep/05 20:14/graphics/fun/netbunnies/rabbit-hurley1.jpg
415 0.01%29/Sep/05 20:20/graphics/fun/netbunnies/rabbit1-klarman1.jpg
415 0.02%29/Sep/05 22:25/graphics/fun/netbunnies/Sassy-Kirsch1.jpg
415 0.02%30/Sep/05 00:02/graphics/fun/netbunnies/bb-lea1.jpg
415 0.01%29/Sep/05 21:37/graphics/fun/netbunnies/boncuk1-sahinalp1.jpg
415 0.01%29/Sep/05 21:32/graphics/fun/netbunnies/fudge2-leigh1.jpg
415 0.01%29/Sep/05 21:37/graphics/fun/netbunnies/bunkie-needler1.jpg
415 0.04%29/Sep/05 23:31/graphics/fun/netbunnies/perry-black-baby-box.jpg
415 0.02%30/Sep/05 00:00/graphics/fun/netbunnies/wiggles2-moore1.jpg
414 0.02%29/Sep/05 22:54/graphics/fun/netbunnies/small.jpg
414 0.02%29/Sep/05 20:10/graphics/fun/netbunnies/arthur1-holden1.jpg
414 0.02%29/Sep/05 23:56/graphics/fun/netbunnies/tinker+alexa-chen1.jpg
414 0.03%29/Sep/05 22:53/graphics/fun/netbunnies/paige+theo-brusk1.jpg
414 0.01%29/Sep/05 22:53/graphics/fun/netbunnies/bosco-belle-graham1.jpg
414 0.02%29/Sep/05 21:37/graphics/fun/netbunnies/reggie-odell1.jpg
414 0.01%29/Sep/05 23:55/graphics/fun/netbunnies/muffy4.jpg
414 0.03%29/Sep/05 17:14/graphics/fun/netbunnies/lily2-rice1.jpg
414 0.02%29/Sep/05 22:17/graphics/fun/netbunnies/tinkerbell-habel1.jpg
414 0.01%29/Sep/05 22:14/graphics/fun/netbunnies/willow3-bowser1.jpg
413 0.02%30/Sep/05 00:01/graphics/fun/netbunnies/baso+stinky-wangchuk1.jpg
413 0.01%29/Sep/05 19:43/graphics/fun/netbunnies/weblio1-aki1.jpg
413 0.01%29/Sep/05 23:38/graphics/fun/netbunnies/hare-harebrain1.jpg
413 0.01%29/Sep/05 21:37/graphics/fun/netbunnies/melanie-rath1.jpg
413 0.02%30/Sep/05 00:00/graphics/fun/netbunnies/bunny-brry1.jpg
413 0.01%29/Sep/05 21:39/graphics/fun/netbunnies/muppet-warwick1.jpg
413 0.01%29/Sep/05 21:36/graphics/fun/netbunnies/rabbit-elamk1.jpg
413 0.03%29/Sep/05 20:20/graphics/fun/netbunnies/bunnybonding-Darren1.jpg
413 0.02%30/Sep/05 00:02/graphics/fun/netbunnies/thumper-gynn1.jpg
413 0.01%29/Sep/05 22:13/graphics/fun/netbunnies/basil1-bivona1.jpg
413 0.02%30/Sep/05 00:01/graphics/fun/netbunnies/patrick-rudeck1.jpg
413 0.03%29/Sep/05 17:43/graphics/fun/netbunnies/bunny1-blair1.jpg
413 0.01%29/Sep/05 20:10/graphics/fun/netbunnies/bunnies1-broley1.jpg
413 0.01%29/Sep/05 23:35/graphics/fun/netbunnies/lennard2-McSweeney1.jpg
413 0.02%29/Sep/05 23:52/graphics/fun/netbunnies/tepp2-noa1.jpg
413 0.01%29/Sep/05 20:16/graphics/fun/netbunnies/vegan2-christina1.jpg
413 0.01%29/Sep/05 23:00/graphics/fun/netbunnies/toto-charonnet1.jpg
412 0.01%29/Sep/05 18:47/graphics/fun/netbunnies/flurrymax-french1.jpg
412 0.01%29/Sep/05 23:10/graphics/fun/netbunnies/oatmeal3-heather1.jpg
412 29/Sep/05 20:40/cgi-bin/suid/~rabbit2/san-diego/search
412 0.01%29/Sep/05 22:58/graphics/fun/netbunnies/cassidy.jpg
412 0.02%29/Sep/05 20:51/graphics/fun/netbunnies/Lau5.jpg
412 0.02%30/Sep/05 00:00/graphics/fun/netbunnies/stinky-wangchuk1.jpg
412 0.01%29/Sep/05 19:00/graphics/fun/netbunnies/george1.jpg
412 0.01%29/Sep/05 23:54/graphics/fun/netbunnies/willow3-stardancer1.jpg
412 0.01%29/Sep/05 22:19/graphics/fun/netbunnies/wasabi-yee1.jpg
412 0.03%29/Sep/05 23:56/graphics/fun/netbunnies/bunny-barry1.jpg
412 0.03%29/Sep/05 22:28/graphics/fun/netbunnies/rabbit2-butt1.jpg
411 0.01%29/Sep/05 23:58/graphics/fun/netbunnies/She-Zdila1.jpg
411 0.01%29/Sep/05 22:18/graphics/fun/netbunnies/bunnies9-doerfler1.jpg
411 0.01%29/Sep/05 23:59/graphics/fun/netbunnies/dandy-jenny1.jpg
411 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/bagelbun1-attila1.jpg
411 0.03%30/Sep/05 00:01/graphics/fun/netbunnies/pebbles3-cliff1.jpg
411 0.01%29/Sep/05 20:15/graphics/fun/netbunnies/fufus23.jpg
411 0.01%29/Sep/05 22:38/rescue/
411 0.01%29/Sep/05 20:12/graphics/fun/netbunnies/bongo2_sylviaw1.jpg
411 0.01%29/Sep/05 19:26/graphics/fun/netbunnies/georgia-janes1.jpg
411 0.02%29/Sep/05 23:53/graphics/fun/netbunnies/lucky-katievic1.jpg
411 0.01%29/Sep/05 21:04/graphics/fun/netbunnies/punkin-dujardin1.jpg
410 0.01%29/Sep/05 23:52/graphics/fun/netbunnies/thor-vanessa1.jpg
410 0.01%29/Sep/05 20:19/graphics/fun/netbunnies/wally-relaxing.jpg
410 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/snoop-robson1.jpg
410 29/Sep/05 22:32/chapters/socal/vets.html
410 0.02%29/Sep/05 23:54/graphics/fun/netbunnies/sweetie2-toillon1.jpg
410 0.01%29/Sep/05 20:06/graphics/fun/netbunnies/bunny-martinez1.jpg
410 0.01%29/Sep/05 22:14/graphics/fun/netbunnies/carmela2-aquino1.jpg
410 0.01%29/Sep/05 19:36/graphics/fun/netbunnies/javajoe-forsythe1.jpg
410 0.01%29/Sep/05 23:15/graphics/fun/netbunnies/turbo2-tam1.jpg
410 0.01%29/Sep/05 19:58/graphics/fun/netbunnies/poppy8-marcia1.jpg
410 0.01%29/Sep/05 16:50/graphics/fun/netbunnies/powder-Daniels1.jpg
410 0.01%29/Sep/05 21:13/graphics/fun/netbunnies/tl-jun1.jpg
409 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/callie-caple1.jpg
409 0.01%30/Sep/05 00:03/graphics/fun/netbunnies/enki-Lucy1.jpg
409 0.01%29/Sep/05 21:24/links/sections/mailing-lists.html
409 0.03%29/Sep/05 23:00/graphics/fun/netbunnies/harold-drake1.jpg
409 0.01%29/Sep/05 23:48/journal/2-12/to-fly-or-not-to-fly.html
409 0.02%29/Sep/05 15:07/graphics/fun/netbunnies/amelia1-mcsherry1.jpg
409 0.02%29/Sep/05 20:19/graphics/fun/netbunnies/velvet+precious-finke1.jpg
409 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/hershey-bella-brandt1.jpg
409 0.02%29/Sep/05 22:54/graphics/fun/netbunnies/vlekkie-rose1.jpg
409 0.01%29/Sep/05 23:50/graphics/fun/netbunnies/thumper-button1.jpg
409 0.01%29/Sep/05 23:45/graphics/fun/netbunnies/willie1-melton1.jpg
409 0.01%29/Sep/05 20:17/graphics/fun/netbunnies/rabbit-a-spence1.jpg
409 0.01%29/Sep/05 20:13/graphics/fun/netbunnies/amos.jpg
409 29/Sep/05 18:56/graphics/mine/foo/
15 29/Sep/05 17:14  /graphics/mine/foo/?N=D
11 28/Sep/05 21:12  /graphics/mine/foo/?M=A
10 28/Sep/05 21:11  /graphics/mine/foo/?S=A
10 28/Sep/05 21:11  /graphics/mine/foo/?D=A
409 0.04%29/Sep/05 21:08/graphics/fun/netbunnies/alexander-7mon-lop-palmiere.jpg
409 0.01%30/Sep/05 00:01/graphics/fun/netbunnies/knuffel-Hoyer1.jpg
409 0.01%29/Sep/05 23:10/graphics/fun/netbunnies/sparkiesnow-small1.jpg
408 0.01%29/Sep/05 21:21/graphics/fun/netbunnies/calvin1-pope1.jpg
408 0.01%29/Sep/05 22:26/graphics/fun/netbunnies/bunny-sugalski1.jpg
408 0.03%29/Sep/05 20:13/graphics/fun/netbunnies/kids-wittenkeller1.jpg
408 0.01%30/Sep/05 00:03/graphics/fun/netbunnies/bubbles-Ng1.jpg
408 0.01%29/Sep/05 19:21/graphics/fun/netbunnies/timmy5-robinson1.jpg
408 0.03%29/Sep/05 20:13/graphics/fun/netbunnies/stormy-skyquest1.jpg
408 0.01%29/Sep/05 23:50/graphics/fun/netbunnies/thumper-vaga1.jpg
408 0.01%29/Sep/05 22:59/graphics/fun/netbunnies/ding-Kujawa1.jpg
408 0.02%29/Sep/05 20:56/graphics/fun/netbunnies/monty-poh1.jpg
408 0.01%29/Sep/05 20:59/graphics/fun/netbunnies/Tommy2.jpg
408 0.01%29/Sep/05 21:37/graphics/fun/netbunnies/sadie-mia1.jpg
408 0.03%29/Sep/05 19:43/graphics/fun/netbunnies/baby-limes1.jpg
408 0.01%29/Sep/05 18:17/graphics/fun/netbunnies/lubimysie3-Anna1.jpg
408 0.01%29/Sep/05 21:39/graphics/fun/netbunnies/jewel-pratt1.jpg
408 0.02%29/Sep/05 20:06/graphics/fun/netbunnies/puput-merikanto1.jpg
408 0.01%29/Sep/05 21:11/graphics/fun/netbunnies/sophia.jpg
408 0.01%29/Sep/05 19:36/graphics/fun/netbunnies/bunny4.jpg
407 0.01%29/Sep/05 20:13/graphics/fun/netbunnies/daphne-tck1.jpg
407 0.02%29/Sep/05 23:00/graphics/fun/netbunnies/oreo-hunnie1.jpg
407 0.02%29/Sep/05 23:58/graphics/fun/netbunnies/ruby-renee1.jpg
407 0.02%29/Sep/05 21:39/graphics/fun/netbunnies/willie1-martin1.jpg
407 0.01%29/Sep/05 21:25/graphics/fun/netbunnies/waabooz-erin1.jpg
407 0.04%29/Sep/05 21:17/graphics/fun/netbunnies/crystal-11mon-palmier.jpg
407 0.01%29/Sep/05 23:50/graphics/fun/tinytim.jpg
407 0.01%29/Sep/05 22:28/graphics/fun/netbunnies/attila+thumper1-schindl1.jpg
407 0.01%29/Sep/05 21:31/graphics/fun/netbunnies/snugglebuns-intelligoth1.jpg
407 0.01%29/Sep/05 22:21/graphics/fun/netbunnies/skye-relaxing.jpg
407 0.01%29/Sep/05 19:15/graphics/fun/netbunnies/babies2-haase1.jpg
407 0.01%29/Sep/05 18:40/graphics/fun/netbunnies/smokey3h.jpg
407 0.02%29/Sep/05 23:50/graphics/fun/netbunnies/thumper-Mason1.jpg
406 0.01%29/Sep/05 20:20/graphics/fun/netbunnies/buster-liu1.jpg
406 0.01%29/Sep/05 22:50/graphics/fun/netbunnies/kaysi-fairhurst1.jpg
406 0.02%29/Sep/05 21:38/graphics/fun/netbunnies/Vicky-LilSweet1.jpg
406 0.02%29/Sep/05 21:24/graphics/fun/netbunnies/monica2-feldman1.jpg
406 0.01%30/Sep/05 00:01/graphics/fun/netbunnies/gingerricky-montgomery1.jpg
406 0.01%29/Sep/05 18:17/graphics/fun/netbunnies/freckles-Cathy1.jpg
406 0.01%29/Sep/05 23:51/graphics/fun/netbunnies/thumber-corkery1.jpg
406 0.03%29/Sep/05 23:57/graphics/fun/netbunnies/cuddles2-koza1.jpg
406 0.02%29/Sep/05 21:38/graphics/fun/netbunnies/bundles-denicourt1.jpg
406 0.02%29/Sep/05 19:28/graphics/fun/netbunnies/pepper+sweetpea-wickerson1.jpg
406 0.01%29/Sep/05 23:28/graphics/fun/netbunnies/black-ho1.jpg
406 0.01%29/Sep/05 17:15/graphics/fun/netbunnies/mopsey-feely1.jpg
406 0.01%29/Sep/05 20:13/graphics/fun/netbunnies/de+boo-bssell1.jpg
406 0.02%29/Sep/05 23:53/graphics/fun/netbunnies/tashi-mypetsrule1.jpg
406 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/muffin-miller1.jpg
406 0.01%29/Sep/05 17:51/graphics/fun/netbunnies/spike-doubleday1.jpg
406 0.01%29/Sep/05 22:28/graphics/fun/netbunnies/bunster-kerry1.jpg
406 0.01%29/Sep/05 18:22/graphics/fun/netbunnies/aspen+pandora3-millikin1.jpg
406 0.01%29/Sep/05 23:10/graphics/fun/netbunnies/bently2-shi1.jpg
406 0.01%29/Sep/05 21:16/graphics/fun/netbunnies/bunnies4-doerfler1.jpg
406 0.02%29/Sep/05 20:17/graphics/fun/netbunnies/bunny-crawford1.jpg
406 0.02%29/Sep/05 18:44/graphics/fun/netbunnies/angel+cloudy-phelan1.jpg
406 0.03%29/Sep/05 19:16/graphics/fun/netbunnies/molson-martin1.jpg
406 0.01%29/Sep/05 22:53/graphics/fun/netbunnies/achog-elamk2c1.jpg
406 0.01%29/Sep/05 22:08/graphics/fun/netbunnies/chloe-odell1.jpg
405 0.01%30/Sep/05 00:00/graphics/fun/netbunnies/oreofluff-varghese1.jpg
405 0.03%30/Sep/05 00:02/graphics/fun/netbunnies/bunny2-angie1.jpg
405 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/usagi1-king1.jpg
405 0.02%29/Sep/05 23:35/graphics/fun/netbunnies/midnite-barnett1.jpg
405 0.01%29/Sep/05 18:44/graphics/fun/netbunnies/mrb-pfirsch1.jpg
405 0.02%29/Sep/05 23:48/graphics/fun/netbunnies/timmy-jasna1.jpg
405 0.01%29/Sep/05 18:34/graphics/books/soup.gif
405 0.01%29/Sep/05 23:57/graphics/fun/netbunnies/elle-gonzalez1.jpg
405 0.02%29/Sep/05 19:36/graphics/fun/netbunnies/bunnies2-Linares1.jpg
405 0.02%29/Sep/05 20:58/graphics/fun/netbunnies/SuperbeHermione-Buton1.jpg
405 0.01%29/Sep/05 23:55/graphics/fun/netbunnies/alfred.jpg
405 0.01%29/Sep/05 23:25/graphics/fun/netbunnies/stewart_sylviaw1.jpg
405 0.03%29/Sep/05 23:54/graphics/fun/netbunnies/shooshoo-snar1.jpg
405 0.01%29/Sep/05 23:54/graphics/fun/netbunnies/kurosawa-king1.jpg
405 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/jonathan-meimei1.jpg
405 0.05%29/Sep/05 21:24/graphics/fun/netbunnies/brown-rabbit-bricks2.jpg
405 0.02%29/Sep/05 23:00/graphics/fun/netbunnies/binky-macgregor1.jpg
404 0.11%29/Sep/05 19:11/chapters/san-diego/diet/Food_Chart.pdf
404 0.01%29/Sep/05 23:54/graphics/fun/netbunnies/betty-Harris1.jpg
404 0.01%29/Sep/05 20:20/graphics/fun/netbunnies/oscar-sigler1.jpg
404 0.02%29/Sep/05 23:54/graphics/fun/netbunnies/sweetpea2-walter1.jpg
404 0.01%29/Sep/05 22:58/graphics/fun/netbunnies/ginger-george1.jpg
404 0.01%29/Sep/05 21:09/chapters/san-diego/behavior/expect.html
404 0.02%29/Sep/05 20:11/graphics/fun/netbunnies/bun1-needler1.jpg
404 0.01%29/Sep/05 20:21/graphics/fun/netbunnies/alfie3-finn1.jpg
404 0.01%29/Sep/05 20:11/graphics/fun/netbunnies/booboo1-strohmeyer1.jpg
404 0.01%29/Sep/05 20:13/graphics/fun/netbunnies/elwood-mcclure1.jpg
404 0.01%29/Sep/05 20:54/graphics/fun/netbunnies/fatlady1-piglet1.jpg
404 0.02%29/Sep/05 21:26/graphics/fun/netbunnies/bunnies7-doerfler1.jpg
404 0.01%29/Sep/05 22:21/graphics/fun/netbunnies/conejo2-Collado1.jpg
403 0.01%29/Sep/05 23:56/graphics/fun/netbunnies/tob-hopfei1.jpg
403 0.02%29/Sep/05 22:58/graphics/fun/netbunnies/kassidy-rich1.jpg
403 0.02%29/Sep/05 17:33/graphics/fun/netbunnies/bunnums.jpg
403 30/Sep/05 00:02/rabbit-center/retail/
403 0.02%29/Sep/05 23:24/graphics/fun/netbunnies/bunbun-allbriggidy1.jpg
403 0.01%29/Sep/05 20:05/graphics/fun/netbunnies/croppedbunny-emily1.jpg
403 0.01%29/Sep/05 20:10/graphics/fun/netbunnies/herby-wright1jpg.jpg
403 0.02%29/Sep/05 20:56/graphics/fun/netbunnies/cuddles-thinkpink1.jpg
403 0.01%29/Sep/05 20:14/graphics/fun/netbunnies/rocky-rayvon1.jpg
403 0.02%30/Sep/05 00:00/graphics/fun/netbunnies/nine2-merkus1.jpg
403 0.01%29/Sep/05 23:57/graphics/fun/netbunnies/abbey3-swordams1.jpg
403 0.02%29/Sep/05 15:53/graphics/fun/netbunnies/floppy-walko1.jpg
403 0.02%29/Sep/05 23:48/graphics/fun/netbunnies/thumper1-knorr1.jpg
403 0.01%29/Sep/05 23:25/graphics/fun/netbunnies/blackie.jpg
403 0.01%29/Sep/05 20:16/graphics/fun/netbunnies/bed.jpg
403 0.01%29/Sep/05 22:39/journal/4-7/love-goes-on.html
403 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/buntoungue-wendy1.jpg
403 0.03%29/Sep/05 22:17/graphics/fun/netbunnies/butz1-french1.jpg
403 0.02%29/Sep/05 20:16/graphics/fun/netbunnies/buggzy-pinto1.jpg
403 0.01%29/Sep/05 22:18/graphics/fun/netbunnies/cedy-holden1.jpg
403 0.02%29/Sep/05 21:17/graphics/fun/netbunnies/bunnibun-jones1.jpg
403 0.02%29/Sep/05 20:12/graphics/fun/netbunnies/bunbun-auken1.jpg
403 0.02%29/Sep/05 23:50/graphics/fun/netbunnies/thumper-knorr1.jpg
402 0.03%29/Sep/05 20:58/graphics/fun/netbunnies/bartside.jpg
402 0.02%29/Sep/05 22:36/graphics/fun/netbunnies/floppy-brandon1.jpg
402 0.03%29/Sep/05 22:22/graphics/fun/netbunnies/buddha1-nolan1.jpg
402 0.01%29/Sep/05 21:50/graphics/fun/netbunnies/hugh.jpg
402 0.03%29/Sep/05 22:27/graphics/fun/netbunnies/orion1-chen1.jpg
402 0.01%29/Sep/05 20:55/graphics/fun/netbunnies/dinkyscale-melin1.jpg
402 0.02%29/Sep/05 20:17/graphics/fun/netbunnies/ZZ-small-Cvetan1.jpg
402 0.01%29/Sep/05 23:10/graphics/fun/netbunnies/snuggles-stacy1.jpg
402 0.03%29/Sep/05 21:08/graphics/fun/netbunnies/bunnies-jamie1.jpg
402 0.02%30/Sep/05 00:00/graphics/fun/netbunnies/pooper-hilda1.jpg
402 0.02%29/Sep/05 23:24/graphics/fun/netbunnies/bunny1-tuma1.jpg
402 0.02%30/Sep/05 00:03/graphics/fun/netbunnies/bambam-hearn1.jpg
402 0.02%29/Sep/05 22:53/graphics/fun/netbunnies/sherlock.jpg
402 0.02%29/Sep/05 20:16/graphics/fun/netbunnies/riley1.jpg
402 0.01%29/Sep/05 23:36/graphics/fun/netbunnies/dickens-bon1.jpg
402 0.02%29/Sep/05 21:17/graphics/fun/netbunnies/niblet-muto1.jpg
402 0.01%29/Sep/05 20:21/graphics/fun/netbunnies/conejo3-Collado1.jpg
402 0.01%29/Sep/05 23:24/graphics/fun/netbunnies/buns-zen1.jpg
402 0.02%29/Sep/05 23:10/graphics/fun/netbunnies/amusematte-herrington1.jpg
402 0.01%29/Sep/05 21:03/graphics/fun/netbunnies/missbuffy-showalter1.jpg
402 0.01%29/Sep/05 22:28/graphics/fun/netbunnies/artie-forsythe1.jpg
401 0.03%29/Sep/05 22:16/graphics/fun/netbunnies/jb+ollie1-ozab1.jpg
401 0.02%29/Sep/05 19:40/graphics/fun/netbunnies/mister-kaoricat1.jpg
401 0.01%29/Sep/05 18:44/graphics/fun/netbunnies/scooter-edelmuller1.jpg
401 0.04%29/Sep/05 23:24/graphics/fun/netbunnies/apollonia-scott1.jpg
401 0.01%29/Sep/05 21:27/graphics/fun/netbunnies/sassy-campbell1.jpg
401 0.01%29/Sep/05 20:56/graphics/fun/netbunnies/rabbit-makuh1.jpg
401 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/charlie-gluck1.jpg
401 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/polly_card2.jpg
401 0.01%29/Sep/05 20:15/graphics/fun/netbunnies/milo1-mack1.jpg
401 0.04%29/Sep/05 18:43/graphics/fun/netbunnies/puff-lindren-white-toilet.jpg
401 0.03%29/Sep/05 23:57/graphics/fun/netbunnies/bill.jpg
401 29/Sep/05 22:32/translations/spanish/
401 0.02%29/Sep/05 20:08/graphics/fun/netbunnies/sherman_sylviaw1.jpg
401 0.13%29/Sep/05 17:38/chapters/san-diego/aboutus/bunnyfest/Bunny Painting_raffle_05.jpg
401 0.05%29/Sep/05 23:09/chapters/san-diego/adoption/Adoption_Photos/Miranda_adoption_7Aug05.jpg
401 0.03%29/Sep/05 22:13/graphics/fun/netbunnies/bartback.jpg
401 0.01%29/Sep/05 23:51/graphics/fun/netbunnies/thumper+louis-desio1.jpg
401 0.01%29/Sep/05 22:12/graphics/fun/netbunnies/tups-oasisfreak1.jpg
401 0.01%29/Sep/05 20:15/graphics/fun/netbunnies/einstein-kristen1.jpg
401 0.01%29/Sep/05 21:12/graphics/fun/netbunnies/RyoOhki3-Burk1.jpg
401 0.01%29/Sep/05 23:54/graphics/fun/netbunnies/mojave2-brown1.jpg
401 0.01%29/Sep/05 23:25/graphics/fun/netbunnies/bunnies3-kimberley1.jpg
401 0.02%29/Sep/05 23:31/graphics/fun/netbunnies/lily-cathey1.jpg
401 0.01%29/Sep/05 22:13/graphics/fun/netbunnies/bunners-lloyd1.jpg
401 0.01%29/Sep/05 21:32/graphics/fun/netbunnies/bob+parsley-hill1.jpg
401 0.01%29/Sep/05 22:13/graphics/fun/netbunnies/luna-lyerly1.jpg
401 0.01%29/Sep/05 23:57/graphics/fun/netbunnies/punkin-harmon1.jpg
401 0.01%29/Sep/05 22:28/graphics/fun/netbunnies/twix1-lanai1.jpg
400 0.02%29/Sep/05 22:21/graphics/fun/netbunnies/emmi-gwen1.jpg
400 0.01%30/Sep/05 00:01/graphics/fun/netbunnies/moby1-odell1.jpg
400 0.01%29/Sep/05 18:42/graphics/fun/netbunnies/bunny0420.jpg
400 0.01%29/Sep/05 16:06/graphics/fun/netbunnies/oliver-4.jpg
400 0.01%29/Sep/05 20:57/graphics/fun/netbunnies/max2-hanna1.jpg
400 0.01%29/Sep/05 22:27/graphics/fun/netbunnies/bunnybasket-uijen1.jpg
400 0.08%29/Sep/05 23:09/chapters/san-diego/adoption/Adoption_Photos/Ranger_adoption_7Aug05.jpg
400 0.02%30/Sep/05 00:00/graphics/fun/netbunnies/buddy2-elliott1.jpg
400 0.02%29/Sep/05 23:57/graphics/fun/netbunnies/bugsi2-greene1.jpg
400 0.01%29/Sep/05 17:31/graphics/fun/netbunnies/bunnyflower-sepesy1.jpg
400 0.02%29/Sep/05 19:12/graphics/fun/netbunnies/annabelle1-walker1.jpg
400 0.02%29/Sep/05 23:59/graphics/fun/netbunnies/herman-black-marks-gordon.jpg
400 29/Sep/05 20:57/graphics/fun/netbunnies/r955ashley38tiny.jpg
400 0.02%29/Sep/05 19:33/graphics/fun/netbunnies/ruby2-strope1.jpg
400 0.01%29/Sep/05 22:27/graphics/fun/netbunnies/hops2-attila1.jpg
400 0.02%29/Sep/05 22:58/graphics/fun/netbunnies/sophie-noakes1.jpg
400 0.01%29/Sep/05 23:01/graphics/fun/netbunnies/austin1-rhonda1.jpg
400 0.01%29/Sep/05 19:34/graphics/fun/netbunnies/magee-melesurgo1.jpg
399 0.01%29/Sep/05 21:18/graphics/fun/netbunnies/muffin-matacia1.jpg
399 0.01%29/Sep/05 18:49/graphics/fun/netbunnies/bunny1-applini1.jpg
399 0.03%29/Sep/05 22:54/graphics/fun/netbunnies/arthur2-holden1.jpg
399 0.01%29/Sep/05 23:48/graphics/fun/netbunnies/thumper1-gitter1.jpg
399 0.01%29/Sep/05 22:51/graphics/fun/netbunnies/snowflake.jpg
399 27/Sep/05 14:18/rabbit-center/graphics/icon_retail.gif
399 0.02%29/Sep/05 23:10/graphics/fun/netbunnies/laraotoole2-swieconek1.jpg
399 0.02%29/Sep/05 23:35/graphics/fun/netbunnies/oreo-corbelli1.jpg
399 0.01%30/Sep/05 00:01/graphics/fun/netbunnies/selleck-allen1.jpg
399 0.02%29/Sep/05 20:57/graphics/fun/netbunnies/bigbun-Hardai1.jpg
399 0.01%29/Sep/05 23:56/graphics/fun/netbunnies/ginger1-herrington1.jpg
399 0.01%29/Sep/05 21:37/graphics/fun/netbunnies/bunnies1-Amit1.jpg
399 0.02%29/Sep/05 21:41/graphics/fun/netbunnies/bunnybabies-Linares1.jpg
399 0.02%29/Sep/05 23:57/graphics/fun/netbunnies/becky-semler1.jpg
399 0.02%29/Sep/05 23:46/graphics/fun/netbunnies/timmysitting-Anderson1.jpg
399 0.02%30/Sep/05 00:02/graphics/fun/netbunnies/snowflake3-smopar1.jpg
399 0.01%29/Sep/05 22:59/graphics/fun/netbunnies/angel1-moskalik1.jpg
399 0.02%29/Sep/05 22:54/graphics/fun/netbunnies/crissinina-santos1.jpg
399 0.02%29/Sep/05 21:13/graphics/fun/netbunnies/missey-rogers1.jpg
399 0.04%29/Sep/05 22:53/graphics/fun/netbunnies/brown-lop-christmas.jpg
399 0.02%29/Sep/05 18:46/graphics/fun/netbunnies/bailey4-erin1.jpg
398 0.02%29/Sep/05 23:58/graphics/fun/netbunnies/snow2-nscean1.jpg
398 0.02%29/Sep/05 22:24/graphics/fun/netbunnies/sammy-lloyd1.jpg
398 0.01%29/Sep/05 20:55/graphics/fun/netbunnies/lulu-velas1.jpg
398 0.01%29/Sep/05 23:24/graphics/fun/netbunnies/shaz-seay1.jpg
398 0.02%29/Sep/05 23:55/graphics/fun/netbunnies/violet-seitz1.jpg
398 0.02%29/Sep/05 20:09/graphics/fun/netbunnies/huggies-Caulders1.jpg
398 0.02%29/Sep/05 20:18/graphics/fun/netbunnies/chubbs-daisy3-esquivel1.jpg
398 0.01%29/Sep/05 23:53/graphics/fun/netbunnies/bugsy+chloe-greene1.jpg
398 0.01%30/Sep/05 00:01/graphics/fun/netbunnies/sam-penelope3-stellato1.jpg
398 0.03%29/Sep/05 19:39/graphics/fun/netbunnies/pandora2-chiquita1.jpg
398 0.01%29/Sep/05 20:55/graphics/fun/netbunnies/blaze2-heldt1.jpg
398 0.02%29/Sep/05 23:10/graphics/fun/netbunnies/kili-sandkamp1.jpg
398 27/Sep/05 14:18/rabbit-center/retail/pixel.gif
398 0.03%29/Sep/05 20:12/graphics/fun/netbunnies/ericrags3.jpg
398 0.01%29/Sep/05 22:28/graphics/fun/netbunnies/bentley4-cummins1.jpg
397 0.05%29/Sep/05 23:09/chapters/san-diego/adoption/Adoption_Photos/Samantha_adoption_7Aug05.jpg
397 0.04%29/Sep/05 18:12/graphics/fun/netbunnies/truffles-white-lop-drinking.jpg
397 0.02%29/Sep/05 19:47/graphics/fun/netbunnies/manny-anderson1.jpg
397 0.01%29/Sep/05 23:31/graphics/fun/netbunnies/shela-morales1.jpg
397 0.02%29/Sep/05 23:29/graphics/fun/netbunnies/nimbus-kmk1.jpg
397 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/bigwig2.jpg
397 0.01%29/Sep/05 20:12/graphics/fun/netbunnies/jellybean1-ozab1.jpg
397 0.02%29/Sep/05 23:35/graphics/fun/netbunnies/daisy-dixon-ho1.jpg
397 0.02%29/Sep/05 20:56/graphics/fun/netbunnies/muffin-mode1.jpg
397 0.01%29/Sep/05 23:55/graphics/fun/netbunnies/benny-scollo1.jpg
397 0.01%29/Sep/05 23:09/graphics/fun/netbunnies/cadbury-mustang1.jpg
397 0.02%30/Sep/05 00:02/graphics/fun/netbunnies/rabbie-cooper1.jpg
397 0.01%29/Sep/05 23:52/graphics/fun/netbunnies/chandler-craig1.jpg
397 0.02%29/Sep/05 23:58/graphics/fun/netbunnies/brownie1-sreenivasan1.jpg
397 0.01%29/Sep/05 20:16/graphics/fun/netbunnies/dixon-ho1.jpg
397 0.01%30/Sep/05 00:03/graphics/fun/netbunnies/bambibeau-guidry1.jpg
396 0.01%29/Sep/05 20:16/graphics/fun/netbunnies/oreo-oei1.jpg
396 0.02%29/Sep/05 22:15/graphics/fun/netbunnies/bungalo-salisbury1.jpg
396 0.01%29/Sep/05 23:33/graphics/fun/netbunnies/hoppy-chetnik1.jpg
396 0.01%29/Sep/05 20:21/graphics/fun/netbunnies/leia-sh1.jpg
396 0.01%29/Sep/05 21:10/graphics/fun/netbunnies/new-2yourabbitsresized.jpg
396 0.01%29/Sep/05 21:21/graphics/fun/netbunnies/basket-linares1.jpg
396 0.01%29/Sep/05 22:11/graphics/fun/netbunnies/fluffy-mauler1.jpg
396 0.02%29/Sep/05 22:23/graphics/fun/netbunnies/garry1-castaneda1.jpg
396 0.01%29/Sep/05 20:57/graphics/fun/netbunnies/dopey-chen1.jpg
396 0.01%29/Sep/05 20:12/graphics/fun/netbunnies/Willy.jpg
396 0.02%29/Sep/05 23:34/graphics/fun/netbunnies/nora-ford1.jpg
396 0.02%29/Sep/05 18:04/graphics/fun/netbunnies/sean-odell1.jpg
396 0.04%29/Sep/05 20:16/graphics/fun/netbunnies/milizard3-joy1.jpg
396 0.02%29/Sep/05 23:01/graphics/fun/netbunnies/rabbits1-reeves1.jpg
395 0.02%29/Sep/05 21:49/graphics/fun/netbunnies/bunny4-ButlerClarke1.jpg
395 0.01%29/Sep/05 21:37/graphics/fun/netbunnies/bunny-gasparick1.jpg
395 0.01%29/Sep/05 21:37/graphics/fun/netbunnies/simone3.jpg
395 0.02%29/Sep/05 15:37/graphics/fun/netbunnies/winniefred-morris1.jpg
395 0.02%29/Sep/05 23:46/graphics/fun/netbunnies/tusse2-Persson1.jpg
395 0.01%29/Sep/05 22:19/graphics/fun/netbunnies/rabbit1-johnson1.jpg
395 0.02%29/Sep/05 23:30/graphics/fun/netbunnies/doodles-monas1.jpg
395 0.01%29/Sep/05 18:07/graphics/fun/netbunnies/marshmellow1-corbelli1.jpg
395 0.02%29/Sep/05 22:14/graphics/fun/netbunnies/crissinina-correa1.jpg
395 0.02%29/Sep/05 20:59/graphics/fun/netbunnies/willow1-stardancer1.jpg
395 0.02%29/Sep/05 18:06/graphics/fun/netbunnies/mudslide-rhoades1.jpg
395 0.01%29/Sep/05 23:50/graphics/fun/netbunnies/thumper-roxy2-bailey1.jpg
395 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/harvey.jpg
395 0.01%29/Sep/05 21:12/graphics/fun/netbunnies/shgizzo-massimo1.jpg
395 0.01%29/Sep/05 22:28/graphics/fun/netbunnies/bunny3-karra1.jpg
395 0.08%29/Sep/05 22:54/graphics/fun/netbunnies/pitfou-reinhart1.jpg
394 0.02%29/Sep/05 23:59/graphics/fun/netbunnies/cinnabun-haviva1.jpg
394 0.01%29/Sep/05 21:38/graphics/fun/netbunnies/ned-betts1.jpg
394 0.03%29/Sep/05 23:52/graphics/fun/netbunnies/theo1-smith1.jpg
394 0.01%29/Sep/05 23:31/graphics/fun/netbunnies/babyhat-gavrilovich1.jpg
394 0.01%29/Sep/05 22:13/graphics/fun/netbunnies/max-harkrader1.jpg
394 0.02%30/Sep/05 00:01/graphics/fun/netbunnies/patches-lemke1.jpg
394 0.02%29/Sep/05 23:32/graphics/fun/netbunnies/marjoram1-ginger1.jpg
394 0.02%29/Sep/05 21:18/graphics/fun/netbunnies/rabbit-b-spence1.jpg
394 0.01%29/Sep/05 20:14/graphics/fun/netbunnies/bbyjack.jpg
394 0.01%29/Sep/05 20:58/graphics/fun/netbunnies/maybetire-ladykat1.jpg
394 0.02%29/Sep/05 19:15/graphics/fun/netbunnies/lopornotbarber.jpg
394 0.07%29/Sep/05 17:30/chapters/san-diego/aboutus/bunnyfest/Bunny Bracelet_raffle_05.jpg
394 0.01%29/Sep/05 21:49/graphics/fun/netbunnies/dillon-fairhurst1.jpg
393 0.01%29/Sep/05 22:28/graphics/fun/netbunnies/benjy3-louise1.jpg
393 0.02%29/Sep/05 21:15/graphics/fun/netbunnies/isidore-wright1.jpg
393 0.01%29/Sep/05 22:12/graphics/fun/netbunnies/chloe-rhonda1.jpg
393 0.01%29/Sep/05 23:11/graphics/fun/netbunnies/dust-Caines1.jpg
393 0.02%29/Sep/05 23:10/graphics/fun/netbunnies/bunnybag3-rott1.jpg
393 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/doe+panda-howo1.jpg
393 0.03%29/Sep/05 23:53/graphics/fun/netbunnies/sylvia-spade-easter-basket.jpg
393 0.01%29/Sep/05 23:54/rabbit-center/events.html
393 0.02%29/Sep/05 23:54/graphics/fun/netbunnies/sunny1-hansen1.jpg
393 0.01%29/Sep/05 23:52/graphics/fun/netbunnies/teriyaki-tima1.jpg
393 0.02%29/Sep/05 23:54/graphics/fun/netbunnies/sumi-lynne1.jpg
393 0.01%29/Sep/05 23:23/graphics/fun/netbunnies/benjamin-Noir1.jpg
393 0.01%29/Sep/05 23:56/graphics/fun/netbunnies/muggs-casey1.jpg
393 0.02%29/Sep/05 21:37/graphics/fun/netbunnies/bunny5-baker1.jpg
393 0.02%29/Sep/05 20:13/graphics/fun/netbunnies/bunbun-szafranski1.jpg
393 0.01%29/Sep/05 20:15/graphics/fun/netbunnies/killer-dodge1.jpg
393 0.02%29/Sep/05 20:15/graphics/fun/netbunnies/bailie-micci1.jpg
393 0.03%29/Sep/05 23:25/graphics/fun/netbunnies/chloe-mann1.jpg
392 0.01%29/Sep/05 23:57/graphics/fun/netbunnies/daphne-chen1.jpg
392 0.03%29/Sep/05 22:46/graphics/fun/netbunnies/rabbit2-Blair1.jpg
392 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/bunky2-needler1.jpg
392 0.01%29/Sep/05 20:17/graphics/fun/netbunnies/bunbun-Caines1.jpg
392 0.01%29/Sep/05 22:23/graphics/fun/netbunnies/cocobunny1-goodman1.jpg
392 0.01%29/Sep/05 23:24/graphics/fun/netbunnies/roger-harris1.jpg
392 0.03%29/Sep/05 22:23/graphics/fun/netbunnies/patch-gallandrian1.jpg
392 0.01%29/Sep/05 21:37/graphics/fun/netbunnies/pearl-espinosa1.jpg
392 0.02%29/Sep/05 23:10/graphics/fun/netbunnies/nelly3-salter1.jpg
392 0.01%29/Sep/05 22:15/graphics/fun/netbunnies/clover-pavhol1.jpg
392 29/Sep/05 22:15/graphics/fun/netbunnies/r937erin58tiny.jpg
392 0.02%29/Sep/05 23:45/graphics/fun/netbunnies/varmint-dunn1.jpg
392 0.02%29/Sep/05 19:11/graphics/fun/netbunnies/jackieabigail-johnsen1.jpg
392 0.01%29/Sep/05 22:58/graphics/fun/netbunnies/duncan13.jpg
392 0.02%29/Sep/05 20:08/graphics/fun/netbunnies/emma-manning1.jpg
392 0.01%29/Sep/05 21:18/graphics/fun/netbunnies/ears1-magee1.jpg
391 0.01%29/Sep/05 20:13/graphics/fun/netbunnies/cilantro-linares1.jpg
391 0.02%29/Sep/05 23:52/graphics/fun/netbunnies/tcereal-lamay1.jpg
391 0.02%29/Sep/05 21:08/graphics/fun/netbunnies/chloe-priscilla1.jpg
391 0.02%29/Sep/05 23:10/graphics/fun/netbunnies/dave-hamilton1.jpg
391 0.01%29/Sep/05 20:17/graphics/fun/netbunnies/reflection-Zdila1.jpg
391 0.01%29/Sep/05 20:20/graphics/fun/netbunnies/mollie1-galer1.jpg
391 0.01%29/Sep/05 23:57/graphics/fun/netbunnies/ben2-mack1.jpg
391 0.01%29/Sep/05 20:58/graphics/fun/netbunnies/lulu+inez-moore1.jpg
391 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/snowwhite_kiki_sylviaw1.jpg
391 0.02%29/Sep/05 22:54/graphics/fun/netbunnies/manny+cornelia3-santiago1.jpg
391 0.03%29/Sep/05 20:19/graphics/fun/netbunnies/bunny1-angie1.jpg
391 0.02%29/Sep/05 23:55/graphics/fun/netbunnies/benny-foofoo-rick1.jpg
391 0.02%29/Sep/05 23:10/graphics/fun/netbunnies/harvey-fuzzy2-Ko1.jpg
391 0.01%29/Sep/05 20:57/graphics/fun/netbunnies/toby3-carolyn1.jpg
391 0.02%29/Sep/05 23:24/graphics/fun/netbunnies/closecompanionsthumpersara.jpg
390 0.02%29/Sep/05 23:49/graphics/fun/netbunnies/amigos2-butcher1.jpg
390 0.01%29/Sep/05 19:28/graphics/fun/netbunnies/gwen-waters1.jpg
390 0.01%29/Sep/05 23:10/graphics/fun/netbunnies/bunbun1-chelsey1.jpg
390 0.02%29/Sep/05 22:14/graphics/fun/netbunnies/padittle_prisbrey1.jpg
390 0.01%29/Sep/05 23:54/graphics/fun/netbunnies/sungar-asa1.jpg
390 0.01%29/Sep/05 23:56/graphics/fun/netbunnies/rabbits-chang1.jpg
390 0.02%29/Sep/05 19:13/graphics/fun/netbunnies/max+ basil1-haley1.jpg
390 0.01%29/Sep/05 22:53/graphics/fun/netbunnies/daphne_dopey-chen1.jpg
390 0.02%29/Sep/05 20:11/graphics/fun/netbunnies/deckland-steven1.jpg
390 0.01%30/Sep/05 00:00/graphics/fun/netbunnies/cleanfoot.jpg
390 0.01%29/Sep/05 19:14/graphics/fun/netbunnies/daisywaisy-rmccl1.jpg
390 0.01%29/Sep/05 20:20/graphics/fun/netbunnies/ding1-kujawa1.jpg
390 0.01%29/Sep/05 20:18/graphics/fun/netbunnies/rabbit-rodriguez1.jpg
390 0.01%29/Sep/05 23:54/graphics/fun/netbunnies/rocky-Cathy1.jpg
390 0.01%29/Sep/05 23:00/graphics/fun/netbunnies/peanut-montgomery1.jpg
390 0.02%29/Sep/05 20:10/graphics/fun/netbunnies/rabbit-christenson1.jpg
390 0.01%30/Sep/05 00:00/graphics/fun/netbunnies/bunandmoose.jpg
390 0.01%29/Sep/05 22:19/graphics/fun/netbunnies/dennis-turner1.jpg
390 0.01%29/Sep/05 20:17/graphics/fun/netbunnies/snuffie-SheilaS1.jpg
390 0.01%29/Sep/05 23:57/graphics/fun/netbunnies/bunny2-libby1.jpg
390 0.02%29/Sep/05 22:53/graphics/fun/netbunnies/chester-jones1.jpg
390 0.02%29/Sep/05 22:17/graphics/fun/netbunnies/unshin2-nilgesl1.jpg
390 0.02%29/Sep/05 21:18/graphics/fun/netbunnies/pebbles8-cliff1.jpg
390 0.01%29/Sep/05 15:26/graphics/fun/netbunnies/rags-standen1.jpg
390 29/Sep/05 23:51/graphics/fun/netbunnies/beauty2.jpg
390 0.02%29/Sep/05 20:15/graphics/fun/netbunnies/lenie-jalasco1.jpg
389 0.01%29/Sep/05 20:17/graphics/fun/netbunnies/music-yoshimura1.jpg
389 0.03%29/Sep/05 21:18/graphics/fun/netbunnies/rishchris-Hunt1.jpg
389 0.01%29/Sep/05 23:00/graphics/fun/netbunnies/tink+ollie-habel1.jpg
389 0.01%29/Sep/05 18:23/graphics/fun/netbunnies/brandi2-rhoda1.jpg
389 0.03%30/Sep/05 00:01/graphics/fun/netbunnies/luna1-spotty1.jpg
389 0.03%29/Sep/05 19:11/graphics/fun/netbunnies/jesse+moby-odell1.jpg
389 0.01%29/Sep/05 22:32/chapters/san-diego/faq/graphics/faq_headergraphic_v2.jpg
389 0.01%29/Sep/05 19:22/graphics/fun/netbunnies/bart-williams1.jpg
389 0.02%29/Sep/05 22:23/graphics/fun/netbunnies/armchair-wood1.jpg
389 0.01%30/Sep/05 00:00/graphics/fun/netbunnies/missflop-hess1.jpg
389 0.01%29/Sep/05 21:21/graphics/fun/netbunnies/missamila-herrington1.jpg
389 0.01%29/Sep/05 21:26/graphics/fun/netbunnies/farmer-canade1.jpg
389 0.02%29/Sep/05 20:18/graphics/fun/netbunnies/pasha-story1.jpg
389 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/kate-haviva1.jpg
389 0.01%29/Sep/05 22:59/graphics/fun/netbunnies/meandl-dlud1.jpg
389 0.01%29/Sep/05 23:35/graphics/fun/netbunnies/riley3-charisemaria1.jpg
389 0.02%29/Sep/05 21:44/graphics/fun/netbunnies/maverick2-kirk1.jpg
389 0.09%29/Sep/05 17:30/chapters/san-diego/aboutus/bunnyfest/Bunny Cookie-jar_raffle_05.jpg
389 0.02%29/Sep/05 23:09/graphics/fun/netbunnies/snow1-nscean1.jpg
389 0.01%29/Sep/05 21:27/graphics/fun/netbunnies/pepper1-stalker1.jpg
389 0.01%29/Sep/05 23:56/graphics/fun/netbunnies/bunbun-crijo1.jpg
389 0.01%29/Sep/05 23:58/graphics/fun/netbunnies/noodles-ford1.jpg
389 0.02%29/Sep/05 23:15/graphics/fun/netbunnies/wabbit1-luumi1.jpg
388 0.01%29/Sep/05 17:26/graphics/fun/netbunnies/petey-caulders1.jpg
388 0.01%29/Sep/05 22:20/graphics/fun/netbunnies/muffy5.jpg
388 0.01%29/Sep/05 17:42/graphics/fun/netbunnies/simone5.jpg
388 0.01%29/Sep/05 19:36/graphics/fun/netbunnies/both-blue1.jpg
388 0.01%29/Sep/05 22:58/graphics/fun/netbunnies/manny+cornelia1-santiago1.jpg
388 0.01%30/Sep/05 00:01/graphics/fun/netbunnies/riley-santoro1.jpg
388 0.01%29/Sep/05 23:24/graphics/fun/netbunnies/patch-gillespie1.jpg
388 0.01%29/Sep/05 22:21/graphics/fun/netbunnies/flopsys-harem.jpg
388 0.01%29/Sep/05 21:22/graphics/fun/netbunnies/commander-hanford1.jpg
388 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/minirex-lane1.jpg
388 0.02%29/Sep/05 23:00/graphics/fun/netbunnies/nibbles-parrington1.jpg
388 0.02%29/Sep/05 18:38/graphics/fun/netbunnies/rufus-remortel1.jpg
388 0.01%29/Sep/05 23:10/graphics/fun/netbunnies/abby2-geekie1.jpg
388 0.01%29/Sep/05 21:38/graphics/fun/netbunnies/floortje-swuggers1.jpg
388 0.01%29/Sep/05 21:32/graphics/fun/netbunnies/busterbabs-schneckloth1.jpg
388 0.03%29/Sep/05 20:21/graphics/fun/netbunnies/starbuck2-gielisse1.jpg
388 0.01%29/Sep/05 17:21/graphics/fun/netbunnies/owen3-victoria1.jpg
388 0.02%29/Sep/05 22:26/graphics/fun/netbunnies/lulabelle.jpg
388 0.02%29/Sep/05 20:16/graphics/fun/netbunnies/barley-caligiuri1.jpg
388 0.01%29/Sep/05 21:37/graphics/fun/netbunnies/george-julie1.jpg
388 0.04%29/Sep/05 20:15/graphics/fun/netbunnies/cadbury-martin1.jpg
388 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/bunny2-osborne1.jpg
388 0.02%29/Sep/05 20:17/graphics/fun/netbunnies/rabbitssnow-Gerritsen1.jpg
387 0.03%29/Sep/05 23:57/graphics/fun/netbunnies/snuffles-quasebarth1.jpg
387 0.02%29/Sep/05 20:18/graphics/fun/netbunnies/bunny10.jpg
387 0.05%29/Sep/05 23:09/chapters/san-diego/adoption/Adoption_Photos/Cody_adoption_26Jul05.jpg
387 0.02%29/Sep/05 23:00/graphics/fun/netbunnies/baxter-snyder1.jpg
387 0.01%29/Sep/05 23:32/graphics/fun/netbunnies/boo-wal1.jpg
387 0.01%29/Sep/05 18:05/graphics/fun/netbunnies/custard-connor1.jpg
387 0.01%29/Sep/05 18:10/graphics/fun/netbunnies/willie2-martin1.jpg
387 0.01%29/Sep/05 23:56/graphics/fun/netbunnies/bunny3-basmayer1.jpg
387 0.01%29/Sep/05 23:11/graphics/fun/netbunnies/amelia1-shay1.jpg
387 0.01%29/Sep/05 20:20/graphics/fun/netbunnies/lucky-woofenden1.jpg
387 0.03%29/Sep/05 22:54/graphics/fun/netbunnies/kobe2-segers1.jpg
387 0.02%29/Sep/05 19:22/graphics/fun/netbunnies/bunny4-lee1.jpg
387 0.25%29/Sep/05 17:30/chapters/san-diego/aboutus/bunnyfest/Bunny Mag-Glass_raffle_05.jpg
387 0.01%29/Sep/05 22:16/graphics/fun/netbunnies/ben-trent1.jpg
387 0.02%29/Sep/05 22:19/graphics/fun/netbunnies/rabbits-sargeant1.jpg
387 0.01%29/Sep/05 23:57/graphics/fun/netbunnies/emmett-erin1.jpg
387 0.01%30/Sep/05 00:00/graphics/fun/netbunnies/dixie-ryder1.jpg
387 0.01%29/Sep/05 21:03/graphics/fun/netbunnies/jackie.jpg
386 0.03%29/Sep/05 22:53/graphics/fun/netbunnies/buns1-schnellbach1.jpg
386 0.01%29/Sep/05 23:56/graphics/fun/netbunnies/firstLitter-Stack1.jpg
386 0.01%29/Sep/05 23:54/graphics/fun/netbunnies/brownie2.jpg
386 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/maplecocoa-cook1.jpg
386 0.02%29/Sep/05 20:14/graphics/fun/netbunnies/bunnies-hayse1.jpg
386 0.01%29/Sep/05 20:57/graphics/fun/netbunnies/fruitloop-debbie1.jpg
386 0.01%29/Sep/05 22:53/graphics/fun/netbunnies/mabel-anderson1.jpg
386 0.02%29/Sep/05 23:11/graphics/fun/netbunnies/haemish-erin1.jpg
386 0.01%29/Sep/05 19:14/graphics/fun/netbunnies/sleepingbabies-napieralski1.jpg
386 0.01%29/Sep/05 21:18/graphics/fun/netbunnies/bunnylove-walker1.jpg
386 0.02%29/Sep/05 23:35/graphics/fun/netbunnies/matilda-katrina1.jpg
386 0.03%29/Sep/05 23:25/graphics/fun/netbunnies/petunia-wittenkeller1.jpg
386 0.01%29/Sep/05 20:57/graphics/fun/netbunnies/makandaun.jpg
386 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/pichi1-lopez1.jpg
386 0.02%29/Sep/05 22:28/graphics/fun/netbunnies/bonnie-gazan1.jpg
386 0.01%29/Sep/05 23:23/graphics/fun/netbunnies/bunny3-pearson1.jpg
386 0.01%29/Sep/05 18:47/graphics/fun/netbunnies/fancy1-fraleigh1.jpg
386 0.01%29/Sep/05 18:32/graphics/fun/netbunnies/basketofbuns-sharwell1.jpg
386 0.01%29/Sep/05 23:11/graphics/fun/netbunnies/werls-arobinson1.jpg
386 0.02%29/Sep/05 23:09/graphics/fun/netbunnies/lilith-emaleth1.jpg
386 0.01%30/Sep/05 00:01/graphics/fun/netbunnies/dusty-khan1.jpg
386 0.01%29/Sep/05 21:11/chapters/san-diego/behavior/altering.html
386 0.01%29/Sep/05 23:10/graphics/fun/netbunnies/bunny4-spence1.jpg
386 0.02%29/Sep/05 18:44/graphics/fun/netbunnies/stew-morgans1.jpg
386 0.02%29/Sep/05 23:53/graphics/fun/netbunnies/nicke-igen1.jpg
386 0.02%29/Sep/05 20:55/graphics/fun/netbunnies/fuzzy_harley4-ko1.jpg
386 0.01%29/Sep/05 20:15/graphics/fun/netbunnies/duncan2-ciuffo1.jpg
386 0.03%29/Sep/05 18:07/graphics/fun/netbunnies/bunbun-apaluch1.jpg
386 0.01%29/Sep/05 23:11/graphics/fun/netbunnies/midnight-pasquarello1.jpg
385 0.01%29/Sep/05 22:12/graphics/fun/netbunnies/dcp.jpg
385 0.02%29/Sep/05 21:40/graphics/fun/netbunnies/bun1-cabin1.jpg
385 0.02%29/Sep/05 17:37/graphics/fun/netbunnies/arwen1-pritchard1.jpg
385 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/chelsee-gordon1.jpg
385 0.01%29/Sep/05 20:13/graphics/fun/netbunnies/m2.jpg
385 0.02%29/Sep/05 21:38/graphics/fun/netbunnies/onemore-yong1.jpg
385 0.01%29/Sep/05 20:18/graphics/fun/netbunnies/nona-barrett1.jpg
385 0.02%30/Sep/05 00:03/graphics/fun/netbunnies/herdoc-gerdoc-9wks-on-backs.jpg
385 0.02%29/Sep/05 19:10/graphics/fun/netbunnies/flopster-francisco1.jpg
385 0.01%30/Sep/05 00:01/graphics/fun/netbunnies/oreo-samantha1.jpg
385 0.02%29/Sep/05 20:15/graphics/fun/netbunnies/pepperout2-beautylies1.jpg
385 0.01%29/Sep/05 22:23/graphics/fun/netbunnies/buns2-schnellbach1.jpg
385 0.01%29/Sep/05 20:08/graphics/fun/netbunnies/fluffy-hosein1.jpg
385 0.02%29/Sep/05 19:37/graphics/fun/netbunnies/oreo-donovan1.jpg
385 0.01%29/Sep/05 21:37/graphics/fun/netbunnies/mitchcharlie2-thompson1.jpg
385 0.02%29/Sep/05 23:58/graphics/fun/netbunnies/natasha-anderson1.jpg
385 0.01%29/Sep/05 23:35/graphics/fun/netbunnies/nutmeg-Nilgesda1.jpg
385 0.02%29/Sep/05 23:25/graphics/fun/netbunnies/dakota1-angelo1.jpg
385 0.02%29/Sep/05 22:22/graphics/fun/netbunnies/hernandobunny-joanna1.jpg
385 0.01%29/Sep/05 23:35/graphics/fun/netbunnies/boba4-shi1.jpg
385 0.01%29/Sep/05 19:40/graphics/fun/netbunnies/boo-long1.jpg
385 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/rura1-Anna1.jpg
385 0.01%29/Sep/05 19:10/graphics/fun/netbunnies/jess2.jpg
385 0.02%29/Sep/05 22:22/graphics/fun/netbunnies/lily3-schroeder1.jpg
385 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/bugs-danaher1.jpg
385 0.01%30/Sep/05 00:03/graphics/fun/netbunnies/fred-bubble1.jpg
384 0.02%29/Sep/05 22:09/rabbit-center/hayward_rescue/hayward_graphics/abscess_exam.jpg
384 29/Sep/05 18:34/graphics/fun/netbunnies/maggie-Dooley1.jpg
384 0.03%29/Sep/05 20:21/graphics/fun/netbunnies/eliott-9mon-hopp-bag.jpg
384 0.01%29/Sep/05 20:57/graphics/fun/netbunnies/foofoo-mattos1.jpg
384 0.01%29/Sep/05 23:09/chapters/san-diego/adoption/Adoption_Photos/Madeline_Adoption_3Jul05.jpg
384 0.02%29/Sep/05 22:18/graphics/fun/netbunnies/marble-haviva1.jpg
384 0.02%29/Sep/05 20:09/graphics/fun/netbunnies/high2.jpg
384 0.01%29/Sep/05 23:25/graphics/fun/netbunnies/penelope-Plourde1.jpg
384 0.01%30/Sep/05 00:03/graphics/fun/netbunnies/blade-Ian1.jpg
384 0.01%29/Sep/05 20:16/graphics/fun/netbunnies/merry-clark1.jpg
384 0.01%29/Sep/05 23:40/links/sections/allywebpage.html
384 0.01%29/Sep/05 22:59/graphics/fun/netbunnies/jack2-Hir1.jpg
384 0.02%29/Sep/05 17:11/graphics/fun/netbunnies/brulee+hudson-beeline1.jpg
384 0.01%29/Sep/05 23:53/graphics/fun/netbunnies/tabitha-leung1.jpg
384 0.02%29/Sep/05 21:39/graphics/fun/netbunnies/chubbs-daisy1-esquivel1.jpg
383 29/Sep/05 23:58/graphics/fun/netbunnies/lightning-sagartz1.jpg
383 0.01%29/Sep/05 21:18/graphics/fun/netbunnies/cuddles+lillian-porter1.jpg
383 0.01%29/Sep/05 23:54/graphics/fun/netbunnies/bunnybutts3-spence1.jpg
383 0.01%29/Sep/05 20:54/graphics/fun/netbunnies/floyd1-medel1.jpg
383 0.01%29/Sep/05 20:57/graphics/fun/netbunnies/rocketpeaches5-sears1.jpg
383 0.01%29/Sep/05 20:15/graphics/fun/netbunnies/radarears-walker1.jpg
383 0.02%29/Sep/05 19:15/graphics/fun/netbunnies/bunny1-braun1.jpg
383 0.01%29/Sep/05 18:30/graphics/fun/netbunnies/elwood1-cook1.jpg
383 0.01%29/Sep/05 23:31/graphics/fun/netbunnies/rabbits2-yu1.jpg
383 0.01%29/Sep/05 15:31/graphics/fun/netbunnies/rex-joe1.jpg
383 0.01%29/Sep/05 23:56/graphics/fun/netbunnies/fluff2-lee1.jpg
383 0.02%29/Sep/05 20:15/graphics/fun/netbunnies/nyuszo-zsuzsanna1.jpg
383 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/joey2-grinnel1.jpg
383 0.01%29/Sep/05 22:14/graphics/fun/netbunnies/sofee-friedmann1.jpg
383 0.01%29/Sep/05 20:08/graphics/fun/netbunnies/nevat-puyol1.jpg
383 0.01%29/Sep/05 20:17/graphics/fun/netbunnies/peter1-prichard1.jpg
383 0.01%29/Sep/05 18:40/graphics/fun/netbunnies/rudi-scherkamp.jpg
383 0.03%29/Sep/05 22:12/graphics/fun/netbunnies/inky1.jpg
383 0.02%29/Sep/05 23:55/graphics/fun/netbunnies/becky-sugalski1.jpg
383 0.01%29/Sep/05 20:17/graphics/fun/netbunnies/sable2.jpg
383 0.01%29/Sep/05 15:32/graphics/fun/netbunnies/carnie-wright1.jpg
382 0.01%29/Sep/05 23:09/graphics/fun/netbunnies/websterlopwabbit.jpg
382 0.01%29/Sep/05 20:12/graphics/fun/netbunnies/cb4-fraleigh1.jpg
382 0.01%29/Sep/05 20:21/graphics/fun/netbunnies/bubba3.jpg
382 0.02%29/Sep/05 21:32/graphics/fun/netbunnies/bunflowers-flaherty1.jpg
382 0.01%29/Sep/05 23:56/graphics/fun/netbunnies/candy1-asa1.jpg
382 0.02%29/Sep/05 23:25/graphics/fun/netbunnies/moose-katievic1.jpg
382 0.01%29/Sep/05 18:59/graphics/fun/netbunnies/bunnies6-doerfler1.jpg
382 0.01%29/Sep/05 20:12/graphics/fun/netbunnies/bunny-fischer1.jpg
382 0.02%29/Sep/05 23:51/graphics/fun/netbunnies/earth2-toong1.jpg
382 0.01%29/Sep/05 21:38/graphics/fun/netbunnies/kanit1-makela1.jpg
382 0.02%29/Sep/05 21:26/graphics/fun/netbunnies/frankie-phelan1.jpg
382 0.03%29/Sep/05 19:29/graphics/fun/netbunnies/stormy-whelchel1.jpg
382 0.02%29/Sep/05 23:32/graphics/fun/netbunnies/bigwig+sugaree-bielawski1.jpg
382 29/Sep/05 23:11/graphics/fun/netbunnies/bunny2-chica1.jpg
382 0.01%29/Sep/05 22:59/graphics/fun/netbunnies/rabbits-tonge1.jpg
382 0.02%29/Sep/05 18:06/graphics/fun/netbunnies/rabbit1-lau1.jpg
382 0.02%29/Sep/05 22:53/graphics/fun/netbunnies/kiss2-Kirkham1.jpg
382 0.02%29/Sep/05 20:16/graphics/fun/netbunnies/fluff-kraina1.jpg
382 0.01%29/Sep/05 23:57/graphics/fun/netbunnies/princess-pendergast1.jpg
382 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/victo-slemp1.jpg
381 0.01%29/Sep/05 20:16/graphics/fun/netbunnies/snugglesnoodles-Yoder1.jpg
381 0.01%29/Sep/05 22:13/graphics/fun/netbunnies/rabbit-mondragon1.jpg
381 29/Sep/05 23:51/chapters/san-francisco/logo.gif
381 0.01%29/Sep/05 21:12/graphics/fun/netbunnies/chkrspearl.jpg
381 0.02%29/Sep/05 22:12/graphics/fun/netbunnies/bunny1-Zisser1.jpg
381 0.02%29/Sep/05 23:10/graphics/fun/netbunnies/melizard1-joy1.jpg
381 0.02%29/Sep/05 21:25/graphics/fun/netbunnies/floppy-lim1.jpg
381 0.01%29/Sep/05 20:15/graphics/fun/netbunnies/sammy-lea1.jpg
381 0.01%29/Sep/05 22:20/graphics/fun/netbunnies/pic00018.jpg
381 0.02%29/Sep/05 20:15/graphics/fun/netbunnies/moneybunny-anderson1.jpg
381 0.01%29/Sep/05 23:04/graphics/fun/netbunnies/patty2-mckinnon1.jpg
381 0.02%29/Sep/05 18:04/graphics/fun/netbunnies/riley1-charisemaria1.jpg
381 0.01%29/Sep/05 23:10/graphics/fun/netbunnies/bunny-morton1.jpg
381 0.02%29/Sep/05 20:15/graphics/fun/netbunnies/bunnys1-tarkan1.jpg
381 0.02%29/Sep/05 20:16/graphics/fun/netbunnies/hamilton-camelot1.jpg
381 0.02%29/Sep/05 18:48/graphics/fun/netbunnies/bunny-schaffer1.jpg
381 0.01%30/Sep/05 00:05/graphics/fun/netbunnies/bunny4-heinsma1.jpg
381 0.01%29/Sep/05 23:01/graphics/fun/netbunnies/rabbits-sukiennik1.jpg
381 0.02%29/Sep/05 20:14/graphics/fun/netbunnies/maybe-kat1.jpg
381 0.02%30/Sep/05 00:02/graphics/fun/netbunnies/sagechris1-Hunt1.jpg
381 0.02%29/Sep/05 22:53/graphics/fun/netbunnies/munches-gilreath1.jpg
381 0.01%29/Sep/05 19:31/graphics/fun/netbunnies/otto-ninespike1.jpg
380 0.01%29/Sep/05 21:27/graphics/fun/netbunnies/bunny2-heinsma1.jpg
380 0.01%29/Sep/05 23:25/graphics/fun/netbunnies/belle-torgomama1.jpg
380 0.02%29/Sep/05 20:21/graphics/fun/netbunnies/untitled1-salas1.jpg
380 0.01%29/Sep/05 21:36/graphics/fun/netbunnies/glamorous.jpg
380 0.01%29/Sep/05 20:17/graphics/fun/netbunnies/belle1-capps1.jpg
380 0.01%29/Sep/05 23:27/graphics/fun/netbunnies/eeyore1-herrod1.jpg
380 0.02%29/Sep/05 23:35/graphics/fun/netbunnies/pippin2-casteneda1.jpg
380 0.01%29/Sep/05 20:57/graphics/fun/netbunnies/nut2-makuh1.jpg
380 0.02%29/Sep/05 21:39/graphics/fun/netbunnies/bunnies4-broley1.jpg
380 0.01%29/Sep/05 23:59/graphics/fun/netbunnies/elliot2-cote1.jpg
380 0.02%29/Sep/05 22:49/chapters/san-diego/behavior/travel.html
380 0.02%29/Sep/05 21:08/graphics/fun/netbunnies/bunnies1-prairie1.jpg
380 0.01%29/Sep/05 23:54/graphics/fun/netbunnies/dotdot_van1.jpg
380 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/foozle-singleton1.jpg
380 0.01%29/Sep/05 21:39/graphics/fun/netbunnies/floyd-ugval1.jpg
380 0.02%29/Sep/05 23:51/graphics/fun/netbunnies/nelly2-salter1.jpg
380 0.02%29/Sep/05 23:12/graphics/fun/netbunnies/lavender.jpg
380 0.01%29/Sep/05 20:16/graphics/fun/netbunnies/bunbun7-lo1.jpg
380 0.01%29/Sep/05 23:09/chapters/san-diego/adoption/Adoption_Photos/Simon_adoption_Jun05.jpg
380 0.01%29/Sep/05 23:56/graphics/fun/netbunnies/rabbit-ellen1.jpg
380 0.02%29/Sep/05 23:10/graphics/fun/netbunnies/buckyshadow-jackson1.jpg
380 0.02%29/Sep/05 19:11/graphics/fun/netbunnies/cuddles-ingram1.jpg
380 0.01%29/Sep/05 17:39/graphics/fun/netbunnies/cammie-thiene1.jpg
380 0.01%29/Sep/05 22:14/graphics/fun/netbunnies/rabbit-adam1.jpg
380 0.02%29/Sep/05 20:10/graphics/fun/netbunnies/robbie-dauzat1.jpg
380 0.03%29/Sep/05 19:10/graphics/fun/netbunnies/roy1-bunnylvr1.jpg
380 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/ginger2-herrington1.jpg
380 0.02%29/Sep/05 21:17/graphics/fun/netbunnies/owen-anderson1.jpg
380 29/Sep/05 23:09/chapters/san-diego/adoption/Adoption_Photos/Penelope_adoption_3Jul05.jpg
380 0.01%29/Sep/05 19:40/graphics/fun/netbunnies/dakota2-angelo1.jpg
379 0.02%29/Sep/05 21:37/graphics/fun/netbunnies/sasha--shorty1.jpg
379 0.02%29/Sep/05 22:54/graphics/fun/netbunnies/pru3-ha1.jpg
379 0.01%29/Sep/05 20:18/graphics/fun/netbunnies/oeddie-henry1.jpg
379 0.01%29/Sep/05 23:55/graphics/fun/netbunnies/ruby1-vogel1.jpg
379 0.01%29/Sep/05 23:25/graphics/fun/netbunnies/paul24-Tini1.jpg
379 0.01%29/Sep/05 23:23/graphics/fun/netbunnies/bunny1-chica1.jpg
379 0.01%29/Sep/05 23:54/graphics/fun/netbunnies/trio-nye1.jpg
379 0.01%29/Sep/05 23:33/graphics/fun/netbunnies/nicke1-Olsson1.jpg
379 0.01%29/Sep/05 20:09/graphics/fun/netbunnies/chocolate1-ko1.jpg
379 0.01%29/Sep/05 15:32/graphics/fun/netbunnies/bunny.jpg
379 0.01%29/Sep/05 23:01/graphics/fun/netbunnies/dexterothers-santos1.jpg
379 0.01%29/Sep/05 20:20/graphics/fun/netbunnies/ivan1-sierra1.jpg
379 0.01%29/Sep/05 23:52/graphics/fun/netbunnies/thegirls.jpg
379 0.02%29/Sep/05 22:54/graphics/fun/netbunnies/sesarog-hos1.jpg
379 0.01%29/Sep/05 23:28/graphics/fun/netbunnies/bunny8-Baker1.jpg
379 0.01%30/Sep/05 00:00/graphics/fun/netbunnies/rabbit-Timcoe1.jpg
379 0.01%29/Sep/05 23:49/graphics/fun/netbunnies/XmasAngel1-Williamson1.jpg
379 0.03%29/Sep/05 21:11/graphics/fun/netbunnies/lopingrass.jpg
379 0.04%29/Sep/05 20:14/graphics/fun/netbunnies/cookie-lovell1.jpg
379 0.01%29/Sep/05 20:13/graphics/fun/netbunnies/midnight1-pasquarello1.jpg
379 0.01%29/Sep/05 17:38/graphics/fun/netbunnies/rabbits5-reeves1.jpg
379 0.02%29/Sep/05 22:53/graphics/fun/netbunnies/blueberry2-perillat1.jpg
379 0.02%29/Sep/05 20:12/graphics/fun/netbunnies/benny-applin1.jpg
379 0.01%29/Sep/05 18:07/graphics/fun/netbunnies/funia-izabella1.jpg
379 0.03%29/Sep/05 22:24/graphics/fun/netbunnies/noble-schaaf1.jpg
379 0.01%29/Sep/05 22:27/graphics/fun/netbunnies/chopper-Raymond1.jpg
379 0.02%29/Sep/05 22:54/graphics/fun/netbunnies/lester1-bowser1.jpg
379 0.02%29/Sep/05 21:09/graphics/fun/netbunnies/brewster-chiang1.jpg
379 0.01%29/Sep/05 23:51/graphics/fun/netbunnies/oliver-habel1.jpg
379 0.02%29/Sep/05 23:35/graphics/fun/netbunnies/cb-fraleigh1.jpg
379 0.01%29/Sep/05 21:22/graphics/fun/netbunnies/hailey-politzer1.jpg
379 0.02%29/Sep/05 22:54/graphics/fun/netbunnies/bunny-nelson1.jpg
379 0.03%30/Sep/05 00:03/graphics/fun/netbunnies/roy-ford1.jpg
379 0.02%29/Sep/05 22:17/graphics/fun/netbunnies/simmie1-ang1.jpg
379 0.01%30/Sep/05 00:00/graphics/fun/netbunnies/murphy-intelligoth1.jpg
379 0.01%29/Sep/05 20:17/graphics/fun/netbunnies/frenchyhall-lorian1.jpg
378 0.01%29/Sep/05 20:55/graphics/fun/netbunnies/harry3-mayers1.jpg
378 0.02%29/Sep/05 18:18/graphics/fun/netbunnies/rabbit-chercat1.jpg
378 0.03%29/Sep/05 18:48/graphics/fun/netbunnies/shadow2-miller1.jpg
378 0.01%29/Sep/05 22:45/graphics/fun/netbunnies/dusty-venlou1.jpg
378 0.02%29/Sep/05 22:54/graphics/fun/netbunnies/rabbit-Castillo1.jpg
378 0.02%29/Sep/05 20:08/graphics/fun/netbunnies/rabbit4-birgit1.jpg
378 0.02%29/Sep/05 23:56/graphics/fun/netbunnies/jamie-perry1.jpg
378 0.01%29/Sep/05 19:14/graphics/fun/netbunnies/snowball-Veres1.jpg
378 0.02%29/Sep/05 22:13/graphics/fun/netbunnies/bunny2-wu1.jpg
378 0.02%29/Sep/05 20:15/graphics/fun/netbunnies/bunnies1-clements1.jpg
378 0.01%29/Sep/05 23:53/graphics/fun/netbunnies/sweetpea4-walter1.jpg
378 0.02%29/Sep/05 22:15/graphics/fun/netbunnies/garth-robinson1.jpg
378 0.02%29/Sep/05 20:08/graphics/fun/netbunnies/sammy-richard1.jpg
378 0.01%29/Sep/05 17:27/graphics/fun/netbunnies/trinityhiphop-fischer1.jpg
378 0.01%29/Sep/05 20:13/graphics/fun/netbunnies/bungee-maclellan1.jpg
378 0.01%29/Sep/05 18:24/graphics/fun/netbunnies/peanut+duke-Bud1.jpg
378 0.03%29/Sep/05 20:15/graphics/fun/netbunnies/montythumper1-carpenter1.jpg
378 0.02%29/Sep/05 23:09/graphics/fun/netbunnies/dip1-tagliamonte1.jpg
378 29/Sep/05 22:54/graphics/fun/netbunnies/fuzz1.jpg
378 0.01%29/Sep/05 20:17/graphics/fun/netbunnies/nuala10.jpg
378 0.01%29/Sep/05 23:23/graphics/fun/netbunnies/bullet-gannon1.jpg
378 0.01%29/Sep/05 21:38/graphics/fun/netbunnies/lily-noir1.jpg
378 0.01%29/Sep/05 22:14/graphics/fun/netbunnies/clover3-sumanski1.jpg
378 0.03%29/Sep/05 20:15/graphics/fun/netbunnies/pepper-lop-leikers.jpg
378 0.01%30/Sep/05 00:00/graphics/fun/netbunnies/hermione2-tourret1.jpg
378 0.02%29/Sep/05 20:11/graphics/fun/netbunnies/hopalong-tucker1.jpg
377 0.02%29/Sep/05 20:12/graphics/fun/netbunnies/nidoran-correa1.jpg
377 29/Sep/05 22:46/fun/reader-photos.html
377 0.01%29/Sep/05 23:03/graphics/fun/netbunnies/four-Zdila1.jpg
377 0.03%30/Sep/05 00:02/graphics/fun/netbunnies/bunjie-Obsenica1.jpg
377 0.01%30/Sep/05 00:01/graphics/fun/netbunnies/mackenzie-cunningham1.jpg
377 0.02%29/Sep/05 22:21/graphics/fun/netbunnies/millicent-steve2-ha1.jpg
377 0.01%29/Sep/05 23:53/graphics/fun/netbunnies/sylvester-Hadjigeorgiou1.jpg
377 0.01%29/Sep/05 23:54/graphics/fun/netbunnies/midnight-dawn1.jpg
377 0.02%29/Sep/05 19:21/graphics/fun/netbunnies/peter2-pritchard1.jpg
377 0.01%29/Sep/05 21:03/graphics/fun/netbunnies/f1.jpg
377 0.01%29/Sep/05 23:55/graphics/fun/netbunnies/scotty-kuryuzawa1.jpg
377 0.02%29/Sep/05 17:33/graphics/fun/netbunnies/merlin-manning1.jpg
377 0.02%29/Sep/05 22:53/graphics/fun/netbunnies/bailey1-erin1.jpg
377 0.01%29/Sep/05 23:58/graphics/fun/netbunnies/sleepbu-ndren1.jpg
377 0.02%29/Sep/05 23:57/graphics/fun/netbunnies/garden-fischer1.jpg
377 0.01%29/Sep/05 20:10/graphics/fun/netbunnies/mvc.jpg
377 0.02%29/Sep/05 21:36/graphics/fun/netbunnies/nick-athensgold1.jpg
377 29/Sep/05 21:18/graphics/fun/netbunnies/r956amber42tiny.jpg
377 0.02%29/Sep/05 20:20/graphics/fun/netbunnies/rabbits-millikin1.jpg
377 0.02%29/Sep/05 20:19/graphics/fun/netbunnies/boomer-frolich1.jpg
377 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/henry1-may1.jpg
377 0.02%29/Sep/05 21:37/graphics/fun/netbunnies/cadbury-gilbert1.jpg
377 0.01%29/Sep/05 23:49/journal/3-11/thorax.html
377 29/Sep/05 22:20/hrs-info/philosophy.html
376 0.02%29/Sep/05 21:40/graphics/fun/netbunnies/bunnyinbox-Leatherdale1.jpg
376 0.01%29/Sep/05 21:04/chapters/san-diego/adoption/company.html
376 0.02%29/Sep/05 21:25/hrs-info/vet-conference/attendees-alpha.html
376 0.01%29/Sep/05 22:12/graphics/fun/netbunnies/sage2.jpg
376 0.01%29/Sep/05 21:38/graphics/fun/netbunnies/kralina-springerova1.jpg
376 0.01%29/Sep/05 21:11/graphics/fun/netbunnies/peaches-blanchard1.jpg
376 0.02%29/Sep/05 20:54/graphics/fun/netbunnies/cinnamon3-carisbug1.jpg
376 0.01%29/Sep/05 18:43/graphics/fun/netbunnies/leiniegoof.jpg
376 0.01%29/Sep/05 23:09/chapters/san-diego/adoption/Adoption_Photos/BJ_adopt_composite.jpg
376 0.01%29/Sep/05 19:28/graphics/fun/netbunnies/rabbits4-reeves1.jpg
376 0.01%29/Sep/05 22:20/graphics/fun/netbunnies/bandit-wachowiak1.jpg
376 0.01%29/Sep/05 23:55/graphics/fun/netbunnies/gangFour-Zdila1.jpg
376 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/janks1-kelly1.jpg
376 0.01%30/Sep/05 00:00/graphics/fun/netbunnies/kuzya-katz1.jpg
376 0.01%29/Sep/05 20:09/graphics/fun/netbunnies/weenie-smith1.jpg
376 0.02%29/Sep/05 23:52/graphics/fun/netbunnies/tepp1-noa1.jpg
376 0.02%29/Sep/05 22:16/graphics/fun/netbunnies/muggsie2-nilgesl1.jpg
376 0.01%29/Sep/05 21:13/graphics/fun/netbunnies/cozybun2.jpg
376 0.01%29/Sep/05 23:52/graphics/fun/netbunnies/threebunny-winarchick1.jpg
376 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/nibbles-floyd1.jpg
376 0.01%29/Sep/05 23:59/graphics/fun/netbunnies/scotchcutie-thomas1.jpg
375 0.01%29/Sep/05 21:38/graphics/fun/netbunnies/ginger1-leen1.jpg
375 0.01%29/Sep/05 23:49/graphics/fun/netbunnies/samantha2-sousa1.jpg
375 0.01%29/Sep/05 20:14/graphics/fun/netbunnies/bess-smith1.jpg
375 0.01%29/Sep/05 20:16/graphics/fun/netbunnies/kobalt-ugarenko1.jpg
375 0.01%29/Sep/05 20:12/graphics/fun/netbunnies/fellafoot-silver1.jpg
375 0.01%29/Sep/05 23:31/graphics/fun/netbunnies/bunny1-Baker1.jpg
375 0.01%29/Sep/05 21:03/graphics/fun/netbunnies/eric1.jpg
375 0.01%29/Sep/05 20:11/graphics/fun/netbunnies/meme-Bridenbaugh1.jpg
375 29/Sep/05 22:58/journal/1/sara.html
375 0.01%29/Sep/05 22:24/graphics/fun/netbunnies/rabbit1-sheetz1.jpg
375 0.02%29/Sep/05 17:34/graphics/fun/netbunnies/lapinface.jpg
375 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/stewit-Clifford1.jpg
375 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/tzapko-mu1.jpg
375 0.01%29/Sep/05 19:39/graphics/fun/netbunnies/bunnies1-kimberley1.jpg
375 0.01%29/Sep/05 20:21/graphics/fun/netbunnies/cam.jpg
375 0.01%29/Sep/05 23:09/chapters/san-diego/adoption/Adoption_Photos/Sammie_adoption_20Jun05.jpg
375 0.01%30/Sep/05 00:00/graphics/fun/netbunnies/happyfeet-Daniels1.jpg
375 0.01%29/Sep/05 23:42/graphics/fun/netbunnies/Amy-garcia1.jpg
375 0.01%29/Sep/05 22:53/graphics/fun/netbunnies/kissmeliss-ndren1.jpg
375 0.01%29/Sep/05 23:30/graphics/fun/netbunnies/queenofthehill2.jpg
375 0.01%30/Sep/05 00:03/graphics/fun/netbunnies/soleil-racicot1.jpg
374 0.01%29/Sep/05 21:20/graphics/fun/netbunnies/smokey+daisy-jack1.jpg
374 0.01%29/Sep/05 22:22/graphics/fun/netbunnies/dopey_daphne-chen1.jpg
374 0.01%29/Sep/05 18:39/graphics/fun/netbunnies/boanddoja.jpg
374 0.01%29/Sep/05 23:00/graphics/fun/netbunnies/bunnies2-kimberley1.jpg
374 0.02%29/Sep/05 22:25/graphics/fun/netbunnies/kili-kamp1.jpg
374 0.03%29/Sep/05 19:36/graphics/fun/netbunnies/robbie1-oneal1.jpg
374 0.01%29/Sep/05 21:12/graphics/fun/netbunnies/cal.jpg
374 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/grethel-broley1.jpg
374 0.01%29/Sep/05 21:40/graphics/fun/netbunnies/buster-nad1.jpg
374 0.01%29/Sep/05 22:22/graphics/fun/netbunnies/rabbit2-young1.jpg
374 0.02%29/Sep/05 23:10/graphics/fun/netbunnies/bubbles-wilkinson1.jpg
374 0.02%29/Sep/05 22:54/graphics/fun/netbunnies/granger-wiener1.jpg
374 0.01%29/Sep/05 20:57/graphics/fun/netbunnies/spencer-pinecone.jpg
374 0.01%29/Sep/05 20:16/graphics/fun/netbunnies/uyy-holden1.jpg
374 0.01%29/Sep/05 23:24/graphics/fun/netbunnies/bunzone2.jpg
374 0.01%29/Sep/05 20:15/graphics/fun/netbunnies/nibbs1.jpg
374 0.02%29/Sep/05 23:58/graphics/fun/netbunnies/hazel-majane1.jpg
374 0.02%29/Sep/05 17:15/graphics/fun/netbunnies/whospilled-copple1.jpg
374 0.01%29/Sep/05 20:20/graphics/fun/netbunnies/p_minc.jpg
373 29/Sep/05 18:34/links/sections/nc-find120x90.gif
373 0.01%29/Sep/05 20:58/graphics/fun/netbunnies/jessica-Guthrie1.jpg
373 0.01%29/Sep/05 20:58/graphics/fun/netbunnies/starr1-pangia1.jpg
373 0.02%29/Sep/05 21:09/chapters/san-diego/aboutus/bunnyfest/auction_photos-2004.html
373 0.01%29/Sep/05 22:46/graphics/fun/netbunnies/bunniesgroup-darcey1.jpg
373 0.01%29/Sep/05 21:18/graphics/fun/netbunnies/mfaces.jpg
373 0.01%29/Sep/05 18:47/graphics/fun/netbunnies/rudi-scherkamp1.jpg
373 0.01%29/Sep/05 20:59/graphics/fun/netbunnies/fripouille-having-a-nap.jpg
373 0.01%29/Sep/05 22:53/graphics/fun/netbunnies/binkyaustin3-rhonda1.jpg
373 0.01%29/Sep/05 19:40/graphics/fun/netbunnies/oreo-angela1.jpg
373 0.01%29/Sep/05 23:09/chapters/san-diego/adoption/Adoption_Photos/Mimi_adoption_Jun05.jpg
373 0.02%29/Sep/05 17:29/graphics/fun/netbunnies/oreo-riefle1.jpg
373 0.01%29/Sep/05 23:59/graphics/fun/netbunnies/phoebe-gumpel1.jpg
373 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/billy-sharwell1.jpg
373 0.01%29/Sep/05 18:44/graphics/fun/netbunnies/pidder-howard1.jpg
373 0.01%29/Sep/05 22:15/graphics/fun/netbunnies/biscus-schtomp-davidson1.jpg
373 0.02%29/Sep/05 21:07/graphics/fun/netbunnies/rabbits2-sargeant1.jpg
373 0.01%29/Sep/05 20:05/graphics/fun/netbunnies/smokey4-morris1.jpg
372 0.01%29/Sep/05 21:22/graphics/fun/netbunnies/chloe2-cote1.jpg
372 0.02%29/Sep/05 22:53/graphics/fun/netbunnies/bella1-beth1.jpg
372 0.01%29/Sep/05 23:23/graphics/fun/netbunnies/jo-m.jpg
372 0.02%29/Sep/05 23:52/graphics/fun/netbunnies/kiwi1-kaczmarski1.jpg
372 0.01%29/Sep/05 23:56/graphics/fun/netbunnies/rory-jnr1.jpg
372 0.01%30/Sep/05 00:00/graphics/fun/netbunnies/daisy4-schnellbach1.jpg
372 0.01%29/Sep/05 20:09/graphics/fun/netbunnies/shag-tammy1.jpg
372 29/Sep/05 23:44/journal/2-5/enteritis.html
372 0.01%29/Sep/05 21:13/graphics/fun/netbunnies/bunpic-aird1.jpg
372 0.01%29/Sep/05 21:26/graphics/fun/netbunnies/josper-metsavir1.jpg
372 0.03%29/Sep/05 19:40/graphics/fun/netbunnies/ninus-andersen1.jpg
372 0.02%29/Sep/05 18:58/graphics/fun/netbunnies/magic-sanders1.jpg
372 0.03%29/Sep/05 19:12/graphics/fun/netbunnies/buns_family.jpg
372 0.02%29/Sep/05 18:35/graphics/fun/netbunnies/espresso-stuart1.jpg
372 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/guy1-bokhart1.jpg
372 0.01%29/Sep/05 23:03/graphics/fun/netbunnies/rab7-overett1.jpg
372 0.01%29/Sep/05 18:22/graphics/fun/netbunnies/smokey-jack1.jpg
372 0.02%29/Sep/05 20:14/graphics/fun/netbunnies/moon2-dana1.jpg
372 0.01%29/Sep/05 21:37/graphics/fun/netbunnies/hops5.jpg
372 0.01%29/Sep/05 21:00/graphics/fun/netbunnies/elvira-odell1.jpg
372 0.01%29/Sep/05 21:53/graphics/fun/netbunnies/merlinmatilda2-robeson1.jpg
371 0.01%29/Sep/05 23:31/graphics/fun/netbunnies/dande3-smigo1.jpg
371 0.01%29/Sep/05 23:00/graphics/fun/netbunnies/peanut-Daniels1.jpg
371 0.03%29/Sep/05 20:14/graphics/fun/netbunnies/nero-daker1.jpg
371 0.02%29/Sep/05 21:37/graphics/fun/netbunnies/chercat-camelot1.jpg
371 29/Sep/05 18:34/graphics/books/peacable.gif
371 0.01%30/Sep/05 00:01/graphics/fun/netbunnies/mrogantaylor-winarchick1.jpg
371 0.01%29/Sep/05 23:32/graphics/fun/netbunnies/destino4-shullaw1.jpg
371 0.02%29/Sep/05 20:20/graphics/fun/netbunnies/penny1-lake1.jpg
371 0.01%29/Sep/05 23:09/chapters/san-diego/adoption/Adoption_Photos/Bandit_adoption_7Jun05.jpg
371 0.01%29/Sep/05 23:56/graphics/fun/netbunnies/bunny22.jpg
371 0.02%29/Sep/05 19:12/graphics/fun/netbunnies/raisins-clarke1.jpg
371 0.02%29/Sep/05 19:29/graphics/fun/netbunnies/dalebunny-crisnjay1.jpg
371 0.02%29/Sep/05 22:22/graphics/fun/netbunnies/copper-rsaqglong1.jpg
371 0.02%29/Sep/05 23:49/graphics/fun/netbunnies/rusty-hanson1.jpg
371 0.01%29/Sep/05 22:12/graphics/fun/netbunnies/luna6-oui1.jpg
371 0.03%29/Sep/05 23:32/graphics/fun/netbunnies/montythumper3-carpenter1.jpg
370 0.01%30/Sep/05 00:01/graphics/fun/netbunnies/casey&min-Cathy2.jpg
370 0.02%29/Sep/05 23:42/graphics/fun/netbunnies/musashi-king1.jpg
370 0.02%29/Sep/05 21:37/graphics/fun/netbunnies/sootysweep-small1.jpg
370 0.02%29/Sep/05 21:31/graphics/fun/netbunnies/rockey1-kirk1.jpg
370 0.02%29/Sep/05 21:41/graphics/fun/netbunnies/rabbit2-johnson1.jpg
370 0.01%30/Sep/05 00:03/graphics/fun/netbunnies/thumper.jpg
370 0.01%29/Sep/05 22:26/graphics/fun/netbunnies/peanutpuff-gluck1.jpg
370 0.01%29/Sep/05 20:21/graphics/fun/netbunnies/rose-doubleday1.jpg
370 0.02%29/Sep/05 20:21/graphics/fun/netbunnies/spikebruiser5-hounsell1.jpg
370 0.01%29/Sep/05 23:47/journal/2-8/quality-of-life.html
370 0.02%29/Sep/05 22:19/graphics/fun/netbunnies/bun3-Hodgett1.jpg
370 0.01%29/Sep/05 23:10/graphics/fun/netbunnies/bunny2-spence1.jpg
370 0.02%29/Sep/05 22:59/graphics/fun/netbunnies/krinkle-schroeder1.jpg
370 0.02%29/Sep/05 20:12/graphics/fun/netbunnies/christmaskids-sandy1.jpg
370 0.02%29/Sep/05 18:46/graphics/fun/netbunnies/conejo4-Collado1.jpg
370 0.02%29/Sep/05 20:20/graphics/fun/netbunnies/tracy.jpg
370 0.01%29/Sep/05 18:36/graphics/fun/netbunnies/peetie1-chaney1.jpg
370 0.01%29/Sep/05 19:26/graphics/fun/netbunnies/vitblaogd-asa1.jpg
370 0.02%29/Sep/05 23:01/graphics/fun/netbunnies/frog-mypetsrule1.jpg
370 0.01%29/Sep/05 22:26/graphics/fun/netbunnies/cheater+ gunston-wolff1.jpg
370 0.01%29/Sep/05 19:02/graphics/fun/netbunnies/stravinsky2-taylor1.jpg
370 0.01%29/Sep/05 23:27/graphics/fun/netbunnies/totta3-tanaka1.jpg
370 29/Sep/05 19:42/graphics/fun/netbunnies/scooter-hawthorne1.jpg
370 0.01%29/Sep/05 22:59/graphics/fun/netbunnies/crystal2-haske1.jpg
369 0.03%29/Sep/05 23:54/graphics/fun/netbunnies/tyler_sylviaw1.jpg
369 0.01%29/Sep/05 20:50/graphics/fun/netbunnies/lilly-peterson1.jpg
369 0.01%29/Sep/05 20:17/graphics/fun/netbunnies/bunny1-potts1.jpg
369 0.01%29/Sep/05 22:05/rabbit-center/rabbit_ofthe_month/sept05/images/John Coltrane 005.jpg
369 0.01%29/Sep/05 20:17/graphics/fun/netbunnies/bunny1-suarez1.jpg
369 0.01%30/Sep/05 00:04/journal/3-10/graphics/pain.gif
369 0.02%29/Sep/05 20:20/graphics/fun/netbunnies/georgethumper-wesorick1.jpg
369 0.01%29/Sep/05 19:12/graphics/fun/netbunnies/ginger3-herrington1.jpg
369 0.01%29/Sep/05 23:56/graphics/fun/netbunnies/mybunny-parker1.jpg
369 0.01%29/Sep/05 23:57/graphics/fun/netbunnies/boys3-martin1.jpg
369 0.01%29/Sep/05 19:15/graphics/fun/netbunnies/chewie-linda1.jpg
369 0.01%29/Sep/05 19:37/graphics/fun/netbunnies/ginger-Cathy1.jpg
369 0.02%29/Sep/05 22:54/graphics/fun/netbunnies/sophia-kroustalis1.jpg
368 0.01%29/Sep/05 19:43/graphics/fun/netbunnies/penelope1-longacre1.jpg
368 0.01%29/Sep/05 18:42/journal/3-12/graphics/allergies.gif
368 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/minik-sahinalp1.jpg
368 0.01%29/Sep/05 21:41/graphics/fun/netbunnies/fall-anderson1.jpg
368 0.01%29/Sep/05 20:08/graphics/fun/netbunnies/fripouille-eating-sandals.jpg
368 0.01%29/Sep/05 20:15/graphics/fun/netbunnies/fiona1-broley1.jpg
368 0.02%29/Sep/05 20:17/graphics/fun/netbunnies/bunnies2-schroeder1.jpg
368 0.01%29/Sep/05 21:24/graphics/fun/netbunnies/litlu-hos1.jpg
368 0.01%29/Sep/05 18:17/graphics/fun/netbunnies/poppy.jpg
368 0.02%29/Sep/05 21:26/graphics/fun/netbunnies/frank-myers1.jpg
368 0.01%29/Sep/05 23:09/chapters/san-diego/adoption/Adoption_Photos/AlfieAndy_adoption_Jun05.jpg
368 0.01%29/Sep/05 23:57/graphics/fun/netbunnies/colonel-carlshausen1.jpg
368 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/duke1-hop1.jpg
368 0.01%30/Sep/05 00:00/graphics/fun/netbunnies/hank-Caine1.jpg
368 0.01%29/Sep/05 20:14/graphics/fun/netbunnies/reggie+chloe-odell1.jpg
368 0.01%29/Sep/05 21:40/graphics/fun/netbunnies/rabbit3-rybizek1.jpg
368 0.02%30/Sep/05 00:02/graphics/fun/netbunnies/peanut-poole1.jpg
368 0.01%29/Sep/05 23:10/graphics/fun/netbunnies/ivy1-scarfone1.jpg
368 0.01%29/Sep/05 23:52/graphics/fun/netbunnies/frenchy+maybe-lorian1.jpg
367 0.01%29/Sep/05 23:59/graphics/fun/netbunnies/luna5-kateri1.jpg
367 0.01%29/Sep/05 22:12/graphics/fun/netbunnies/jasper-silvery1.jpg
367 29/Sep/05 20:17/graphics/fun/netbunnies/harvey2-newstead1.jpg
367 0.01%29/Sep/05 22:16/graphics/fun/netbunnies/frenchy1-lorian1.jpg
367 0.01%29/Sep/05 19:11/graphics/fun/netbunnies/bramwell-nelson1.jpg
367 29/Sep/05 21:37/graphics/fun/netbunnies/Toto-Sun1.jpg
367 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/bunna-jca1.jpg
367 0.01%29/Sep/05 18:34/graphics/books/hoptoit.gif
367 0.01%29/Sep/05 18:41/graphics/fun/netbunnies/mel2-shay1.jpg
367 0.01%29/Sep/05 21:39/graphics/fun/netbunnies/beatrix-snyder1.jpg
367 0.01%29/Sep/05 20:16/graphics/fun/netbunnies/ebonyandrosita.jpg
367 29/Sep/05 23:53/rabbit-center/boarding.html
367 0.01%29/Sep/05 21:41/graphics/fun/netbunnies/lexi2-dionne1.jpg
367 0.01%29/Sep/05 23:00/graphics/fun/netbunnies/victor-woods1.jpg
367 0.03%29/Sep/05 22:18/graphics/fun/netbunnies/diggler-wilkinson1.jpg
367 0.02%29/Sep/05 23:57/graphics/fun/netbunnies/scampers-fahlman1.jpg
367 0.02%29/Sep/05 21:36/graphics/fun/netbunnies/bumble-kinnard1.jpg
367 0.01%29/Sep/05 21:03/graphics/fun/netbunnies/cc30.jpg
367 0.02%29/Sep/05 18:40/graphics/fun/netbunnies/lollie-harris1.jpg
366 0.01%29/Sep/05 23:56/graphics/fun/netbunnies/buninpot4.jpg
366 0.01%29/Sep/05 18:22/graphics/fun/netbunnies/dodger2-montoya1.jpg
366 0.01%29/Sep/05 20:11/graphics/fun/netbunnies/kizzy1-hughes1.jpg
366 0.01%29/Sep/05 20:12/graphics/fun/netbunnies/pandora-heidi1.jpg
366 0.02%29/Sep/05 23:59/graphics/fun/netbunnies/bunnies-wittenkeller1.jpg
366 0.01%29/Sep/05 23:55/graphics/fun/netbunnies/relaxing.jpg
366 0.01%29/Sep/05 23:25/graphics/fun/netbunnies/daisy-ho1.jpg
366 0.02%29/Sep/05 20:15/graphics/fun/netbunnies/dustyandmirrordownes.jpg
366 0.01%29/Sep/05 20:12/graphics/fun/netbunnies/buddy1-elliott1.jpg
366 0.01%29/Sep/05 20:59/graphics/fun/netbunnies/picasso2-autumn1.jpg
366 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/mojo-Georgiev1.jpg
366 0.02%29/Sep/05 22:26/graphics/fun/netbunnies/ike-jpward1.jpg
366 0.03%29/Sep/05 20:57/graphics/fun/netbunnies/reese-engler1.jpg
366 0.01%29/Sep/05 20:13/graphics/fun/netbunnies/lolococo-dy1.jpg
366 0.01%29/Sep/05 21:12/graphics/fun/netbunnies/luna-lynne1.jpg
365 0.01%29/Sep/05 23:11/graphics/fun/netbunnies/piper-watson1.jpg
365 0.01%29/Sep/05 21:12/graphics/fun/netbunnies/rabbit-jcp1.jpg
365 0.01%29/Sep/05 20:17/graphics/fun/netbunnies/bobo-gabriella1.jpg
365 0.01%29/Sep/05 22:23/graphics/fun/netbunnies/sophie-marroney1.jpg
365 0.01%29/Sep/05 20:20/graphics/fun/netbunnies/cookie+mocha1-gatto1.jpg
365 0.01%30/Sep/05 00:01/graphics/fun/netbunnies/bun4-Breese1.jpg
365 0.01%29/Sep/05 21:34/graphics/fun/netbunnies/ollie-cherry1.jpg
365 29/Sep/05 18:34/graphics/books/right-pet.gif
364 0.01%29/Sep/05 23:52/graphics/fun/netbunnies/parsley1.jpg
364 0.01%29/Sep/05 20:21/graphics/fun/netbunnies/ek-ashwroth1.jpg
364 0.01%29/Sep/05 21:31/graphics/fun/netbunnies/scone2-brown1.jpg
364 0.01%29/Sep/05 20:53/graphics/fun/netbunnies/pearl+spiro-anderson1.jpg
364 0.02%29/Sep/05 20:09/graphics/fun/netbunnies/rishcage-sandy1.jpg
364 0.01%29/Sep/05 21:22/graphics/fun/netbunnies/bubzy-sydney1.jpg
364 0.01%29/Sep/05 22:53/graphics/fun/netbunnies/eve-Walzer1.jpg
364 0.01%29/Sep/05 22:24/graphics/fun/netbunnies/snix-fields1.jpg
364 0.01%29/Sep/05 18:17/graphics/fun/netbunnies/georgie-lake1.jpg
364 0.02%29/Sep/05 23:10/graphics/fun/netbunnies/buster-saikaley1.jpg
364 0.01%30/Sep/05 00:02/graphics/fun/netbunnies/hopalong-ho1.jpg
364 0.01%29/Sep/05 20:16/graphics/fun/netbunnies/kiwi_sylviaw1.jpg
364 0.02%30/Sep/05 00:01/graphics/fun/netbunnies/punky-brianna1.jpg
364 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/bugsy1-meier1.jpg
364 0.02%29/Sep/05 20:57/graphics/fun/netbunnies/busterwithlowerteeth.jpg
364 0.01%29/Sep/05 21:37/graphics/fun/netbunnies/bunnies-marroney1.jpg
363 0.01%29/Sep/05 23:37/graphics/fun/netbunnies/job1-saar1.jpg
363 0.01%29/Sep/05 21:16/graphics/fun/netbunnies/ryok3.jpg
363 0.01%29/Sep/05 23:23/journal/1/making-a-houserabbit.html
363 0.01%29/Sep/05 22:56/graphics/fun/netbunnies/freckles-mullins1.jpg
363 0.01%29/Sep/05 20:13/graphics/fun/netbunnies/harvey-zorro1.jpg
363 0.01%29/Sep/05 23:57/graphics/fun/netbunnies/franklin1-harris1.jpg
363 0.01%29/Sep/05 19:27/graphics/fun/netbunnies/pyawns.jpg
363 29/Sep/05 22:54/graphics/fun/netbunnies/spencer-profile.jpg
363 0.02%29/Sep/05 15:25/graphics/fun/netbunnies/rabbits3-reeves1.jpg
363 0.02%29/Sep/05 23:51/graphics/fun/netbunnies/fufu2-crownover1.jpg
363 0.01%29/Sep/05 23:46/chapters/san-diego/health/vet-talk/dental.html
363 0.01%29/Sep/05 23:55/graphics/fun/netbunnies/bighead1.jpg
363 0.01%29/Sep/05 22:17/graphics/fun/netbunnies/chester1-Tree1.jpg
363 0.01%29/Sep/05 23:04/graphics/fun/netbunnies/baileymason-Chaplin1.jpg
363 0.01%29/Sep/05 17:37/graphics/fun/netbunnies/gimmel1-feitelberg1.jpg
363 0.01%29/Sep/05 20:36/chapters/san-diego/behavior/quiz/quiz_graphic.jpg
363 0.01%29/Sep/05 22:17/graphics/fun/netbunnies/oreo-nicki1.jpg
363 0.03%29/Sep/05 16:59/graphics/fun/netbunnies/rabbit-Kylensarah1.jpg
362 0.01%29/Sep/05 23:09/graphics/fun/netbunnies/lucy+stinky-wangchuk1.jpg
362 0.01%29/Sep/05 23:23/graphics/fun/netbunnies/bubba-capps1.jpg
362 0.02%29/Sep/05 22:13/graphics/fun/netbunnies/moon5-dana1.jpg
362 0.03%30/Sep/05 00:02/graphics/fun/netbunnies/luna2-spotty1.jpg
362 0.02%29/Sep/05 20:53/graphics/fun/netbunnies/feebie-cooke1.jpg
362 0.01%29/Sep/05 23:57/graphics/fun/netbunnies/carolron-balch1.jpg
362 0.01%29/Sep/05 20:15/graphics/fun/netbunnies/charlie2-louise1.jpg
362 0.01%29/Sep/05 20:12/graphics/fun/netbunnies/dexter-correa1.jpg
362 0.02%29/Sep/05 23:57/graphics/fun/netbunnies/jazzie-fraleigh1.jpg
362 0.01%29/Sep/05 20:14/graphics/fun/netbunnies/rabbit-kogan1.jpg
361 0.01%29/Sep/05 21:37/graphics/fun/netbunnies/dulcy-storms1.jpg
361 0.01%29/Sep/05 22:16/graphics/fun/netbunnies/blackberry2-leen1.jpg
361 0.10%29/Sep/05 23:09/chapters/san-diego/adoption/Adoption_Photos/Dusty_Ronan_adoption_4Sept05.jpg
361 29/Sep/05 23:10/fun/answer3.html
361 0.03%29/Sep/05 23:58/graphics/fun/netbunnies/santarabbitandpresentkarask.jpg
361 0.02%30/Sep/05 00:03/graphics/fun/netbunnies/sonora-hanson1.jpg
361 0.01%29/Sep/05 22:15/graphics/fun/netbunnies/pixie04c.jpg
361 0.02%29/Sep/05 21:17/graphics/fun/netbunnies/harvey-birch1.jpg
361 0.02%29/Sep/05 19:35/graphics/fun/netbunnies/buns1-oberley1.jpg
361 0.02%29/Sep/05 20:55/graphics/fun/netbunnies/harveywatchingtvnorth.jpg
361 0.02%29/Sep/05 22:09/rabbit-center/hayward_rescue/hayward_graphics/syphilis_nose.jpg
360 0.02%29/Sep/05 22:54/graphics/fun/netbunnies/eric15.jpg
360 0.01%29/Sep/05 20:08/graphics/fun/netbunnies/rabbit6-oehler1.jpg
360 0.02%29/Sep/05 20:10/graphics/fun/netbunnies/owen-slessor1.jpg
360 0.03%29/Sep/05 22:53/graphics/fun/netbunnies/khaki-fischer1.jpg
360 0.02%29/Sep/05 23:55/graphics/fun/netbunnies/maeve+draighnean-mcnulty1.jpg
359 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/oreo-froggy1.jpg
359 0.01%29/Sep/05 22:37/chapters/san-diego/diet/rabbit_GI_physiology.html
359 29/Sep/05 22:38/care/abuse.html
359 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/rabbit-kissoon1.jpg
359 0.01%29/Sep/05 22:59/graphics/fun/netbunnies/ruby2-renee1.jpg
359 0.01%29/Sep/05 20:16/graphics/fun/netbunnies/georgie_lake1.jpg
359 0.02%29/Sep/05 20:12/graphics/fun/netbunnies/isaac-barbara1.jpg
359 0.01%29/Sep/05 19:28/graphics/fun/netbunnies/ponpon-herrera1.jpg
359 0.01%29/Sep/05 19:40/graphics/fun/netbunnies/george-wesirucj1.jpg
359 0.01%29/Sep/05 23:54/graphics/fun/netbunnies/hops3-attila1.jpg
358 0.01%29/Sep/05 20:14/graphics/fun/netbunnies/bunnybegging-eng1.jpg
358 0.01%29/Sep/05 17:43/graphics/fun/netbunnies/fosterbun-cvetan1.jpg
358 29/Sep/05 23:49/rabbit-center/adoptables/css/mm_graphic.css
358 0.01%29/Sep/05 23:00/graphics/fun/netbunnies/pele02.jpg
358 0.01%29/Sep/05 21:50/adoption/rabbits-at-easter.html
358 0.02%29/Sep/05 21:03/graphics/fun/netbunnies/rudy-cooke1.jpg
358 0.01%29/Sep/05 23:53/graphics/fun/netbunnies/sylvie4-robinson1.jpg
358 0.01%29/Sep/05 20:54/graphics/fun/netbunnies/mrsbunny-beebe1.jpg
358 0.01%29/Sep/05 23:35/graphics/fun/netbunnies/fidge2.jpg
358 0.01%29/Sep/05 21:15/graphics/fun/netbunnies/thunder2-jacqueline1.jpg
358 29/Sep/05 23:46/health/abscess.html
358 0.01%29/Sep/05 21:11/graphics/fun/netbunnies/rab4-vinkaz1.jpg
358 0.02%29/Sep/05 20:10/graphics/fun/netbunnies/jed6-forrai1.jpg
358 0.01%29/Sep/05 20:14/graphics/fun/netbunnies/penny1_lake1.jpg
358 0.02%29/Sep/05 22:14/graphics/fun/netbunnies/sophie1-noakes1.jpg
358 0.01%29/Sep/05 23:00/graphics/fun/netbunnies/cheyenne-anderson1.jpg
357 0.01%29/Sep/05 15:26/graphics/fun/netbunnies/rabbit5-nycx1.jpg
357 0.01%29/Sep/05 23:28/graphics/fun/netbunnies/betsy2-byrne1.jpg
357 0.07%27/Sep/05 17:03/chapters/san-diego/adoption/Adoption_Photos/HA_Jasper2_May05.jpg
357 0.01%29/Sep/05 20:14/graphics/fun/netbunnies/french04.jpg
356 0.01%29/Sep/05 18:33/graphics/fun/netbunnies/ralphie-garver1.jpg
356 0.01%29/Sep/05 21:40/chapters/san-diego/behavior/litter_compare.html
355 29/Sep/05 21:07/graphics/banners/care.gif
355 0.01%29/Sep/05 18:21/graphics/fun/netbunnies/marley-phelan1.jpg
355 0.01%29/Sep/05 21:22/graphics/fun/netbunnies/flop1-julian1.jpg
355 0.01%29/Sep/05 20:19/graphics/fun/netbunnies/jb2-cho1.jpg
354 0.01%29/Sep/05 23:55/graphics/fun/netbunnies/buns3-schnellbach1.jpg
354 29/Sep/05 22:16/graphics/fun/netbunnies/fidge1.jpg
354 0.01%29/Sep/05 20:20/graphics/fun/netbunnies/oscar-sigler1 .jpg
354 0.01%29/Sep/05 21:37/graphics/fun/netbunnies/chewy-teada1.jpg
354 0.03%29/Sep/05 22:54/graphics/fun/netbunnies/kiwi3-kaczmarski1.jpg
354 0.01%29/Sep/05 20:12/graphics/fun/netbunnies/rabbit2-klarman1.jpg
354 0.01%29/Sep/05 20:17/graphics/fun/netbunnies/bunny-anderson1.jpg
354 0.02%29/Sep/05 23:04/graphics/fun/netbunnies/buckland-steven1.jpg
354 0.01%29/Sep/05 20:15/graphics/fun/netbunnies/maeve-ellis1.jpg
353 0.01%29/Sep/05 22:37/journal/3-3/law-rabbit.html
353 0.02%29/Sep/05 23:57/graphics/fun/netbunnies/peter-barrett1.jpg
353 0.02%29/Sep/05 20:54/graphics/fun/netbunnies/minirex-sandamander1.jpg
353 0.01%29/Sep/05 20:16/graphics/fun/netbunnies/r2-3-lin1.jpg
353 0.02%29/Sep/05 21:37/graphics/fun/netbunnies/rabbits1-szmoon1.jpg
352 0.01%29/Sep/05 21:38/graphics/fun/netbunnies/jasper-cartwright1.jpg
352 0.01%29/Sep/05 20:57/graphics/fun/netbunnies/bunboy-smith1.jpg
352 0.01%29/Sep/05 22:18/journal/3-9/bonding.html
352 0.02%29/Sep/05 17:32/graphics/fun/netbunnies/cloverbun-Mulholland1.jpg
352 0.01%29/Sep/05 17:41/graphics/fun/netbunnies/merlin+panda2-holly1.jpg
351 29/Sep/05 20:36/chapters/san-diego/behavior/quiz/quiz-numbers.gif
351 0.01%29/Sep/05 22:18/graphics/fun/netbunnies/campion2-ginger1.jpg
351 0.02%29/Sep/05 23:51/graphics/fun/netbunnies/gimli2-schroede1.jpg
351 0.02%29/Sep/05 22:09/rabbit-center/hayward_rescue/hayward_graphics/boy_tumor_exam.jpg
350 0.01%29/Sep/05 23:31/graphics/fun/netbunnies/cooper-graham1.jpg
350 0.01%30/Sep/05 00:00/graphics/fun/netbunnies/bunny2.jpg
349 0.01%30/Sep/05 00:00/graphics/fun/netbunnies/cotton-renee1.jpg
349 0.02%29/Sep/05 23:28/graphics/fun/netbunnies/bunny2-baker1.jpg
348 0.01%29/Sep/05 21:37/graphics/fun/netbunnies/clover2-sumanski1.jpg
347 29/Sep/05 23:49/rabbit-center/adoptables/images/mm_spacer.gif
347 0.02%29/Sep/05 22:09/rabbit-center/hayward_rescue/hayward_graphics/yellow_boy_exam_3.jpg
346 0.02%29/Sep/05 19:44/graphics/fun/netbunnies/josey-kwmsp1.jpg
346 0.01%29/Sep/05 20:18/graphics/fun/netbunnies/pixie-chiu1.jpg
346 0.01%29/Sep/05 20:16/graphics/fun/netbunnies/mel1-shay1.jpg
346 0.01%29/Sep/05 22:25/graphics/fun/netbunnies/flopsie.jpg
346 0.01%30/Sep/05 00:00/graphics/fun/netbunnies/ippie-sewps1.jpg
346 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/melbacheckers-tolle1.jpg
345 0.01%29/Sep/05 19:09/graphics/fun/netbunnies/emma2-beavis1.jpg
345 0.01%28/Sep/05 15:41/chapters/san-diego/adoption/Adoption_Photos/Ned_adoption_1May05.jpg
344 29/Sep/05 23:58/rabbit-center/resources/
344 0.01%29/Sep/05 22:54/graphics/fun/netbunnies/cooper-bailor1.jpg
344 0.01%29/Sep/05 23:27/graphics/fun/netbunnies/elwood4-cook1.jpg
344 0.01%29/Sep/05 20:18/graphics/fun/netbunnies/jasper-walker1.jpg
343 0.02%29/Sep/05 20:13/graphics/fun/netbunnies/leo-herb1.jpg
343 0.01%29/Sep/05 20:19/graphics/fun/netbunnies/im-not-ready.jpg
343 0.02%30/Sep/05 00:02/graphics/fun/netbunnies/rabbitwithcataroundcorner.jpg
342 0.01%29/Sep/05 23:43/journal/3-12/graphics/litter-training1.gif
342 0.02%29/Sep/05 22:09/rabbit-center/hayward_rescue/hayward_graphics/yellow_bunny_exam_2.jpg
342 0.01%30/Sep/05 00:03/graphics/fun/netbunnies/emily2-marroney1.jpg
342 0.01%29/Sep/05 23:43/journal/3-12/graphics/litter-training2.gif
342 0.01%29/Sep/05 23:56/graphics/fun/netbunnies/pete-sexton1.jpg
341 0.04%28/Sep/05 15:57/chapters/san-diego/adoption/Adoption_Photos/Stewart_Cherokee_2_Apr05.jpg
341 0.01%29/Sep/05 21:21/care/vets_nocal.html
341 28/Sep/05 16:45/chapters/san-diego/adoption/Adoption_Photos/AG_HA_Buster_Vito__May05.jpg
341 0.01%29/Sep/05 21:27/graphics/fun/netbunnies/peetie-chaney1.jpg
341 0.02%30/Sep/05 00:00/graphics/fun/netbunnies/rabbits2-ceftakhar1.jpg
341 0.01%27/Sep/05 17:03/chapters/san-diego/adoption/Adoption_Photos/Misty_adoption_1May05.jpg
340 0.01%29/Sep/05 16:57/graphics/fun/netbunnies/rabbit1-ergun1.jpg
340 0.07%29/Sep/05 22:39/adopt-a-rabbit-month/MythFlyer2003.pdf
339 0.01%28/Sep/05 17:42/chapters/san-diego/adoption/Adoption_Photos/Jonathon_adoption_21May05.jpg
339 0.01%29/Sep/05 20:59/graphics/fun/netbunnies/ichy1-spallone1.jpg
338 0.01%29/Sep/05 20:14/graphics/fun/netbunnies/hayeaters4-rainey1.jpg
338 29/Sep/05 22:32/chapters/socal/banner.gif
338 0.01%29/Sep/05 23:50/graphics/fun/tinytim.gif
338 0.01%29/Sep/05 20:58/graphics/fun/netbunnies/magic-christina1.jpg
337 0.01%29/Sep/05 23:09/chapters/san-diego/adoption/Adoption_Photos/HappyAdoption_Muffin_4Sep05.jpg
337 0.01%29/Sep/05 20:00/chapters/san-diego/behavior/bonding.html
335 28/Sep/05 17:20/chapters/san-diego/adoption/Adoption_Photos/Neil_adoption_Apr05.jpg
334 29/Sep/05 22:49/chapters/san-diego/health/health-cert.html
334 0.01%28/Sep/05 16:35/chapters/san-diego/adoption/Adoption_Photos/CodiHalfpint_adoption_Apr05.jpg
333 0.01%27/Sep/05 17:03/chapters/san-diego/adoption/Adoption_Photos/Cookie_adoption_1_Mar05.jpg
333 0.01%29/Sep/05 20:17/graphics/fun/netbunnies/peterbenben-eng1.jpg
332 0.01%28/Sep/05 17:41/chapters/san-diego/adoption/Adoption_Photos/Molly_Rory_adoption_26Mar05.jpg
332 0.01%29/Sep/05 23:47/chapters/san-diego/health/vet-talk/elderly.html
331 0.01%29/Sep/05 20:38/chapters/san-diego/behavior/know_thumper.html
330 0.01%28/Sep/05 16:56/chapters/san-diego/adoption/Adoption_Photos/HA_Alex_Mar05.jpg
330 0.01%28/Sep/05 18:01/chapters/san-diego/adoption/Adoption_Photos/Donnie_Leilani_adoption_3_Mar05.jpg
329 0.01%29/Sep/05 18:09/chapters/san-diego/diet/hayisbasis.html
329 0.01%28/Sep/05 17:12/chapters/san-diego/adoption/Adoption_Photos/Watson_adoption.jpg
327 29/Sep/05 21:36/fun/answer2.html
327 0.01%29/Sep/05 23:44/graphics/fun/netbunnies/Bunny.gif
327 0.01%29/Sep/05 18:43/graphics/fun/netbunnies/morty2-alcorn1.jpg
326 29/Sep/05 23:51/chapters/san-francisco/home-banner.gif
325 0.01%29/Sep/05 23:46/chapters/san-diego/health/choosevet.html
325 29/Sep/05 20:32/chapters/oregon/images/banner_450x120.jpg
325 0.01%29/Sep/05 22:31/journal/4-7/letters.html
324 29/Sep/05 20:32/chapters/oregon/images/buttonbar_01.gif
323 29/Sep/05 20:32/chapters/oregon/images/buttonbar_02.gif
322 29/Sep/05 20:32/chapters/oregon/images/buttonbar_07.gif
322 29/Sep/05 19:21/graphics/fun/netbunnies/spencer-bianca.jpg
322 29/Sep/05 20:32/chapters/oregon/images/buttonbar_03.gif
321 29/Sep/05 20:32/chapters/oregon/images/buttonbar_04.gif
321 29/Sep/05 20:32/chapters/oregon/images/buttonbar_05.gif
321 0.01%29/Sep/05 21:06/journal/2-12/thumper-and-me.html
321 29/Sep/05 20:32/chapters/oregon/images/buttonbar_06.gif
320 0.01%29/Sep/05 23:46/journal/2-9/recordkeeping.html
314 29/Sep/05 23:38/journal/3-1/graphics/dorothy.gif
314 29/Sep/05 20:30/links/sections/memorial.html
313 29/Sep/05 20:54/chapters/oregon/rabbits.html
313 29/Sep/05 22:00/journal/3-11/trucking.html
312 0.01%29/Sep/05 13:58/graphics/easter/gold-egg.gif
312 29/Sep/05 23:38/journal/3-1/graphics/learn-1.gif
311 0.01%29/Sep/05 23:38/journal/3-1/graphics/learn-2.gif
311 0.03%29/Sep/05 20:43/graphics/fun/netbunnies/Bunny_in_a_Bowl_1.gif
311 0.04%29/Sep/05 22:09/rabbit-center/hayward_rescue/hayward_graphics/bonepile.jpg
311 0.01%29/Sep/05 21:32/opinion/petco.html
310 29/Sep/05 23:58/chapters/mid-penninsula/adoptables.html
309 29/Sep/05 17:34/rabbit-center/adoptables/Xanadu.htm
308 30/Sep/05 00:01/graphics/fun/netbunnies/BunnySniff.JPG
308 29/Sep/05 22:09/rabbit-center/hayward_rescue/hayward_graphics/shed.jpg
307 29/Sep/05 19:58/chapters/oregon/
307 29/Sep/05 21:27/journal/1/jb.html
305 29/Sep/05 22:39/chapters/san-diego/health/cool.html
303 0.01%29/Sep/05 21:15/rabbit-center/lucky/letter-writting.htm
303 29/Sep/05 16:23/links/history.html
303 29/Sep/05 23:19/rabbit-center/css/mm_travel2.css
302 29/Sep/05 02:09/rabbit-center/rabbit_ofthe_month/sept05/
301 28/Sep/05 11:15/rabbit-center/resources/images/no-pict.gif
300 29/Sep/05 22:48/links/sections/zipzoefoo.html
300 0.01%29/Sep/05 21:35/journal/3-3/graphics/law.gif
299 0.01%29/Sep/05 19:43/chapters/san-diego/health/spay_neuter_rebates.html
299 29/Sep/05 22:09/rabbit-center/hayward_rescue/hayward_graphics/corpse1.jpg
298 0.01%29/Sep/05 23:46/chapters/san-diego/health/vet-talk/sludge.html
297 29/Sep/05 23:19/rabbit-center/fair_share/images/mm_spacer.gif
296 29/Sep/05 20:28/graphics/easter/
10 29/Sep/05 03:59  /graphics/easter/?M=A
295 29/Sep/05 10:11/webmail/images/right.gif
294 0.01%29/Sep/05 17:28/chapters/san-diego/aboutus/feedback.html
294 29/Sep/05 19:27/journal/2-5/yes-to-rabbits.html
293 0.01%29/Sep/05 23:47/journal/3-12/chiropractor.html
292 29/Sep/05 20:52/chapters/san-diego/diet/pellets.html
292 0.01%29/Sep/05 23:37/graphics/mine/foo/1-baby-foo.jpg
290 29/Sep/05 20:34/links/sections/karma.html
289 29/Sep/05 22:16/journal/3-9/palmer.html
289 0.01%29/Sep/05 20:52/graphics/postcard/lavender.jpg
289 0.01%29/Sep/05 22:20/journal/3-8/rabbits-in-the-plural.html
288 29/Sep/05 23:26/journal/warren-wise/fleas.html
286 0.01%29/Sep/05 23:45/graphics/postcard/paddington.jpg
286 29/Sep/05 18:53/care/angora.html
283 29/Sep/05 22:02/journal/4-7/bereavedbunny.html
283 29/Sep/05 21:26/fun/tiny-tim.html
281 0.01%29/Sep/05 14:51/graphics/mine/foo/3-under-bed.jpg
281 29/Sep/05 17:10/chapters/san-diego/health/vet-talk/cuniculi.html
280 29/Sep/05 21:19/hrs-info/adoption-education-center.html
279 0.01%29/Sep/05 23:47/chapters/san-diego/health/vet-talk/cuniculi-up.html
279 28/Sep/05 23:44/rabbit-center/retail/store3S.jpg
278 29/Sep/05 01:01/rabbit-center/retail/store2S.jpg
278 0.01%29/Sep/05 23:58/caregerman/leben-mit-kaninchen.html
278 28/Sep/05 23:44/rabbit-center/retail/store1S.jpg
278 29/Sep/05 22:28/translations/portugese/
278 29/Sep/05 18:26/journal/3-7/graphics/rescue-circle.gif
277 0.02%29/Sep/05 21:12/hrs-info/hrs.pdf
275 29/Sep/05 20:38/chapters/san-diego/adoption/Adoption_Photos/HRS_Honey_3_11Jul03.JPG
275 29/Sep/05 23:19/rabbit-center/fair_share/index.htm
274 29/Sep/05 22:55/rabbit-center/lucky/luckyphotos.htm
273 29/Sep/05 18:27/help/search.html
273 29/Sep/05 23:44/faqgerman/sections/medizinischefragen.html
272 29/Sep/05 20:23/care/tips98.html
272 0.01%29/Sep/05 16:53/journal/3-9/graphics/chase1.gif
271 0.01%29/Sep/05 16:53/journal/3-9/graphics/chase2.gif
271 29/Sep/05 20:28/chapters/san-diego/health/newflea.html
270 0.01%29/Sep/05 17:03/help/subject-index.html
270 25/Sep/05 21:32/rabbit-center/retail/carrot.gif
270 0.01%29/Sep/05 23:24/faqgerman/sections/kastration.html
270 29/Sep/05 21:20/adoption/adoption-policies.html
270 29/Sep/05 22:59/journal/2-10/gutherie.html
270 0.01%29/Sep/05 16:53/journal/3-9/graphics/2snuggling-from-back.gif
269 0.01%29/Sep/05 23:51/chapters/san-francisco/images/with_sheryl.jpg
267 29/Sep/05 20:32/links/sections/fun-facts.html
267 29/Sep/05 23:51/chapters/san-francisco/carrot.gif
267 29/Sep/05 23:17/journal/2-5/gift.html
267 0.01%29/Sep/05 23:51/chapters/san-francisco/images/with_joel.jpg
264 29/Sep/05 23:47/care/recipies.html
264 0.01%29/Sep/05 23:11/rabbit-center/resources/vets.html
263 29/Sep/05 23:51/chapters/san-francisco/bun.gif
263 30/Sep/05 00:00/hrs-info/premiums.html
262 29/Sep/05 23:51/chapters/san-francisco/leap2.gif
261 29/Sep/05 13:44/chapters/san-diego/products/graphics/Herman_baseball_jersey.jpg
260 0.01%29/Sep/05 20:52/graphics/postcard/willow-in-bed-with-teddy.jpg
259 29/Sep/05 23:46/chapters/san-diego/health/vet-talk/beadtherapy.html
259 29/Sep/05 21:06/rabbit-center/hayward_rescue/hayward_rabbits_Janet-Lance.html
259 29/Sep/05 23:51/chapters/san-francisco/run2.gif
257 29/Sep/05 21:34/chapters/michigan/
257 29/Sep/05 22:03/care/shavings.html
257 29/Sep/05 22:45/chapters/san-diego/health/vet-talk/zinc.html
256 0.01%29/Sep/05 20:04/chapters/san-diego/behavior/toys.html
255 0.01%29/Sep/05 23:49/journal/3-11/graphics/xray1.gif
253 29/Sep/05 23:47/links/palace_pet.html
253 0.01%29/Sep/05 23:49/journal/3-11/graphics/xray2.gif
253 0.01%29/Sep/05 23:49/journal/3-11/graphics/xray3.gif
252 29/Sep/05 22:32/journal/3-5/beyond-petting.html
252 0.01%29/Sep/05 19:08/rabbit-center/rabbit_ofthe_month/sept05/images/John Coltrane 004.jpg
251 29/Sep/05 23:15/journal/2-5/ever-be-friends.html
251 29/Sep/05 21:59/graphics/calendars/
250 0.01%29/Sep/05 23:43/graphics/fun/netbunnies/Bouboulle-whissel1.jpg
249 29/Sep/05 23:01/journal/2-9/rebel-with-paws.html
248 29/Sep/05 20:39/chapters/san-diego/behavior/quiz/nextquestion.gif
248 29/Sep/05 20:39/chapters/san-diego/behavior/quiz/next-arrow.gif
248 25/Sep/05 20:56/rabbit-center/graphics/icon_boardpage.gif
246 0.01%29/Sep/05 23:43/graphics/fun/netbunnies/Buddy-zawalickl1.jpg
245 0.02%29/Sep/05 22:03/rabbit-center/hayward_rescue/witness_statements.html
243 0.01%29/Sep/05 23:49/rabbit-center/adoptables/images/roxie_r1469_15tiny.jpg
242 29/Sep/05 22:54/journal/3-1/repellent.html
242 0.01%29/Sep/05 11:18/chapters/san-diego/aboutus/events.html
242 0.01%29/Sep/05 20:52/graphics/postcard/Pl-sch10.jpg
241 28/Sep/05 14:36/rabbit-center/graphics/icon_eventspage.gif
241 0.01%29/Sep/05 23:39/faq/sections/orphan-old.html
241 29/Sep/05 23:49/rabbit-center/adoptables/images/img_1384.jpg
240 29/Sep/05 23:58/rabbit-center/links.html
236 0.01%29/Sep/05 19:28/rabbit-center/adoptables/graphics/big/anusha45sml.jpg
236 29/Sep/05 23:46/journal/3-7/snake-bite.html
236 29/Sep/05 19:17/rabbit-center/hayward_rescue/whiterabbit.jpg
235 29/Sep/05 22:27/journal/3-7/ungetaway.html
235 26/Sep/05 03:52/rabbit-center/rabbit_ofthe_month/common/bunnyL.gif
235 26/Sep/05 03:52/rabbit-center/rabbit_ofthe_month/common/bunnyR.gif
235 29/Sep/05 18:40/chapters/san-diego/diet/sources.html
234 29/Sep/05 21:05/easter/flyer/
234 29/Sep/05 20:39/chapters/san-diego/quizstart.html
233 0.01%29/Sep/05 23:59/graphics/fun/netbunnies/Elmer-gw1.jpg
233 29/Sep/05 20:35/graphics/angora.jpg
232 0.01%29/Sep/05 23:52/chapters/san-diego/diet/plants.html
231 29/Sep/05 22:30/presspolicies.html
231 0.15%26/Sep/05 03:52/rabbit-center/rabbit_ofthe_month/sept05/images/John Coltrane 002.png
231 0.01%29/Sep/05 23:41/rabbit-center/hayward_rescue/hayward_rabbits_volunteers.html
230 29/Sep/05 22:53/journal/3-1/floorscapes.html
229 29/Sep/05 23:13/journal/2-6/hasenpfeffer.html
229 29/Sep/05 19:15/care/tips99.html
228 29/Sep/05 23:47/journal/3-2/disabled.html
228 29/Sep/05 23:56/chapters/san-diego/behavior/losing.html
228 29/Sep/05 20:43/faq/sections/hrs-info.html
228 29/Sep/05 23:15/journal/2-6/reel-rabbits.html
227 0.01%29/Sep/05 18:42/chapters/san-diego/aboutus/bunnyfest/auction_photos-2003.html
227 29/Sep/05 22:59/index-small.html
226 0.04%29/Sep/05 20:35/graphics/adopt-a-highway.jpg
225 29/Sep/05 22:42/chapters/san-diego/health/death.html
224 29/Sep/05 10:11/webmail/images/left.gif
220 29/Sep/05 22:32/journal/3-7/stray-roundup.html
219 0.01%29/Sep/05 20:51/graphics/fun/netbunnies/LEO-2-small.JPG
217 0.03%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/blue-bunny-earrings.JPG
217 0.01%29/Sep/05 17:52/rabbit-center/hayward_rescue/hayward_graphics/Janet_fresh-air.JPG
217 29/Sep/05 21:42/journal/4-7/friend.html
217 0.01%29/Sep/05 17:52/rabbit-center/hayward_rescue/hayward_graphics/Janet_karen.JPG
217 29/Sep/05 17:34/rabbit-center/adoptables/images/Xanadu005.jpg
217 29/Sep/05 23:56/rabbit-center/hq-volunteer.html
217 0.01%29/Sep/05 23:45/graphics/fun/netbunnies/ChipEat2.JPG
216 29/Sep/05 18:03/rabbit-center/retail/cages.html
216 29/Sep/05 21:42/journal/3-11/graphics/dutch-munch.gif
216 29/Sep/05 18:57/fun/answer13.html
215 29/Sep/05 21:46/journal/4-7/study.html
215 29/Sep/05 21:07/chapters/san-diego/adoption/find_rabbit.html
214 29/Sep/05 17:34/rabbit-center/adoptables/images/Xanadu002.jpg
213 0.03%29/Sep/05 23:20/rabbit-center/sponsor/smFosterCarePackageFlyer-lt2t.pdf
213 0.01%29/Sep/05 20:15/translations/spanish/brochure-spanish.html
212 29/Sep/05 20:35/links/sections/links.html
211 0.01%29/Sep/05 22:00/rabbit-center/hayward_rescue/hayward_rabbits_animal-place.html
211 29/Sep/05 15:20/translations/spanish/debo-darle-de-comer.html
211 0.03%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Baseball_front.JPG
209 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Julie-k_Toby.jpg
209 0.02%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/large_bunny_plaque.jpg
208 29/Sep/05 17:55/cgi-bin/suid/~rabbit2/search
208 0.01%29/Sep/05 20:56/graphics/babies/harvey.jpg
206 29/Sep/05 22:48/graphics/thumbnails/tiny-izzy.gif
206 29/Sep/05 09:05/care/vets_texas.html
206 29/Sep/05 22:48/graphics/thumbnails/tiny-king-foo.gif
206 0.01%29/Sep/05 20:20/graphics/fun/netbunnies/starbuck-gielisse1.jpg
205 29/Sep/05 23:46/chapters/san-diego/health/vet-talk/enteritis.html
205 29/Sep/05 16:18/graphics/index/baby-zowie-profile-l.gif
204 28/Sep/05 22:13/chapters/oregon/images/rex.jpg
204 29/Sep/05 12:53/chapters/oregon/images/jordan.jpg
204 0.01%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Baseball_back.JPG
204 28/Sep/05 22:13/chapters/oregon/images/leslieelliot.jpg
203 29/Sep/05 22:48/graphics/thumbnails/tiny-zippy.gif
202 29/Sep/05 20:45/graphics/fun/netbunnies/DCP00205.JPG
201 29/Sep/05 22:15/journal/3-9/bale-of-hay.html
201 29/Sep/05 23:19/rabbit-center/buddy/
201 29/Sep/05 20:39/chapters/san-diego/behavior/quiz/q2.html
201 28/Sep/05 22:13/chapters/oregon/images/sally.jpg
200 29/Sep/05 19:20/chapters/san-diego/behavior/digger.html
200 29/Sep/05 17:14/chapters/san-diego/adoption/guidelines.html
199 29/Sep/05 22:48/journal/3-2/marshmallow.html
199 29/Sep/05 22:48/graphics/thumbnails/tiny-zowie.gif
199 29/Sep/05 23:46/journal/4-4/pandora.html
198 29/Sep/05 22:56/journal/3-1/trouble-with-ears.html
198 0.02%29/Sep/05 21:45/easter/flyer/childstory.pdf
197 29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/prana088tiny.jpg
197 0.01%29/Sep/05 17:52/rabbit-center/hayward_rescue/hayward_graphics/Lance_Phyllis.jpg
197 29/Sep/05 22:35/rabbit-center/adoptables/chip.htm
197 29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/olga103tiny.jpg
197 0.01%29/Sep/05 22:02/journal/3-8/graphics/plural.gif
195 29/Sep/05 20:40/chapters/san-diego/behavior/quiz/q3.html
194 0.01%29/Sep/05 19:45/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_2.JPG
194 29/Sep/05 20:42/chapters/san-diego/behavior/quiz/q10.html
194 29/Sep/05 17:21/chapters/san-diego/adoption/pre-adoption.html
194 0.01%29/Sep/05 22:53/graphics/fun/netbunnies/doxy-vrtis1.jpg
193 27/Sep/05 10:29/rabbit-center/events/classes/BUNNY GROOMING CLASS.htm
193 29/Sep/05 23:22/chapters/san-diego/adoption/supplies.html
192 29/Sep/05 20:06/chapters/oakland/fight.html
191 29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/zephyr081tiny.jpg
191 29/Sep/05 20:11/rabbit-center/retail/no-pict.gif
190 0.01%29/Sep/05 19:45/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_4.jpg
190 29/Sep/05 20:40/chapters/san-diego/behavior/quiz/q5.html
190 26/Sep/05 16:20/rabbit-center/news_release/
190 29/Sep/05 18:40/chapters/michigan/x.gif
189 29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/samantha077tiny.jpg
189 29/Sep/05 20:18/journal/3-12/graphics/chiro.gif
189 29/Sep/05 20:40/chapters/san-diego/behavior/quiz/q4answer_true.html
189 29/Sep/05 20:40/chapters/san-diego/behavior/quiz/q4.html
188 29/Sep/05 22:55/rabbit-center/lucky/latestphotos.htm
187 29/Sep/05 20:42/chapters/san-diego/behavior/quiz/q9.html
186 0.01%29/Sep/05 22:22/graphics/postcard/tracy.jpg
186 29/Sep/05 20:41/chapters/san-diego/behavior/quiz/q6.html
186 0.01%29/Sep/05 19:46/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_10.jpg
186 0.01%29/Sep/05 19:46/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_3.jpg
186 29/Sep/05 20:40/chapters/san-diego/behavior/quiz/q3answer_true.html
185 29/Sep/05 12:52/journal/2-2/perfection.html
185 0.01%29/Sep/05 13:06/help/toc.html
185 29/Sep/05 22:47/journal/3-2/litter-diggers.html
185 28/Sep/05 22:13/chapters/oregon/images/william.jpg
184 29/Sep/05 23:00/graphics/fun/netbunnies/Ember_Amy2-garcia1.jpg
184 29/Sep/05 21:32/translations/japanese/red-urine-j.txt
184 29/Sep/05 23:38/easter/kids.html
183 29/Sep/05 21:07/chapters/san-diego/behavior/besttoy.html
183 29/Sep/05 21:57/journal/3-12/fosterer-allergies.html
183 29/Sep/05 21:29/journal/3-9/graphics/snuggle-bunnies.gif
183 29/Sep/05 21:29/journal/3-9/graphics/palmer.gif
183 29/Sep/05 22:56/rabbit-center/lucky/adopted.htm
183 28/Sep/05 22:13/chapters/oregon/images/georgefrancine.jpg
183 29/Sep/05 20:41/chapters/san-diego/behavior/quiz/q7.html
182 28/Sep/05 22:13/chapters/oregon/images/bruce.jpg
182 29/Sep/05 17:34/rabbit-center/adoptables/images/Xanadu004.jpg
182 29/Sep/05 20:41/chapters/san-diego/behavior/quiz/q8.html
182 29/Sep/05 23:47/journal/4-3/house-fly.html
182 0.01%29/Sep/05 19:46/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_6.jpg
182 29/Sep/05 17:34/rabbit-center/adoptables/images/Xanadu003.jpg
181 28/Sep/05 22:13/chapters/oregon/images/maurice.jpg
181 29/Sep/05 16:35/chapters/san-diego/behavior/bunnies_teaching_bunnies.html
181 29/Sep/05 21:17/hrs-info/history.html
181 29/Sep/05 23:47/chapters/san-diego/health/vet-talk/stress.html
181 29/Sep/05 23:50/graphics/fun/lapin.gif
180 29/Sep/05 12:19/care/vets_michigan.html
179 29/Sep/05 21:29/chapters/michigan/fosters.html
179 29/Sep/05 21:57/hrs-info/policies.html
178 29/Sep/05 20:33/journal/3-7/places-to-be.html
178 0.01%29/Sep/05 17:02/rabbit-center/hayward_rescue/hayward_graphics/Lance_med-facility.JPG
178 0.01%29/Sep/05 21:09/care/living-with-a-houserabbit.pdf
178 25/Sep/05 21:03/rabbit-center/graphics/icon_resources.gif
178 0.01%29/Sep/05 09:46/rabbit-center/adoptables/graphics/big/mohawk r1424 09sml.jpg
177 29/Sep/05 21:14/links/breed-descriptions.html
177 29/Sep/05 17:25/graphics/postcard/
177 29/Sep/05 23:46/journal/3-2/drawing-blood.html
176 0.01%29/Sep/05 19:46/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_7.jpg
176 0.02%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/perfume_bottle.JPG
176 29/Sep/05 07:26/journalgerman/2-12/fliegenmaden.html
175 29/Sep/05 20:39/chapters/san-diego/behavior/quiz/q2answer_false.html
175 29/Sep/05 20:48/graphics/fun/netbunnies/Freckles-1.JPG
174 0.01%29/Sep/05 19:46/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_9.jpg
174 29/Sep/05 20:57/chapters/oakland/woolblok.html
174 29/Sep/05 23:46/chapters/san-diego/health/eye_scanning.html
173 0.01%29/Sep/05 17:02/rabbit-center/hayward_rescue/hayward_graphics/Lance_relaxing.JPG
173 0.03% 9/Sep/05 16:38/chapters/san-diego/adoption/Adoption_Photos/HRS_Dusty_1_29Aug05.jpg
172 0.02%29/Sep/05 17:02/rabbit-center/hayward_rescue/hayward_graphics/Janet_Lance_karens-lap.JPG
172 29/Sep/05 23:50/graphics/breeds/
11 29/Sep/05 03:59  /graphics/breeds/?N=D
172 0.01%29/Sep/05 19:46/rabbit-center/hayward_rescue/hayward_graphics/rescue_photo_11.jpg
171 29/Sep/05 21:30/hrs-info/membership-form.html
171 29/Sep/05 16:25/graphics/fun/netbunnies/photos-to-upload/
18 28/Sep/05 20:52  /graphics/fun/netbunnies/photos-to-upload/?D=A
17 29/Sep/05 05:33  /graphics/fun/netbunnies/photos-to-upload/?N=A
16 28/Sep/05 20:53  /graphics/fun/netbunnies/photos-to-upload/?N=D
14 28/Sep/05 20:53  /graphics/fun/netbunnies/photos-to-upload/?S=A
14 29/Sep/05 05:33  /graphics/fun/netbunnies/photos-to-upload/?D=D
13 29/Sep/05 16:25  /graphics/fun/netbunnies/photos-to-upload/?M=A
10 29/Sep/05 05:33  /graphics/fun/netbunnies/photos-to-upload/?S=D
171 0.01%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/beatrix_potter_books.JPG
170 29/Sep/05 20:40/chapters/san-diego/behavior/quiz/q5answer_false.html
170 29/Sep/05 19:17/rabbit-center/hayward_rescue/hayward_graphics/Ubu_day1.JPG
169 29/Sep/05 22:19/journal/3-8/numbers.html
168 29/Sep/05 20:14/chapters/san-diego/aboutus/member.html
168 29/Sep/05 23:46/journal/3-7/graphics/snake-bite-bunny.gif
168 29/Sep/05 20:40/chapters/san-diego/adoption/in-house.html
166 29/Sep/05 18:08/chapters/oakland/
166 0.01%29/Sep/05 21:36/graphics/fun/netbunnies/Tater-kormendi1.jpg
166 29/Sep/05 22:29/translations/german/
166 0.01%29/Sep/05 23:40/faqgerman/sections/kinder.html
165 0.01%29/Sep/05 22:26/graphics/fun/netbunnies/babies1-ozab1.jpg
165 0.01%29/Sep/05 23:58/graphics/fun/netbunnies/shnuggs3-tree1.jpg
165 29/Sep/05 23:46/journal/3-7/graphics/recovered.gif
164 0.01%29/Sep/05 20:47/graphics/fun/netbunnies/ElvisandMaddy.JPG
164 29/Sep/05 20:41/chapters/san-diego/behavior/quiz/q7answer_true.html
164 29/Sep/05 22:06/journal/3-10/conference.html
164 29/Sep/05 20:42/chapters/san-diego/behavior/quiz/q9answer_false.html
164 29/Sep/05 19:17/rabbit-center/hayward_rescue/rabbit.jpg
163 29/Sep/05 16:58/fun/answer6.html
163 29/Sep/05 23:46/journal/3-7/graphics/bunny-w-bandage.gif
162 29/Sep/05 17:21/chapters/san-diego/adoption/right.html
162 0.01%29/Sep/05 21:56/rabbit-center/adoptables/graphics/big/sara1-sml.jpg
162 29/Sep/05 23:46/journal/3-7/graphics/necrotic-tissue.gif
161 0.02%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/ice_tea_basket.JPG
161 29/Sep/05 23:06/journal/2-7/hop.html
160 29/Sep/05 22:42/links/sections/books-fiction.html
159 29/Sep/05 22:06/chapters/san-diego/behavior/quiz/q10answer_false.html
159 29/Sep/05 19:17/rabbit-center/hayward_rescue/clip_image023.gif
159 29/Sep/05 15:14/chapters/san-francisco/docs.html
158 29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/calendar.jpg
158 0.02%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/blue_porcelain_bunny.JPG
158 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/zorro_dr-harvey.jpg
158 0.01%29/Sep/05 21:11/graphics/fun/netbunnies/baby-mundy1.jpg
158 29/Sep/05 22:55/journal/3-1/sheltering-spirit.html
158 29/Sep/05 09:43/graphics/links/
10 29/Sep/05 03:58  /graphics/links/?N=D
157 0.01%29/Sep/05 21:06/rabbit-center/retail/cubesetL.jpg
157 29/Sep/05 20:57/chapters/san-diego/health/vet-talk/myths.html
156 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Karen_Richard.jpg
155 29/Sep/05 19:53/fun/answer8.html
155 0.01%29/Sep/05 23:54/graphics/fun/netbunnies/Mui Mui-chow1.jpg
154 29/Sep/05 23:02/rabbit-center/resources/spay_neuter.html
153 29/Sep/05 23:51/graphics/mine/
12 29/Sep/05 03:54  /graphics/mine/?S=A
11 28/Sep/05 21:13  /graphics/mine/?M=A
10 28/Sep/05 21:12  /graphics/mine/?D=A
10 29/Sep/05 01:57  /graphics/mine/?N=D
153 29/Sep/05 16:46/translations/portugese/baby-myths.html
153 29/Sep/05 17:21/chapters/san-diego/adoption/pdf_icon.gif
153 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Dr-Harvey_pregnant_girls.jpg
153 0.01%29/Sep/05 22:55/rabbit-center/lucky/images/recent-3_000.gif
153 29/Sep/05 16:48/graphics/easter/anti-victoria-circle.jpg
153 0.01%29/Sep/05 22:55/rabbit-center/lucky/images/recent-1_000.gif
153 0.01%29/Sep/05 21:40/journal/2-6/graphics/hasie-2.gif
153 29/Sep/05 18:03/rabbit-center/retail/lrgcageS.jpg
152 29/Sep/05 18:03/rabbit-center/retail/cubesetS.jpg
152 29/Sep/05 19:19/graphics/postcard/Tommy2.jpg
151 29/Sep/05 22:55/rabbit-center/lucky/images/back_photos.gif
151 29/Sep/05 22:55/rabbit-center/lucky/luckystory.htm
151 29/Sep/05 22:55/rabbit-center/lucky/images/back_photos_002.gif
151 0.02%29/Sep/05 22:55/rabbit-center/lucky/images/recent-2.gif
150 0.01%29/Sep/05 22:55/rabbit-center/lucky/images/recent-6.gif
150 29/Sep/05 21:31/journal/4-5/frith.html
149 29/Sep/05 21:42/journal/3-1/graphics/fifi.gif
149 29/Sep/05 18:11/hrs-info/other-support.html
149 0.01%29/Sep/05 16:43/graphics/calendars/0763149349_b.jpg
149 0.01%29/Sep/05 22:55/rabbit-center/lucky/images/recent-4.gif
149 0.01%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/coffee_cookie_bsket.JPG
149 29/Sep/05 21:42/journal/3-1/graphics/wascel.gif
149 28/Sep/05 11:15/rabbit-center/graphics/icon_links.gif
149 0.02%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/chargers_basket.jpg
149 0.01%29/Sep/05 22:55/rabbit-center/lucky/images/recent-5.gif
149 29/Sep/05 21:42/journal/3-1/graphics/george.gif
148 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Francine_dr-harvey.jpg
148 28/Sep/05 20:25/rabbit-center/adoptables/graphics/big/bungee08sml.jpg
148 28/Sep/05 21:30/cgi-bin/chat/stream.cgi
57  4/Sep/05 23:47  /cgi-bin/chat/stream.cgi?action=stream&id=azffqtludmbugivjghsgwqoxbhcpno
27 20/Sep/05 18:24  /cgi-bin/chat/stream.cgi?action=stream&id=sfmsxbgamtnxcgebxaufyxzywqzeju&pause=
10  9/Sep/05 20:01  /cgi-bin/chat/stream.cgi?action=stream&id=buinacmxouiaqjgihttwdzpppivasn&pause=
148 29/Sep/05 17:28/graphics/postcard/amos.jpg
148 27/Sep/05 17:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/brown_dutch-bunny.JPG
147 29/Sep/05 19:15/journal/3-2/graphics/disabled-1.gif
147 30/Sep/05 00:00/chapters/oakland/oldbun.html
147 0.01%29/Sep/05 20:21/graphics/fun/netbunnies/maggie-mccomb1.jpg
146 29/Sep/05 19:15/journal/3-2/graphics/disabled-2.gif
145 29/Sep/05 20:30/graphics/mine/toby-izzy/
10 29/Sep/05 20:30  /graphics/mine/toby-izzy/?N=D
145 0.01%29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/animal_place_chk-out_new_buns.jpg
145 29/Sep/05 23:11/graphics/fun/netbunnies/bello3-sims1.jpg
144 29/Sep/05 16:02/rabbit-center/adoptables/yoshi2.htm
143 29/Sep/05 22:21/journal/3-8/words.html
143 29/Sep/05 20:53/graphics/postcard/tabatha.jpg
143 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Frankie_dr-harvey.jpg
142 0.01%30/Sep/05 00:03/graphics/fun/netbunnies/peanut3-zawalickl1.jpg
142 0.01%29/Sep/05 10:38/faqgerman/sections/stubenrein.html
142 29/Sep/05 19:08/rabbit-center/adoptables/images/myra001_000.jpg
142 0.01%29/Sep/05 22:35/rabbit-center/adoptables/images/mrchipr145920sml_000.jpg
141 29/Sep/05 21:29/journal/3-7/graphics/ungetaway.gif
141 0.04%29/Sep/05 20:49/graphics/fun/netbunnies/HRS photos 4-12 to 5-3-03
141 29/Sep/05 16:26/chapters/michigan/jeremy2a.jpg
141 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Samantha_dr-harvey.jpg
140 29/Sep/05 19:08/rabbit-center/adoptables/myra.htm
140 28/Sep/05 08:15/rabbit-center/adoptpolicies.html
140 0.01%29/Sep/05 19:33/graphics/fun/netbunnies/rabbit2-sugar1.jpg
140 0.01%29/Sep/05 23:55/graphics/fun/netbunnies/josehpine-jikuu1.jpg
140 29/Sep/05 20:54/graphics/fun/netbunnies/Perla.JPG
140 30/Sep/05 00:00/journal/3-8/multi-maintenance.html
140 29/Sep/05 20:41/chapters/san-diego/behavior/quiz/q8answer_true.html
140 0.01%29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/animal_place_girls_emerge.jpg
140 29/Sep/05 22:00/rabbit-center/hayward_rescue/hayward_rabbits_toby_tribute.html
139 0.01%29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/pen_redesign.jpg
139 29/Sep/05 16:35/chapters/san-diego/behavior/graphics/2by-crate-gate.gif
139 29/Sep/05 21:09/faqgerman/sections/spielzeug.html
139 29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/smbunnyball.jpg
139 29/Sep/05 16:35/chapters/san-diego/behavior/graphics/looking-in-crate.gif
139 29/Sep/05 22:44/hrs-info/vet-conference/
138 29/Sep/05 16:35/chapters/san-diego/behavior/graphics/peering-above-crate.gif
138 29/Sep/05 22:13/journal/3-9/companions-not-dinner.html
138 29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/clip_image010.jpg
137 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Nancy-J_rabbit-back.jpg
136 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/finishing_pens.jpg
136 29/Sep/05 22:28/journal/3-6/giving-is-recieving.html
136 29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/clip_image012.jpg
136 28/Sep/05 19:53/chapters/san-diego/health/ears.html
136 29/Sep/05 18:36/hrs-info/volunteer.html
135 0.02%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/avon_basket.JPG
135 0.01%29/Sep/05 23:58/graphics/fun/netbunnies/bunny-ibrons1.jpg
135 0.01%29/Sep/05 14:04/rabbit-center/adoptables/graphics/big/fred r1412-09sml.jpg
135 29/Sep/05 14:36/fun/answer4.html
135 29/Sep/05 20:39/chapters/san-diego/behavior/quiz/q1answer_false.html
135 29/Sep/05 21:48/journal/4-7/visdelight.html
134 29/Sep/05 16:26/chapters/michigan/banner.gif
134 29/Sep/05 20:55/graphics/fun/netbunnies/Romeo.JPG
134 29/Sep/05 19:30/rabbit-center/adoptables/Clara.htm
134 29/Sep/05 07:48/chapters/san-diego/behavior/new_home.html
134 29/Sep/05 17:18/chapters/san-diego/behavior/litterbox.html
134 0.01%29/Sep/05 20:50/graphics/fun/netbunnies/IttyBityBuns.JPG
134 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Play_structures_installed.jpg
134 0.01%29/Sep/05 23:58/graphics/fun/netbunnies/rabbit1-sugar1.jpg
133 0.01%29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/animal_place_lemonade_rita.jpg
133 0.01%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunnykins_album_rabbit.JPG
132 29/Sep/05 21:09/faqgerman/sections/gefahren.html
132 29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Bigbunnyball.jpg
132 29/Sep/05 14:29/vets/vet-list-additions.html
132 0.01%29/Sep/05 22:18/graphics/fun/netbunnies/rabbits3-ginoto1.jpg
132 29/Sep/05 23:46/journal/3-9/chester.html
131 29/Sep/05 14:24/rabbit-center/hayward_rescue/hayward_graphics/Toby_2.JPG
131 29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/animal_place_prana-move.jpg
131 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Karen_J_Danny.jpg
131 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Liane-ko_Frankie.jpg
131 29/Sep/05 19:25/translations/japanese/spay-neuter-j.txt
131 0.01%29/Sep/05 22:55/rabbit-center/lucky/images/adopted-2.gif
130 0.01%29/Sep/05 22:55/rabbit-center/lucky/images/adopted-3.gif
130 0.01%29/Sep/05 22:45/graphics/mine/zippy1.jpg
130 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Pam-m_Frankie.jpg
130 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Kelly_s_Zorro.jpg
130 29/Sep/05 21:24/hrs-info/benefits.html
129 29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/thermometer.JPG
129 0.01%29/Sep/05 22:55/rabbit-center/lucky/images/adopted-5.gif
129 29/Sep/05 12:53/translations/dutch/blaasontsteking-en-blaasstenen-bij-het-konijn.html
129 0.01%29/Sep/05 22:55/rabbit-center/lucky/images/adopted-6.gif
129 0.01%29/Sep/05 22:55/rabbit-center/lucky/images/adopted-1.gif
129 0.01%29/Sep/05 22:55/rabbit-center/lucky/images/adopted-4.gif
129 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Kerry_s_frankie.jpg
129 29/Sep/05 14:24/rabbit-center/hayward_rescue/hayward_graphics/Toby_1.JPG
128 29/Sep/05 23:47/chapters/san-diego/health/laser_surgery.html
128 0.01%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/pellet_jar.JPG
128 29/Sep/05 22:36/journal/3-4/kids-program.html
128 0.01%29/Sep/05 16:42/graphics/mine/foo33.jpg
128 0.01%29/Sep/05 22:55/rabbit-center/lucky/images/adopted-7.gif
127 29/Sep/05 23:46/journal/3-2/geriatric.html
127 29/Sep/05 19:14/help/atomz-hints.html
127 29/Sep/05 03:44/rabbit-center/adoption-contract.rtf
127 29/Sep/05 23:47/journal/3-5/toxoplasmosis.html
127 29/Sep/05 21:14/rabbit-center/retail/treats.html
127 29/Sep/05 23:20/journal/2-5/wabbit.html
126 26/Sep/05 10:59/rabbit-center/graphics/icon_involvedpage.gif
125 29/Sep/05 23:10/journal/2-7/whos-the-pet.html
125 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Robin_Julie_best-friends.jpg
125 29/Sep/05 22:31/hrs-info/supporting.html
125 29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/flying_bunny_flower_pitcher.JPG
125 29/Sep/05 14:34/fun/answer5.html
125 0.01%29/Sep/05 19:30/chapters/san-diego/adoption/Easter/Rabbits_and_Children.html
124 0.01%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/F&F_teapot.JPG
124 29/Sep/05 21:58/rabbit-center/hayward_rescue/hayward_rabbits_update_jun6_04.html
124 29/Sep/05 23:16/faq/sections/shy.html
124 29/Sep/05 23:25/rabbit-center/hayward_rescue/hayward_rabbits_johanna.html
124 0.02%29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Royal_Doulton_Bunnykins_HighRes.jpg
123 29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/animal_place_sam_rita.jpg
123 29/Sep/05 23:47/graphics/fun/netbunnies/Lovers2.JPG
123 29/Sep/05 22:56/rabbit-center/lucky/luckysaved.htm
123 29/Sep/05 22:57/journal/2-11/dont-call-me-kind.html
123 29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/animal_place_bunny_temple2.jpg
123 29/Sep/05 19:12/links/sections/stories-rabbits-tell.html
123 30/Sep/05 00:05/chapters/san-diego/behavior/grief.html
122 29/Sep/05 16:55/journal/3-12/graphics/fosterer-allergies.gif
122 30/Sep/05 00:01/rabbit-center/hayward_rescue/hayward_rabbits_district_attny.html
122 0.02%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Country_Art_Rabbit.JPG
122 29/Sep/05 21:33/opinion/cruelty-case.html
121 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Terry-L-Sombra.jpg
121 0.04%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_purse_XL_t-shirt.JPG
121 29/Sep/05 23:30/graphics/mine/fripouille.html
121 0.01%29/Sep/05 18:28/journal/3-7/graphics/rescue-pen.gif
121 29/Sep/05 21:45/journal/4-7/pimpernell.html
120 29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/animal_place_new_girl.jpg
120 29/Sep/05 21:30/journal/4-5/ode.html
120 0.01%29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Cybis_Bunny_Bottom.JPG
120 29/Sep/05 16:23/care/vets-bay-area.html
120 29/Sep/05 23:50/hrs-info/whats-new-archive97.html
119 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Business_card_holder.JPG
119 29/Sep/05 23:50/graphics/awards/
119 0.01%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/fairy_bird-feeder.JPG
119 29/Sep/05 22:09/journal/3-10/pbs.html
119 29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/animal_place_sam_boy.jpg
119 29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/animal_place_regulars1.jpg
119 29/Sep/05 22:30/easter/link.html
119 29/Sep/05 23:00/journal/2-10/rabbits-on-the-road.html
119 0.01%29/Sep/05 18:28/journal/3-7/graphics/rescue-group.gif
119 29/Sep/05 18:58/chapters/san-diego/aboutus/bunnyfest/bunnyfest_2004.html
118 29/Sep/05 17:16/chapters/san-diego/adoption/take_home.html
118 29/Sep/05 22:14/journal/3-9/diners-beware.html
118 29/Sep/05 21:47/journal/4-7/subaru.html
118 28/Sep/05 11:12/rabbit-center/adopt-procedures.html
118 29/Sep/05 20:41/chapters/san-diego/behavior/quiz/q6answer_false.html
118 29/Sep/05 18:28/journal/3-7/graphics/woman-w-bunny.gif
117 29/Sep/05 05:34/graphics/books/
10 29/Sep/05 05:33  /graphics/books/?S=A
10 28/Sep/05 21:28  /graphics/books/?S=D
10 29/Sep/05 05:33  /graphics/books/?N=D
117 0.01%28/Sep/05 16:52/rabbit-center/adoptables/graphics/big/baloo-sml.jpg
117 29/Sep/05 23:22/translations/japanese/digestibility-j.txt
117 29/Sep/05 22:59/hrs-info/petco_update.html
117 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Justus_p_baxter.jpg
117 29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/animal_place_varina_goat.jpg
117 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Christine_M_Lance.jpg
117 29/Sep/05 23:00/faqgerman/sections/zusammenfuehrung.html
116 29/Sep/05 20:49/graphics/fun/netbunnies/IMG044.JPG
116 26/Sep/05 16:20/rabbit-center/news_release/index_clip_image002.jpg
116 29/Sep/05 21:01/journal/2-6/rick-fred-pj.html
115 29/Sep/05 05:30/chapters/san-diego/aboutus/donations.html
115 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Cybis_Bunny_Snowball_front.JPG
115 0.02%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/baby_bib_bunny.JPG
115 29/Sep/05 16:14/chapters/san-diego/aboutus/volunteer_ops.html
114 29/Sep/05 21:12/journal/3-8/disaster-preparedness.html
114 29/Sep/05 23:46/graphics/fun/netbunnies/IMG04.JPG
114 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Yuri_Ito_Benton.jpg
114 0.01%29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/bunny_every_lap.jpg
114 29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/charming_tails_carrot-bunny.JPG
113 0.07%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny-stamp_pin.JPG
113 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Kerry_S_Janet.jpg
113 29/Sep/05 02:48/faqgerman/
112 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Pam-M-michael_stroll.jpg
112 29/Sep/05 21:09/faq/sections/
112 0.01%29/Sep/05 23:19/rabbit-center/buddy/images/buddy1.gif
112 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/alpaca_bunny.JPG
112 29/Sep/05 22:35/journal/3-4/daycare.html
112 29/Sep/05 23:46/care/vhd-guidelines.html
112 29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/animal_place_new_arrivals2.jpg
112 29/Sep/05 23:42/hrs-info/whats-new-archive03.html
111 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Kelle_k_Benton.jpg
111 29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Blue_flwr_trnkt_box.JPG
111 29/Sep/05 18:55/translations/japanese/amoxicillin-warning-j.txt
111 29/Sep/05 22:08/journal/3-10/overgrooming.html
111 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Carol_S_bunny_lap.jpg
111 0.01%29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Royal_Doulton_Bunnykins_bottom.JPG
111 29/Sep/05 11:59/graphics/fun/netbunnies/bunny.bmp
111 29/Sep/05 22:42/journal/3-3/soft-stool.html
111 0.01%29/Sep/05 23:52/graphics/mine/emmybunny.jpg
111 29/Sep/05 23:19/rabbit-center/buddy/images/garbera3.gif
111 29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/animal_place_toe_cleaning.jpg
111 29/Sep/05 20:50/graphics/fun/netbunnies/Inseperable0002.JPG
110 29/Sep/05 23:31/journal/warren-wise/new-chapter.html
110 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/bunnQA.jpg
110 29/Sep/05 08:47/chapters/san-diego/health/vet-talk/
110 29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/animal_place_lemonade3.jpg
110 29/Sep/05 03:40/chapters/san-diego/terms_use.html
110 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Kelle_K_boys_driveway_2.jpg
110 29/Sep/05 17:55/chapters/san-diego/adoption/bunny_bonding.html
110 29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/animal_place_kibblefest_1.jpg
110 0.01%29/Sep/05 15:55/graphics/postcard/Rab1.jpg
110 29/Sep/05 23:19/rabbit-center/buddy/images/buddy-traced.gif
110 0.01%29/Sep/05 11:00/rabbit-center/hayward_rescue/hayward_graphics/eileen_page_bottom.jpg
110 0.01%29/Sep/05 23:19/rabbit-center/buddy/images/buddy2.gif
109 29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/animal_place_varina.jpg
109 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Carol_S_Jeanne_S_ttouch.jpg
109 0.01%29/Sep/05 12:40/help/toc-url.html
109 26/Sep/05 21:41/rabbit-center/grooming.html
109 29/Sep/05 21:54/rabbit-center/hayward_rescue/hayward_rabbits_adoption.html
109 29/Sep/05 11:42/rabbit-center/adoptables/graphics/big/yuna-r1395-16sml.jpg
108 29/Sep/05 20:12/rabbit-center/retail/toys.html
108 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Karen_J_Janet.jpg
108 29/Sep/05 20:49/graphics/fun/netbunnies/IMG02.JPG
108 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Jeanne_S_bunny_lap.jpg
108 29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_bank_2.JPG
108 29/Sep/05 23:38/easter/help.html
108 0.02%29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Danko_Bunny_Collectibles.JPG
108 29/Sep/05 23:49/hrs-info/whats-new-archive98.html
108 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Kelle_K_Bernie.jpg
108 29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/clip_image002.jpg
108 29/Sep/05 21:09/health/frontline.html
108 29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_placemat_bowl.JPG
107 29/Sep/05 22:07/rabbit-center/hayward_rescue/hayward_rabbits_one-group.html
107 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Phyllis_Lance.jpg
107 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Justus_Sam.jpg
107 29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/zen_bunny.JPG
107 29/Sep/05 16:26/chapters/michigan/corey8.jpg
107 29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/animal_place_kibblefest_2.jpg
107 29/Sep/05 22:39/journal/3-3/life-worthy.html
106 29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/animal_place_sam1.jpg
106 0.02%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/metal_platter.JPG
106 29/Sep/05 16:26/chapters/michigan/acb10.jpg
106 29/Sep/05 22:17/journal/3-9/you-never-know.html
106 29/Sep/05 16:26/chapters/michigan/boo1.jpg
106 29/Sep/05 19:40/rabbit-center/hayward_rescue/hayward_graphics/animal_place_lemonade_girl.jpg
106 29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/charmingtails_photo_frame.JPG
105 29/Sep/05 02:38/hrs-info/chapterapplication.html
105 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Sombra_dr-harvey_hypno.jpg
105 29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/pet_photo_book.JPG
105 29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/flowerpot_white_tshirt.JPG
105 29/Sep/05 17:06/chapters/san-diego/behavior/quiz/q1answer_true.html
104 28/Sep/05 08:15/rabbit-center/graphics/adopt-t.gif
104 29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/lenox_rabbit_cky-jar.jpg
104 29/Sep/05 10:02/faqgerman/sections/aggression-de.html
104 29/Sep/05 11:51/fun/answer12.html
104 29/Sep/05 22:24/journal/3-8/pound.html
104 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Michael_dr-harvey_1.jpg
104 29/Sep/05 16:02/rabbit-center/adoptables/images/ashleynew_001.jpg
104 29/Sep/05 16:26/chapters/michigan/mtz1.jpg
104 29/Sep/05 16:26/chapters/michigan/cdez11.jpg
104 0.01%29/Sep/05 10:32/graphics/postcard/izzy-portrait-crop.jpg
103 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Terry-L_Sombra_nail-trim.jpg
103 29/Sep/05 08:01/rabbit-center/retail/care.html
103 29/Sep/05 22:56/rabbit-center/lucky/spayed.htm
103 29/Sep/05 20:51/graphics/fun/netbunnies/Lupsu_nolo.bmp
103 29/Sep/05 16:26/chapters/michigan/jason4.jpg
103 29/Sep/05 21:09/chapters/socal/
103 29/Sep/05 16:26/chapters/michigan/sarah2.jpg
103 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Aimee_R_Zorro.jpg
103 29/Sep/05 16:26/chapters/michigan/lilly6.jpg
103 29/Sep/05 09:26/graphics/books/mitten.gif
103 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Baby_Lamp.JPG
103 29/Sep/05 10:27/fun/answer11.html
103 0.01%29/Sep/05 16:02/rabbit-center/adoptables/images/yoshimotor146153sml.jpg
102 29/Sep/05 23:20/journal/1/books.html
102 0.10%29/Sep/05 22:56/rabbit-center/lucky/images/safe-2.png
102 29/Sep/05 23:58/translations/japanese/incisors-j.txt
102 29/Sep/05 16:26/chapters/michigan/spot3.jpg
102 29/Sep/05 16:26/chapters/michigan/milo6.jpg
102 29/Sep/05 21:33/faqgerman/sections/klassenzimmer.html
102 29/Sep/05 16:24/chapters/oregon/vets.html
102 29/Sep/05 19:38/graphics/thumbnails/
102 29/Sep/05 16:26/chapters/michigan/luke10.jpg
102 29/Sep/05 16:26/chapters/michigan/ellie2.jpg
102 24/Sep/05 11:00/fun/net-bunnies.html/
101 29/Sep/05 09:26/graphics/books/runaway-bunny.gif
101 29/Sep/05 22:34/journal/3-4/togetherness.html
101 29/Sep/05 20:33/journal/3-7/graphics/sleeping-in-desk.gif
101 29/Sep/05 23:40/hrs-info/whats-new-archive04.html
100 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Kerry_S_Lewis.jpg
100 29/Sep/05 21:55/rabbit-center/hayward_rescue/hayward_graphics/Olga_dr-harvey.jpg
100 29/Sep/05 20:50/graphics/fun/netbunnies/IMG13.JPG
100 29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/blanket_purse.JPG
100 0.07%29/Sep/05 01:35/hrs-info/stats/all.html
100 29/Sep/05 22:51/journal/3-1/cold-tempeatures.html
99 29/Sep/05 22:29/journal/3-11/letters.html
99 29/Sep/05 19:31/rabbit-center/adoptables/Calypso.htm
99 0.01%29/Sep/05 20:33/journal/3-7/graphics/bunnys-w-toys.gif
99 29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/japanese_bowls.JPG
98 29/Sep/05 22:50/journal/3-1/a-hare-about-the-house.html
98 29/Sep/05 23:21/rabbit-center/retail/bags.html
98 29/Sep/05 18:52/hrs-info/web.html
98 29/Sep/05 19:59/journal/3-2/graphics/marsh.gif
98 29/Sep/05 23:47/hrs-info/whats-new-archive00.html
97 29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/F&F_salt-pepper.JPG
97 0.02%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bedtime_story_bunny.JPG
97 29/Sep/05 09:26/graphics/books/watershipdown.gif
96 0.01%29/Sep/05 22:56/rabbit-center/lucky/images/safe-1.gif
96 29/Sep/05 22:02/rabbit-center/hayward_rescue/hayward_rabbits_letter_writing.html
96 29/Sep/05 09:26/graphics/books/amazon.gif
96 0.01%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/rain_gauge.JPG
96 0.04%27/Sep/05 20:20/chapters/san-diego/aboutus/bunnyfest/Bunnyfest_Flyer_2005-fullpage.pdf
95 29/Sep/05 10:34/graphics/hrs-rabbits/
95 29/Sep/05 09:26/graphics/books/tales.gif
95 29/Sep/05 09:26/graphics/books/potter.gif
95 29/Sep/05 09:26/graphics/books/marshmallow.gif
95 29/Sep/05 09:26/graphics/books/rabbit-hill.gif
95 29/Sep/05 12:38/chapters/san-diego/aboutus/bunnyfest/auction_photos.html
95 29/Sep/05 09:26/graphics/books/jackrabbit.gif
95 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Natures_children_plate.JPG
95 29/Sep/05 22:36/rabbit-center/adoptables/meg.htm
95 0.01%29/Sep/05 22:56/rabbit-center/lucky/images/safe-3.gif
95 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Rice_bowls.JPG
94 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Salad_quiche_set.JPG
94 29/Sep/05 15:01/rabbit-center/adoptables/graphics/big/r835heidi25sml.jpg
94 29/Sep/05 09:26/graphics/books/velveteen.gif
94 0.01%29/Sep/05 17:27/graphics/postcard/strawberry-white-baby.jpg
94 0.01%29/Sep/05 10:51/rabbit-center/hayward_rescue/hayward_graphics/tt_2.JPG
94 29/Sep/05 03:54/rabbit-center/adoptables/seamus.htm
93 29/Sep/05 16:24/hrs-info/awards.html
93 29/Sep/05 21:00/rabbit-center/lucky/letter-from.htm
93 29/Sep/05 23:22/rabbit-center/retail/deco.html
93 29/Sep/05 22:55/rabbit-center/lucky/images/abusersondock_000.jpg
93 29/Sep/05 10:51/rabbit-center/hayward_rescue/hayward_graphics/tt_3.JPG
93 0.01%29/Sep/05 10:51/rabbit-center/hayward_rescue/hayward_graphics/tt_6.JPG
93 0.01%29/Sep/05 10:51/rabbit-center/hayward_rescue/hayward_graphics/toby_ramp.JPG
93 29/Sep/05 10:51/rabbit-center/hayward_rescue/hayward_graphics/tt_1.JPG
93 29/Sep/05 10:51/rabbit-center/hayward_rescue/hayward_graphics/tt-3.JPG
93 29/Sep/05 03:26/chapters/oregon/adoption.html
93 29/Sep/05 23:46/health/database.html
93 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Japanese_teapot.JPG
93 29/Sep/05 06:26/translations/dutch/verlagingvanhetcalcium.html
93 0.01%29/Sep/05 22:55/rabbit-center/lucky/images/lucky20ondock_000.jpg
93 0.03%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/cutting_board.JPG
93 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Barfoot_Drawing.JPG
92 0.01%29/Sep/05 03:52/graphics/mine/zippy3.jpg
92 29/Sep/05 14:29/graphics/mine/foo/gifs/
10 28/Sep/05 21:10  /graphics/mine/foo/gifs/?S=A
10 29/Sep/05 01:46  /graphics/mine/foo/gifs/?D=A
92 29/Sep/05 23:47/chapters/oakland/hurtshop.html
92 29/Sep/05 22:35/rabbit-center/adoptables/Seamus.htm
92 29/Sep/05 23:46/journal/3-11/radiologist.html
92 29/Sep/05 23:47/graphics/fun/netbunnies/Nibbel3.JPG
92 29/Sep/05 21:14/foster-homes/burrow-inn/css/mm_wedding.css
92 29/Sep/05 22:50/rabbit-center/hayward_rescue/hayward_rabbits_play-areas.html
92 29/Sep/05 20:52/graphics/fun/netbunnies/MVC-016S.JPG
91 29/Sep/05 20:53/rabbit-center/retail/guinea.html
91 29/Sep/05 13:44/rabbit-center/adoptables/fiona.htm
91 30/Sep/05 00:06/journal/about.html
91 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Silver_bracelet.jpg
91 0.01%29/Sep/05 10:51/rabbit-center/hayward_rescue/hayward_graphics/tt_5.JPG
91 29/Sep/05 22:03/rabbit-center/hayward_rescue/hayward_rabbits_eileen.html
91 29/Sep/05 23:51/graphics/index/
13 28/Sep/05 21:17  /graphics/index/?N=D
10 28/Sep/05 21:16  /graphics/index/?S=A
10 28/Sep/05 21:16  /graphics/index/?N=A
91 29/Sep/05 10:19/chapters/san-diego/behavior/quiz/q6answer_true.html
91 29/Sep/05 15:58/translations/japanese/haydiet-j.txt
91 29/Sep/05 23:21/rabbit-center/services/
91 29/Sep/05 22:30/care/vets_svirginia.html
91 29/Sep/05 10:29/fun/answer7.html
91 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bochy_photo.JPG
91 29/Sep/05 19:05/translations/japanese/emergencies-j.txt
91 29/Sep/05 18:20/hrs-info/vet-conference/vetcon.gif
90 29/Sep/05 18:34/journal/3-10/graphics/deeb.gif
90 29/Sep/05 18:34/journal/3-10/graphics/rosenthal.gif
90 29/Sep/05 18:34/journal/3-10/graphics/williford.gif
90 29/Sep/05 18:34/journal/3-10/graphics/conference2.gif
90 29/Sep/05 15:53/graphics/mine/foo/8-zowie-holiday-inn.jpg
90 29/Sep/05 15:26/chapters/san-francisco/adoptables_0802.html
90 29/Sep/05 18:34/journal/3-10/graphics/jenkins.gif
90 29/Sep/05 21:48/graphics/resources/
11 28/Sep/05 21:02  /graphics/resources/?D=D
90 28/Sep/05 21:40/opinion/july-adopt-a-rabbit.html
90 29/Sep/05 18:34/journal/3-10/graphics/harkness.gif
90 29/Sep/05 04:01/graphics/banners/
11 28/Sep/05 21:30  /graphics/banners/?S=A
10 29/Sep/05 03:43  /graphics/banners/?N=D
90 0.01%29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Primitive Bunny & Box.JPG
90 29/Sep/05 16:56/chapters/san-diego/aboutus/wish_list.html
90 29/Sep/05 21:14/rabbit-center/retail/matS.jpg
90 29/Sep/05 18:34/journal/3-10/graphics/conference1.gif
90 29/Sep/05 21:14/foster-homes/burrow-inn/images/mm_spacer.gif
90 29/Sep/05 22:33/translations/japanese/bladder-stones-j.txt
90 29/Sep/05 22:26/journal/3-7/program.html
89 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Alabaster_bunny.JPG
89 29/Sep/05 13:25/rabbit-center/adoptables/Flip.htm
89 29/Sep/05 21:14/rabbit-center/retail/ballS.gif
89 28/Sep/05 21:41/rabbit-center/retail/carry.html
89 29/Sep/05 23:23/journal/1/bunnymoon.html
89 29/Sep/05 21:14/foster-homes/burrow-inn/images/bun.gif
89 29/Sep/05 17:39/chapters/oakland/title.jpg
89 29/Sep/05 21:14/rabbit-center/retail/basketS.jpg
89 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Ricker_wine_goblet.jpg
89 29/Sep/05 05:51/graphics/fun/netbunnies/The Secret
89 29/Sep/05 22:30/journal/3-6/soft-stool-no-veggies.html
89 29/Sep/05 17:18/chapters/san-diego/behavior/graphics/litterbox_after.jpg
89 28/Sep/05 15:42/rabbit-center/adoptables/graphics/big/spike-sasparilla161sml.jpg
88 29/Sep/05 23:55/faqgerman/sections/tierarzt.html
88 29/Sep/05 23:47/graphics/fun/netbunnies/MVC-018F.JPG
88 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Chargers_Jersey.JPG
88 29/Sep/05 23:52/hrs-info/whats-new-archive96.html
88 29/Sep/05 23:16/journal/2-5/community-ed.html
88 29/Sep/05 18:33/care/vets_tennessee.html
88 29/Sep/05 15:18/hrs-info/survey.html
88 29/Sep/05 19:29/rabbit-center/adoptables/ronnie.htm
88 29/Sep/05 22:35/chapters/san-diego/adoption/Adoption_Photos/HRS_Oreo_2_2Nov03.JPG
88 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/index.htm
88 29/Sep/05 23:53/translations/spanish/rescue-spanish.html
88 28/Sep/05 20:49/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Grey_bunny-in-arms.JPG
88 29/Sep/05 21:14/rabbit-center/retail/tunnelS.gif
88 29/Sep/05 20:52/graphics/fun/netbunnies/MVC-011S.JPG
88 29/Sep/05 21:14/rabbit-center/retail/ringS.jpg
88 29/Sep/05 23:25/journal/warren-wise/eulogies.html
87 29/Sep/05 10:27/fun/answer10.html
87 29/Sep/05 21:50/rabbit-center/hayward_rescue/hayward_rabbits_toby.html
87 0.02%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/big_grey_bunny.JPG
87 29/Sep/05 11:05/hrs-info/how-donations-are-used.html
87 29/Sep/05 13:56/rabbit-center/hayward_rescue/hayward_graphics/johanna_medical_exam.JPG
87 29/Sep/05 21:02/adopt-a-rabbit-month/press-release-04.html
87 0.01%29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Football_2.JPG
86 29/Sep/05 08:03/spam_vaccine/mailto.gif
86 29/Sep/05 03:47/graphics/gallery/
86 0.01%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/hilltop_house_souvenirs.JPG
86 28/Sep/05 19:52/chapters/san-diego/health/hotline.html
85 29/Sep/05 23:43/rabbit-center/adoptables/chris.htm
85 28/Sep/05 20:47/chapters/oregon/sanctuary.html
85 29/Sep/05 21:29/rabbit-center/lucky/sf-crronicle.htm
85 29/Sep/05 23:43/hrs-info/whats-new-archive01.html
85 29/Sep/05 20:12/rabbit-center/retail/hngtoysL.jpg
85 0.01%28/Sep/05 18:49/graphics/mine/zippy2.jpg
85 29/Sep/05 20:04/links/zowie.html
85 29/Sep/05 15:34/faqgerman/sections/warmwetter.html
85 29/Sep/05 20:52/graphics/fun/netbunnies/MVC-029S.JPG
85 29/Sep/05 05:59/graphics/mine/foo/2-pumpkin-foo.jpg
84 29/Sep/05 05:03/faqgerman/sections/ernaehrung.html
84 0.01%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/rustic_candle_holders.JPG
84 29/Sep/05 21:14/rabbit-center/retail/tentS.jpg
84 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Easter_Bell.JPG
84 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/White_rabbit_casserole.JPG
84 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Rosie_rabbit_Franklin-mint.JPG
84 29/Sep/05 22:45/journal/3-2/foot-problems.html
83 29/Sep/05 22:12/rabbit-center/retail/hay.html
83 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Two_flower_Pots.JPG
83 29/Sep/05 17:47/rabbit-center/adoptables/graphics/big/peaches26sml.jpg
83 29/Sep/05 17:51/chapters/san-diego/aboutus/hay_elf.html
83 29/Sep/05 18:21/translations/portugese/right-person.html
83 29/Sep/05 23:48/hrs-info/whats-new-archive99.html
83 29/Sep/05 23:07/journal/2-7/power-plays.html
83 29/Sep/05 04:00/graphics/thanks/
83 29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/diane_wat_t-shirt.JPG
83 29/Sep/05 21:10/chapters/san-diego/adoption/right_rabbit.html
83 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/ski_hat.jpg
83 29/Sep/05 20:30/journal/3-5/habitat-brochure.html
82 29/Sep/05 19:29/rabbit-center/adoptables/images/myra001_001.jpg
82 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Blue_Lattice_flwrd_vase.JPG
82 29/Sep/05 21:52/journal/4-3/finders-keepers.html
82 29/Sep/05 09:19/adoptiongerman/hrszucht.html
82 29/Sep/05 20:52/graphics/fun/netbunnies/MVC-015S.JPG
82 29/Sep/05 09:31/chapters/san-diego/aboutus/bunnyfest/bfest_toydonation.html
82 29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/basket_candles.JPG
82 29/Sep/05 20:52/graphics/fun/netbunnies/MRBIG01.JPG
82 29/Sep/05 15:32/faqgerman/sections/draussen.html
82 29/Sep/05 09:00/faqgerman/sections/medizinverabreichen.html
82 29/Sep/05 21:58/rabbit-center/hayward_rescue/hayward_rabbits_spay-neuter.html
82 29/Sep/05 10:19/rabbit-center/hayward_rescue/hayward_graphics/hayward4.jpg
82 29/Sep/05 17:18/chapters/san-diego/behavior/graphics/litterbox_before.jpg
82 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Rabbit_Pitcher_2.JPG
81 29/Sep/05 15:53/graphics/mine/foo/4-under-bed.jpg
81 29/Sep/05 23:51/graphics/homepage/
81 29/Sep/05 23:42/hrs-info/whats-new-archive02.html
81 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Garden_Bunnies_Wall_Hanging.JPG
81 29/Sep/05 10:27/graphics/shelter/
81 29/Sep/05 21:31/rescue/resources.html
81 29/Sep/05 23:29/translations/japanese/medical-j.txt
81 29/Sep/05 15:23/translations/japanese/fiber-j.txt
81 29/Sep/05 16:24/journal/donations.html
81 29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/hay-rack.jpg
80 29/Sep/05 17:39/chapters/oakland/aboutus.html
80 29/Sep/05 18:32/chapters/san-diego/behavior/microchip.html
80 29/Sep/05 11:48/care/holidays.html
80 0.01%29/Sep/05 13:56/rabbit-center/hayward_rescue/hayward_graphics/johanna_shelter.JPG
80 29/Sep/05 13:25/links/sections/Rabbits911.html
80 29/Sep/05 23:07/journal/3-6/making-a-difference.html
80 29/Sep/05 13:43/rabbit-center/adoptables/taylor.htm
79 29/Sep/05 23:56/chapters/san-francisco/overlooked.html
79 29/Sep/05 03:52/chapters/oakland/bladder.html
79 29/Sep/05 15:01/easter/flyer/flyer2.gif
79 29/Sep/05 15:01/easter/flyer/childstory.jpg
79 29/Sep/05 23:22/rabbit-center/retail/store3L.jpg
79 29/Sep/05 10:19/rabbit-center/hayward_rescue/hayward_graphics/hayward2.jpg
79 29/Sep/05 16:31/journal/3-8/graphics/multi.gif
79 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/HK_Fergie_2.jpg
79 0.01%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/two_pins.jpg
79 29/Sep/05 19:08/rabbit-center/rabbit_ofthe_month/
79 29/Sep/05 15:01/easter/flyer/flyer3.gif
79 29/Sep/05 13:56/rabbit-center/hayward_rescue/hayward_graphics/Zorro_testicle-growth.JPG
79 29/Sep/05 10:19/rabbit-center/hayward_rescue/hayward_graphics/hayward3.jpg
79 29/Sep/05 22:22/journal/3-8/yard-sale-bunny.html
79 29/Sep/05 15:01/easter/flyer/flyer1.gif
79 29/Sep/05 21:50/journal/4-4/paul-bloom.html
79 29/Sep/05 10:19/rabbit-center/hayward_rescue/hayward_graphics/hayward1.jpg
79 29/Sep/05 15:01/easter/flyer/food-not-free.jpg
79 29/Sep/05 15:01/easter/flyer/flyer4.gif
79 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Irish_Pewter_Measure.JPG
78 29/Sep/05 16:31/journal/3-8/graphics/dexter.gif
78 29/Sep/05 18:47/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/tapestry_pillow.JPG
78 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Rabbit_custard_cup.JPG
78 29/Sep/05 16:25/faqgerman/sections/mehrere.html
78 29/Sep/05 23:44/chapters/san-diego/aboutus/bunnyfest/bunnyfest_2003_photos.html
78 29/Sep/05 13:56/rabbit-center/hayward_rescue/hayward_graphics/johanna_better_now.JPG
78 29/Sep/05 13:56/rabbit-center/hayward_rescue/hayward_graphics/Michael_abscess.JPG
77 29/Sep/05 13:56/rabbit-center/hayward_rescue/hayward_graphics/johanna_growth.JPG
77 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bunny_Watercolor_DD.JPG
77 29/Sep/05 16:04/rabbit-center/adoptables/yelena.htm
77 0.01%29/Sep/05 19:02/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/resin_plaque.JPG
77 29/Sep/05 10:12/chapters/san-diego/aboutus/find_out_more.html
77 0.01%29/Sep/05 18:47/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_pin.JPG
77 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/wood_door_hanger.JPG
77 29/Sep/05 23:51/graphics/misc/
77 29/Sep/05 22:56/rabbit-center/lucky/images/spayed-1.gif
77 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Baby_outfit.JPG
77 29/Sep/05 20:42/care/vets-uncovered-regions.txt
77 29/Sep/05 18:47/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/rustic_ceramic_bunny.JPG
77 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Calico_bunny.JPG
77 29/Sep/05 02:17/hrs-info/vet-conference/original-brochure.html
77 29/Sep/05 22:56/rabbit-center/lucky/images/spayed-2.gif
76 29/Sep/05 18:01/journal/3-4/graphics/kids.gif
76 29/Sep/05 16:37/care/vets_hawaii.html
76 29/Sep/05 20:45/rabbit-center/retail/litter.html
76 29/Sep/05 13:56/rabbit-center/hayward_rescue/hayward_graphics/Zorro_mask.JPG
76 29/Sep/05 22:56/rabbit-center/lucky/images/spayed-3.gif
76 29/Sep/05 23:48/graphics/fun/netbunnies/Sugaree-Bigwig.JPG
76 29/Sep/05 23:51/icons/text.gif
76 0.03%29/Sep/05 14:52/chapters/san-diego/aboutus/bunnyfest/BunnyfestFlyer_half_2005.pdf
76 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Napkin_rings.JPG
76 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bunny_Pitcher.JPG
76 29/Sep/05 13:05/fun/reader-photos2.html
76 29/Sep/05 16:37/rabbit-center/adoptables/graphics/big/R705 Java 47 sml.jpg
75 0.01%28/Sep/05 01:50/rabbit-center/adoptables/graphics/thumb/
75 29/Sep/05 09:51/graphics/fun/netbunnies/att00218.jpeg
75 0.01%29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/space_rabbit_poster.JPG
75 29/Sep/05 13:56/rabbit-center/hayward_rescue/hayward_graphics/Michael_Karen.JPG
75 29/Sep/05 22:41/journal/3-3/rescuers-worst-nightmare.html
75 29/Sep/05 17:40/journal/vol2-by-subject-index.html
75 29/Sep/05 13:56/rabbit-center/hayward_rescue/hayward_graphics/Micheal_w-boys.JPG
75 0.01%29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/baby_jumper.JPG
75 29/Sep/05 12:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Anne_Geddes_doll.jpg
75 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Welcome_sign.JPG
75 29/Sep/05 23:27/journal/warren-wise/grooming-table.html
75 0.01%29/Sep/05 08:01/rabbit-center/retail/groominL.jpg
75 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/pink_nesting_rabbit.JPG
75 29/Sep/05 13:56/rabbit-center/hayward_rescue/hayward_graphics/happy_johanna.JPG
74 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bunny_cabbage_pitcher.JPG
74 29/Sep/05 20:02/translations/japanese/eye-problems-j.txt
74 29/Sep/05 23:21/rabbit-center/retail/haybagsL.jpg
74 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/kids_writing_basket.JPG
74 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Fitz_Floyd_rabbit.JPG
74 29/Sep/05 21:44/rabbit-center/events/
74 29/Sep/05 18:37/chapters/san-diego/products/coloring_book.html
74 29/Sep/05 22:55/rabbit-center/lucky/letters_to_judge.htm
74 29/Sep/05 13:56/rabbit-center/hayward_rescue/hayward_graphics/Zorro_w-Karen.JPG
74 0.01%29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/garden_stakes.JPG
74 29/Sep/05 00:10/behaviourgerman/koerpersprache.html
74 29/Sep/05 16:31/journal/3-9/graphics/lop-eating-hay.gif
74 29/Sep/05 15:44/rabbit-center/hayward_rescue/hayward_graphics/Hayward_buns_shelter_3.JPG
74 29/Sep/05 17:12/rabbit-center/adoptables/graphics/big/r834hayley11sml.jpg
74 29/Sep/05 03:57/graphics/hrs-rabbits/living-with/
74 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/furniture_feet.JPG
73 29/Sep/05 14:27/care/vets_louisiana.html
73 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/grey_stuffed_bunny.JPG
73 29/Sep/05 03:42/graphics/mine/phil/
10 29/Sep/05 01:36  /graphics/mine/phil/?D=A
10 28/Sep/05 21:09  /graphics/mine/phil/?N=D
73 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/blanket_rattle-bunny.JPG
73 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/HK_Harry_2.jpg
73 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/year_of_rabbit.JPG
73 29/Sep/05 16:43/translations/portugese/easter.html
73 29/Sep/05 13:22/rabbit-center/adoptables/P2050012med.jpg
73 29/Sep/05 05:34/rabbit-center/retail/food.html
73 29/Sep/05 21:22/rabbit-center/lucky/letter-to.htm
73 29/Sep/05 18:58/translations/japanese/aggression-j.txt
73 29/Sep/05 22:02/translations/japanese/age-related-behavior-j.txt
73 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Picnic_Basket_carrier.JPG
73 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/angel_bunny.JPG
73 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bedtime_Buddies_2.JPG
73 29/Sep/05 10:05/faqgerman/sections/training-de.html
73 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/photo_bracelet.JPG
73 29/Sep/05 19:53/press-kit/easter-press-release.html
73 29/Sep/05 12:25/rabbit-center/adoptables/benito.htm
73 29/Sep/05 15:53/graphics/mine/foo/6-licking.jpg
73 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Two_Bisque_Bunnies_pair1.JPG
73 29/Sep/05 17:33/rabbit-center/adoptables/vanzetti.htm
73 29/Sep/05 21:49/journal/4-5/doors-open.html
73 0.01%29/Sep/05 18:36/hrs-info/volunteerapp.doc
73 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/key_rack.jpg
73 28/Sep/05 23:19/care/reproduction.html
72 29/Sep/05 20:35/graphics/adoption-ed-small-oval.jpg
72 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Two_Bisque_Bunnies_pair2.JPG
72 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_pillow_sz-chart.JPG
72 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/2-bunny_creamers.JPG
72 29/Sep/05 15:15/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_bird_house.JPG
72 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Southwest_bunny_pins.jpg
72 29/Sep/05 17:47/chapters/oakland/nobadrab.html
72 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/votive_cndl_watering-can.JPG
72 29/Sep/05 21:41/journal/submissions.html
72 0.01%29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Tall_Grape_Vase.JPG
72 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Flowered_Bunny_Trinket_Box.JPG
72 0.01%29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/shiny_bunny_box.JPG
71 29/Sep/05 22:01/journal/3-11/burn-out.html
71 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/styupark_book.JPG
71 0.01%29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/jodi_jensen_print.JPG
71 28/Sep/05 20:51/chapters/oregon/images/sanctuaryheader.jpg
71 29/Sep/05 15:50/rabbit-center/adoptables/graphics/big/tia r1409 06sml.jpg
71 29/Sep/05 16:24/chapters/oregon/supplies.html
71 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/carrot_trivet.JPG
71 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Peter_Rabbit_Frame-Book.JPG
71 28/Sep/05 20:51/chapters/oregon/images/bunnymascot6.jpg
71 29/Sep/05 23:34/journal/warren-wise/saftey.html
71 29/Sep/05 23:41/translations/japanese/bibliography-j.txt
71 29/Sep/05 22:03/journal/3-11/ww.html
71 28/Sep/05 19:56/chapters/san-diego/aboutus/whoweare.html
70 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/white_trinket_box.JPG
70 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Rug_lotion.jpg
70 29/Sep/05 23:26/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Brown-eyed_bun.JPG
70 29/Sep/05 13:13/care/vets_iowa.html
70 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_blanket_peter.JPG
70 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Books_puzzle.JPG
70 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Easter_candy_dishes-2.JPG
70 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_plaque.JPG
70 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Silver_Pearl_Necklace.JPG
70 29/Sep/05 01:05/faqgerman/sections/nagen.html
70 29/Sep/05 12:01/opinion/subaru.html
70 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/white_bunny_cookie-jar.JPG
70 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/brn_bunny_puzzle.jpg
70 29/Sep/05 04:00/graphics/10.gif
70 29/Sep/05 15:36/fun/answer9.html
69 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Olympic_pins.JPG
69 28/Sep/05 20:51/chapters/oregon/images/bunnymascot2.jpg
69 26/Sep/05 16:03/rabbit-center/rabbit_ofthe_month/august05/
69 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/welcome_sign.JPG
69 29/Sep/05 23:47/links/sections/
11 29/Sep/05 23:47  /links/sections/?M=D
10 28/Sep/05 12:30  /links/sections/?D=D
69 29/Sep/05 09:05/opinion/newsday-reprint.html
69 29/Sep/05 17:38/chapters/oregon/newsletter.html
69 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/welcome_sign_2.JPG
69 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/bunny_soap_dish.JPG
69 0.01%29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/olympic_bobblehead.JPG
69 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/powder_room_bunny.JPG
69 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/easter_tea_set.JPG
69 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/white_collectible_bunny.JPG
69 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/stuffed_bunny_carrier.JPG
69 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/rustic_rabbit_w-heart.JPG
69 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/brn_bunny_photo_album.JPG
68 29/Sep/05 23:04/journal/2-7/permanence.html
68 29/Sep/05 22:38/translations/japanese/chew-stick-j.txt
68 29/Sep/05 22:31/journal/3-5/warehouse.html
68 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Baby_shoes_bib_frame.JPG
68 29/Sep/05 23:08/fun/izzy-zowie/lisa-t.jpg
67 29/Sep/05 13:45/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/white_casserole.JPG
67 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Diane_Wat_blouse.JPG
67 0.01%29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/White_Bunny_CookieJar.JPG
67 29/Sep/05 04:00/graphics/2003arrmsugar2.jpg
67 29/Sep/05 23:02/journal/2-9/special-rabbit.html
67 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Powder_Bobblehead.JPG
67 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Ruffled_bowl.JPG
67 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Lenox_Cottontail_Plate.JPG
67 29/Sep/05 08:46/rabbit-center/hayward_rescue/hayward_graphics/Albert_adopt.jpg
67 29/Sep/05 08:46/rabbit-center/hayward_rescue/hayward_graphics/baxter140tiny.jpg
67 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Green-flwrd_rabbit_vase_2.JPG
67 29/Sep/05 10:49/chapters/san-diego/behavior/quiz/q8answer_false.html
67 29/Sep/05 20:57/graphics/fun/netbunnies/Spencer-Bianca.JPG
67 28/Sep/05 21:23/chapters/san-diego/aboutus/volunteer_materials.html
67 29/Sep/05 23:21/rabbit-center/retail/vids.html
67 29/Sep/05 23:24/journal/warren-wise/cage-door.html
67 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bronze_trinket_box.JPG
67 29/Sep/05 22:35/rabbit-center/adoptables/images/enzo_r1451_13sml.jpg
67 29/Sep/05 22:58/journal/2-11/willingly-useful.html
67 29/Sep/05 08:27/translations/portugese/philosophy.html
66 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Gund_Flower_Bunny_2.JPG
66 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/suzie-sample.jpg
66 29/Sep/05 05:21/faqgerman/sections/leckereien.html
66 29/Sep/05 08:46/rabbit-center/hayward_rescue/hayward_graphics/bernie147tiny.jpg
66 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Verdegris_Candle_Bunny.JPG
66 0.01%29/Sep/05 09:52/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Abbys_rose_framed.JPG
66 0.01%29/Sep/05 13:05/graphics/fun/netbunnies/sherlock.gif
66 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Fairy_Bunny.JPG
66 29/Sep/05 08:46/rabbit-center/hayward_rescue/hayward_graphics/diana106tiny.jpg
66 29/Sep/05 19:32/rabbit-center/adoptables/graphics/big/satin-r1308-01sml.jpg
66 29/Sep/05 23:09/chapters/oakland/ana.jpg
57 29/Sep/05 23:09  /chapters/oakland/ana.jpg?
65 29/Sep/05 08:46/rabbit-center/hayward_rescue/hayward_graphics/gigi084tiny.jpg
65 29/Sep/05 15:44/rabbit-center/hayward_rescue/hayward_graphics/hayward_bunnies_3.jpg
65 29/Sep/05 17:51/rabbit-center/adoptables/graphics/big/natasha03sml.jpg
65 29/Sep/05 08:46/rabbit-center/hayward_rescue/hayward_graphics/francine057tiny.jpg
65 29/Sep/05 13:44/chapters/san-francisco/stores.html
65 29/Sep/05 08:46/rabbit-center/hayward_rescue/hayward_graphics/angel062tiny.jpg
65 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bunny_Candy_dish.JPG
65 29/Sep/05 22:52/journal/3-1/first-rescue.html
65 29/Sep/05 08:46/rabbit-center/hayward_rescue/hayward_graphics/benton111tiny.jpg
65 29/Sep/05 23:05/journal/2-7/educators.html
65 29/Sep/05 17:36/rabbit-center/adoptables/graphics/big/debbie r1411 09sml.jpg
65 29/Sep/05 18:46/journal/3-8/graphics/litterbox-trained.gif
65 29/Sep/05 20:01/rabbit-center/lucky_rescue.html/robots.txt
64 29/Sep/05 21:13/chapters/san-diego/health/graphics/Frankenbunny-1.JPG
64 29/Sep/05 22:36/rabbit-center/adoptables/images/June29th003_000.jpg
64 29/Sep/05 23:52/chapters/san-francisco/bunny-butt.gif
64 29/Sep/05 09:47/graphics/fun/netbunnies/Twilight.gif
64 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Large_White_Ceramic_Bunnies.JPG
64 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/2-Bunny_Trinket_box.JPG
64 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Spanish_Plate.JPG
64 29/Sep/05 08:46/rabbit-center/hayward_rescue/hayward_graphics/danny116tiny.jpg
63 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/Chloe_Chelsea_1_Dec04.jpg
63 29/Sep/05 19:04/rabbit-center/adoptables/graphics/big/
63 29/Sep/05 23:42/chapters/san-diego/adoption/cage.html
63 29/Sep/05 12:08/caregerman/
63 28/Sep/05 05:02/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Black_agouti.JPG
63 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Dancing_choco_bunny.JPG
63 29/Sep/05 21:13/chapters/san-diego/health/graphics/Skye_sofa.jpg
63 29/Sep/05 23:30/journal/warren-wise/hot-weather.html
63 29/Sep/05 22:10/journal/3-10/writers-guidelines.html
62 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/dixie.jpg
62 29/Sep/05 04:01/graphics/store/
62 29/Sep/05 18:55/chapters/san-diego/aboutus/bunnyfest/bfest_auction_2004.html
62 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Nooman_2_Feb05.jpg
62 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/images/mm_spacer.gif
62 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_gino2.jpg
62 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/HK_PotBelly_Candles.JPG
62 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Emily_2_FEb05.jpg
62 0.02%29/Sep/05 09:52/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/placemats_napking-rings.JPG
62 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Nooman_1_Feb05.jpg
62 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Christmas_Bunny.JPG
62 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Small_floral_basket.JPG
62 29/Sep/05 17:36/rabbit-center/adoptables/Roman.htm
62 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/Harley_Jan05.jpg
62 29/Sep/05 15:34/easter/thanks.html
62 29/Sep/05 18:40/chapters/michigan/specialneeds.html
62 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Blue_Fenton_Bunny.JPG
62 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_gino1.jpg
62 29/Sep/05 21:09/chapters/oregon/newsletter99_1.html
62 29/Sep/05 22:03/rabbit-center/hayward_rescue/hayward_rabbits_media_coverage.html
61 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Silver_Frames.JPG
61 29/Sep/05 17:10/hrs-info/spam_vaccine/spam_vaccine.js
61 29/Sep/05 11:28/care/vets-uncovered-regions.html
61 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/HK_RolyPoly_Salt-Pepper.JPG
61 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Emily_1_FEb05.jpg
61 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Merry_Pippen_2_Dec04.jpg
61 29/Sep/05 08:46/rabbit-center/hayward_rescue/hayward_graphics/janet018tiny.jpg
61 0.01%29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Mo_1_Mar04.jpg
61 28/Sep/05 23:22/foster-homes/burrow-inn/index.htm
61 29/Sep/05 23:08/journal/2-7/right-decision.html
61 29/Sep/05 09:52/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/F&F_canape_platter.JPG
61 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Bunny_Blanket_Set.jpg
61 29/Sep/05 20:32/chapters/oregon/images/endquote.gif
61 29/Sep/05 20:32/chapters/oregon/images/startquote.gif
61 29/Sep/05 17:43/graphics/mine/fripouille.gif
61 29/Sep/05 09:52/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/white_resin_bunnies.JPG
61 29/Sep/05 08:46/rabbit-center/hayward_rescue/hayward_graphics/frankie041tiny.jpg
61 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/megan.jpg
61 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Chloe_Chelsea_1_Feb05.jpg
61 29/Sep/05 13:56/rabbit-center/hurt-rabbit.html
61 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Framed_Crosstitch_Bunny.JPG
60 29/Sep/05 12:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Wall_plaque.JPG
60 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Sock_Bunny.JPG
60 29/Sep/05 17:58/journal/3-2/graphics/mcvee.gif
60 28/Sep/05 17:16/graphics/homepage/backbar.gif
60 29/Sep/05 03:10/care/vets_newmexico.html
60 29/Sep/05 23:12/journal/2-6/database.html
60 29/Sep/05 08:46/rabbit-center/hayward_rescue/hayward_graphics/nancy067tiny.jpg
60 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/BunnyLove_Painting.JPG
60 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/HK_Marquis_de_Blanc.JPG
60 29/Sep/05 19:29/rabbit-center/adoptables/images/ronnier145709sml_000.jpg
60 29/Sep/05 07:15/chapters/san-diego/aboutus/bunnyfest/bunnyfest_2002_photos.html
60 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Merry_Pippen_1_Dec04.jpg
60 29/Sep/05 21:58/journal/3-11/
60 28/Sep/05 11:25/graphics/homepage/hrs-banner.gif
60 29/Sep/05 23:52/chapters/san-francisco/blue.jpeg
60 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Lucy_1_Feb05.jpg
60 29/Sep/05 08:46/rabbit-center/hayward_rescue/hayward_graphics/lance005tiny.jpg
60 29/Sep/05 12:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/CeramicStellar.jpg
59 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Albert_2_FEb05.jpg
59 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/molly1.jpg
59 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Lacquer_tray.JPG
59 29/Sep/05 14:16/care/tips.html
59 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Higgins_1_Feb05.jpg
59 29/Sep/05 08:46/rabbit-center/hayward_rescue/hayward_graphics/johanna095tiny.jpg
59 29/Sep/05 11:58/rabbit-center/rabbit_ofthe_month/common/_notes/
59 29/Sep/05 08:46/rabbit-center/hayward_rescue/hayward_graphics/lewis122tiny.jpg
59 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Giant_Bunny.JPG
59 28/Sep/05 20:54/graphics/fun/netbunnies/bj.tif
59 29/Sep/05 19:13/graphics/fun/netbunnies/h1.JPG
59 29/Sep/05 18:20/hrs-info/vet-conference/hrs-logo.gif
59 0.01%29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Maurice_2_Feb05.jpg
59 29/Sep/05 08:46/rabbit-center/hayward_rescue/hayward_graphics/richard131tiny.jpg
59 0.01%29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Maurice_1_Feb05.jpg
59 29/Sep/05 20:05/translations/dutch/
58 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Higgins_2_Feb05.jpg
58 0.01%29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Thinking_Rabbit.JPG
58 0.01%29/Sep/05 11:00/rabbit-center/hayward_rescue/hayward_graphics/eileen_sprouts.jpg
58 29/Sep/05 15:42/caregerman/bibliografie.html
58 29/Sep/05 09:52/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2004/Harmony_Kingomd_TJ.jpg
58 29/Sep/05 08:46/rabbit-center/hayward_rescue/hayward_graphics/michael046tiny.jpg
58 29/Sep/05 22:40/journal/3-3/privacy.html
58 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/0203_triston.jpg
58 29/Sep/05 10:40/journal/3-8/graphics/disaster.gif
58 28/Sep/05 23:18/easter/hidden-egg.html
58 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/molly2.jpg
58 29/Sep/05 19:31/rabbit-center/adoptables/images/myra001_002.jpg
58 29/Sep/05 21:09/chapters/san-diego/adoption/statistic.html
58 29/Sep/05 20:14/chapters/san-diego/join_online_nowoff.gif
58 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Albert_1_Feb05.jpg
58 29/Sep/05 18:24/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Stuffed_buddies.JPG
58 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Lucy-2_Feb05.jpg
58 29/Sep/05 02:45/rabbit-center/adoptables/spot.htm
57 29/Sep/05 16:00/links/calendar.html
57 28/Sep/05 23:00/rabbit-center/retail/carrierS.jpg
57 28/Sep/05 20:24/rabbit-center/rabbit_ofthe_month/_notes/
57 28/Sep/05 17:20/rabbit-center/adoptables/images/seamus_r1450_10sml.jpg
57 29/Sep/05 20:29/chapters/oregon/newsletter99_6.html
57 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/AUT_3100.jpg
57 28/Sep/05 18:27/rabbit-center/retail/playboxL.jpg
57 28/Sep/05 21:33/rabbit-center/retail/blkbagS.jpg
57 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/AUT_3094.jpg
57 29/Sep/05 10:40/journal/3-8/graphics/disaster-three-in-pen.gif
57 29/Sep/05 22:35/rabbit-center/adoptables/yasu.htm
57 29/Sep/05 23:44/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Premium_booth.JPG
57 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Corky_1_Feb05.jpg
57 29/Sep/05 23:21/rabbit-center/services/images/carrot_000.gif
57 29/Sep/05 13:44/rabbit-center/adoptables/images/fiona11sml.jpg
57 29/Sep/05 04:41/care/vets_scarolina.html
57 29/Sep/05 08:46/rabbit-center/hayward_rescue/hayward_graphics/sam108tiny.jpg
57 29/Sep/05 18:45/easter/flyer/flyer2.html
57 29/Sep/05 22:26/rabbit-center/hayward_rescue/hayward_rabbits_cruelty_report.html
57 29/Sep/05 23:12/journal/2-6/hands-on-therapy.html
56 29/Sep/05 08:46/rabbit-center/hayward_rescue/hayward_graphics/seymore141tiny.jpg
56 29/Sep/05 08:46/rabbit-center/hayward_rescue/hayward_graphics/sambra072tiny.jpg
56 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Milo_Corey_Jul02.jpg
56 29/Sep/05 06:15/chapters/san-francisco/promo.html
56 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Corky_2_Feb05.jpg
56 29/Sep/05 08:46/rabbit-center/hayward_rescue/hayward_graphics/toby025tiny.jpg
56 29/Sep/05 22:04/journal/3-10/
56 29/Sep/05 19:56/graphics/mine/foo/9-cds.jpg
56 29/Sep/05 08:46/rabbit-center/hayward_rescue/hayward_graphics/zorro011tiny.jpg
56 29/Sep/05 08:46/rabbit-center/hayward_rescue/hayward_graphics/ubu031tiny.jpg
55 29/Sep/05 22:28/rabbit-center/rabbit_ofthe_month/_baks/
55 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Amelia_1_Feb05.jpg
55 29/Sep/05 13:25/rabbit-center/adoptables/images/Flip_000.jpg
55 29/Sep/05 17:51/rabbit-center/fair_share/sf_peninsula/index.htm
55 29/Sep/05 14:51/graphics/mine/foo/5-under-table.jpg
55 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Sparky_2_Feb05.jpg
55 28/Sep/05 23:22/hrs-info/publicity/wp-apr-97.html
55 29/Sep/05 01:07/care/vets_idaho.html
55 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Sparky_1_Feb05.jpg
55 29/Sep/05 09:32/chapters/san-diego/aboutus/bunnyfest/bfest_photos/Rugby_Toy_2.JPG
55 29/Sep/05 17:47/rabbit-center/adoptables/graphics/big/gretchen15sml.jpg
55 29/Sep/05 23:18/journal/2-5/volunteer-overview.html
55 29/Sep/05 20:42/rabbit-center/lucky/cruelty.htm
55 29/Sep/05 22:07/journal/3-10/home-office.html
55 29/Sep/05 16:45/translations/japanese/cuniculi-up-j.txt
54 29/Sep/05 23:33/journal/warren-wise/priorities.html
54 29/Sep/05 17:51/rabbit-center/rabbit_ofthe_month/common/
54 29/Sep/05 12:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/FruitStand.jpg
54 29/Sep/05 10:52/chapters/san-diego/diet/guide.html
54 29/Sep/05 15:26/care/vets_wvirginia.html
54 29/Sep/05 23:09/journal/2-7/submissions.html
54 29/Sep/05 22:38/journal/3-3/lead.html
54 29/Sep/05 23:35/rabbit-center/adoptables/graphics/big/helga25sml.jpg
54 29/Sep/05 20:11/translations/japanese/tusks-j.txt
54 28/Sep/05 23:35/help/hints.html
54 29/Sep/05 23:32/journal/warren-wise/photos.html
54 29/Sep/05 05:32/adopt-a-rabbit-month/poster.html
54 28/Sep/05 22:27/chapters/oakland/bunwalk.html
54 29/Sep/05 20:26/rabbit-center/lucky/release_adopted.htm
54 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Amelia_2_Feb05.jpg
54 29/Sep/05 09:00/graphics/Icon%0d
54 29/Sep/05 21:07/translations/portugese/about.html
54 29/Sep/05 18:03/translations/japanese/orphan-j.txt
53 0.01%29/Sep/05 11:00/rabbit-center/hayward_rescue/hayward_graphics/eileen_exam_1.jpg
53 29/Sep/05 22:19/rabbit-center/fair_share/east_bay/index.htm
53 29/Sep/05 21:43/rabbit-center/lucky/PETA.htm
53 29/Sep/05 12:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Arthur_Court_album.JPG
53 0.01%29/Sep/05 11:00/rabbit-center/hayward_rescue/hayward_graphics/eileen_babies.jpg
53 28/Sep/05 22:22/chapters/oregon/images/bunnymascot5.jpg
53 29/Sep/05 23:44/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Ask-a-Vet_1.JPG
53 29/Sep/05 18:11/translations/japanese/calcium-j.txt
53 29/Sep/05 16:24/behaviourgerman/
53 29/Sep/05 14:19/journal/2-6/graphics/pj.gif
53 29/Sep/05 20:14/chapters/san-diego/join_online_nowon.gif
53 29/Sep/05 18:33/care/vets_utah.html
53 0.01%29/Sep/05 11:00/rabbit-center/hayward_rescue/hayward_graphics/eileen_top_page.jpg
53 29/Sep/05 17:33/hrs-info/adopt-a-highway.html
53 28/Sep/05 17:55/graphics/breeds/pappy-mini-rex-oc.jpg
53 29/Sep/05 23:44/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Auction_items_4.JPG
53 29/Sep/05 23:44/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Auction_items_1.jpg
52 29/Sep/05 11:00/rabbit-center/hayward_rescue/hayward_graphics/eileen_exam5.jpg
52 29/Sep/05 05:03/chapters/san-diego/behavior/quiz/q7answer_false.html
52 29/Sep/05 09:01/easter/flyer/food-not-free.pdf
52 29/Sep/05 11:00/rabbit-center/hayward_rescue/hayward_graphics/eileen_resting_driveway.jpg
52 29/Sep/05 16:55/translations/japanese/diet-j.txt
52 29/Sep/05 23:52/chapters/san-francisco/adopted.html
52 29/Sep/05 13:43/rabbit-center/adoptables/images/taylorr145639sml_000.jpg
52 0.01%29/Sep/05 11:00/rabbit-center/hayward_rescue/hayward_graphics/eileen_feeling_better.jpg
52 28/Sep/05 16:43/rabbit-center/retail/lrgcageL.jpg
52 29/Sep/05 20:42/translations/japanese/disabled-j.txt
52 29/Sep/05 11:14/chapters/san-diego/products/clothing.html
52 29/Sep/05 12:51/faqgerman/sections/unterbringung.html
52 0.01%29/Sep/05 11:00/rabbit-center/hayward_rescue/hayward_graphics/eileen_exam_2.jpg
52 29/Sep/05 23:29/journal/warren-wise/help-a-fosterer.html
52 29/Sep/05 09:32/chapters/san-diego/aboutus/bunnyfest/bfest_photos/p1010046.jpg
52 0.01%29/Sep/05 11:00/rabbit-center/hayward_rescue/hayward_graphics/eileen_exam4.jpg
52 29/Sep/05 22:49/journal/3-2/writing-for-journal.html
52 0.01%29/Sep/05 11:00/rabbit-center/hayward_rescue/hayward_graphics/eileen_exam_3.jpg
52 28/Sep/05 17:44/translations/japanese/pellets-j.txt
52 29/Sep/05 23:43/rabbit-center/adoptables/images/christopherr145825sml_000.jpg
52 29/Sep/05 21:44/rabbit-center/rabbit_ofthe_month/common/_baks/
52 29/Sep/05 09:32/chapters/san-diego/adoption/graphics/Misha_stuffed_bunny.JPG
51 29/Sep/05 10:25/chapters/oakland/baby.html
51 29/Sep/05 12:04/hrs-info/credit-card.html
51 29/Sep/05 09:32/chapters/san-diego/aboutus/bunnyfest/bfest_photos/p1010078.jpg
51 29/Sep/05 22:07/rabbit-center/hayward_rescue/hayward_graphics/angel_thanks.JPG
51 0.01%29/Sep/05 09:32/chapters/san-diego/aboutus/bunnyfest/bfest_photos/p1010035.jpg
51 29/Sep/05 17:39/chapters/oakland/adoption.html
51 29/Sep/05 09:32/chapters/san-diego/aboutus/bunnyfest/bfest_photos/p1010030.jpg
51 29/Sep/05 22:35/rabbit-center/adoptables/stockton.htm
50 28/Sep/05 22:49/chapters/san-diego/behavior/quiz/q9answer_true.html
50 29/Sep/05 19:45/rabbit-center/rabbit_ofthe_month/common/_baks/_notes/
50 29/Sep/05 23:56/chapters/san-francisco/graphics/adoptables/overlo1.jpg
50 29/Sep/05 09:32/chapters/san-diego/aboutus/bunnyfest/bfest_photos/Peanut_toy_1.JPG
50 29/Sep/05 09:32/chapters/san-diego/aboutus/bunnyfest/bfest_photos/p1010015.jpg
50 29/Sep/05 13:22/rabbit-center/adoptables/linda.htm
50 0.01%29/Sep/05 09:32/chapters/san-diego/aboutus/bunnyfest/North_Kylie_2_11Nov02.JPG
50 29/Sep/05 16:03/rabbit-center/adoptables/images/yelenar146331sml_000.jpg
50 29/Sep/05 21:18/rabbit-center/lucky/media_release.htm
50 28/Sep/05 21:39/chapters/oakland/bctheydi.html
50 29/Sep/05 10:36/rabbit-center/hayward_rescue/hayward_graphics/its-a-hit.JPG
50 29/Sep/05 20:24/translations/portugese/interpreting-behavoir.html
50 29/Sep/05 18:15/rabbit-center/news/
50 29/Sep/05 23:44/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/lagomorph_lounge.JPG
50 28/Sep/05 19:13/chapters/oregon/newsletter99_4.html
50 29/Sep/05 09:32/chapters/san-diego/aboutus/bunnyfest/bfest_photos/mats.jpg
49 28/Sep/05 19:57/chapters/san-diego/aboutus/new_chapter.html
49 29/Sep/05 09:32/chapters/san-diego/aboutus/bunnyfest/bfest_photos/HRS_Misha_and_friend.JPG
49 28/Sep/05 21:39/events/nj-conf-10-00.html
49 29/Sep/05 20:31/graphics/Icon_
49 29/Sep/05 22:36/translations/
49 29/Sep/05 23:44/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Cottontail_cafe.JPG
49 29/Sep/05 07:56/rabbit-center/adoptables/graphics/big/r834hayley11tny.jpg
49 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/toby.jpg
49 0.01%29/Sep/05 22:07/rabbit-center/hayward_rescue/hayward_graphics/one_big_pen_2.JPG
49 29/Sep/05 20:13/chapters/socal/hrs-square-easter.gif
49 29/Sep/05 09:32/chapters/san-diego/aboutus/bunnyfest/bfest_photos/CC1_250_333.jpg
49 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/buster.jpg
49 29/Sep/05 19:33/translations/japanese/cuniculi-j.txt
49 28/Sep/05 16:50/care/gi-stasis.html
49 29/Sep/05 20:13/chapters/socal/care.gif
49 29/Sep/05 23:28/journal/warren-wise/health-data.html
48 0.01%29/Sep/05 14:24/rabbit-center/hayward_rescue/hayward_graphics/Toby_playing.JPG
48 29/Sep/05 23:44/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/AK_Specialties.JPG
48 29/Sep/05 15:39/caregerman/leben-mit-einem.html
48 29/Sep/05 20:13/chapters/socal/leap2.gif
48 29/Sep/05 15:08/translations/japanese/drollery-j.txt
48 28/Sep/05 20:07/graphics/mine/foo/7-by-couch.jpg
48 29/Sep/05 20:13/chapters/socal/bun.gif
48 29/Sep/05 04:22/graphics/homepage/homepage-banner-text.gif
48 29/Sep/05 20:13/chapters/socal/carrot.gif
48 29/Sep/05 20:13/chapters/socal/run2.gif
48 29/Sep/05 06:30/care/vets_montana.html
48 29/Sep/05 18:29/graphics/fun/netbunnies/blond-3.tif
47 29/Sep/05 02:59/chapters/san-diego/aboutus/online.html
47 29/Sep/05 10:50/chapters/san-diego/behavior/quiz/q10answer_true.html
47 29/Sep/05 22:10/translations/japanese/pellet-info-j.txt
47 28/Sep/05 19:59/chapters/san-diego/behavior/quiz/q5answer_true.html
47 0.01%29/Sep/05 10:36/rabbit-center/hayward_rescue/hayward_graphics/boys_love_too.JPG
47 0.01%29/Sep/05 22:07/rabbit-center/hayward_rescue/hayward_graphics/one_big_pen_1.JPG
47 29/Sep/05 16:09/easter/flyer/flyer1.html
47 29/Sep/05 22:36/rabbit-center/adoptables/Mae.htm
47 29/Sep/05 19:58/journal/3-1/graphics/hare.gif
47 29/Sep/05 10:36/rabbit-center/hayward_rescue/hayward_graphics/more_bunnies.JPG
47 29/Sep/05 10:36/rabbit-center/hayward_rescue/hayward_graphics/structure_toys.jpg
47 29/Sep/05 10:36/rabbit-center/hayward_rescue/hayward_graphics/beginning_structure.JPG
47 29/Sep/05 17:33/rabbit-center/adoptables/images/vanzettir146502sml_000.jpg
47 29/Sep/05 10:36/rabbit-center/hayward_rescue/hayward_graphics/exploring.jpg
47 28/Sep/05 13:28/chapters/oakland/articles.html
46 29/Sep/05 23:44/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Auction_items_2.JPG
46 29/Sep/05 01:43/chapters/san-diego/aboutus/philosophy.html
46 29/Sep/05 23:44/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/avian_2.jpg
46 28/Sep/05 21:23/rabbit-center/hayward_rescue/hayward_rabbits_adopt-janet.html
46 29/Sep/05 13:19/journal/3-8/ww.html
46 28/Sep/05 17:16/rabbit-center/retail/litter.jpg
46 29/Sep/05 15:52/rabbit-center/hayward_rescue/hayward_graphics/girl_talk.jpg
46 29/Sep/05 12:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Desert_Hare_Print.JPG
45 28/Sep/05 22:43/rabbit-center/rabbit_ofthe_month/images/
45 29/Sep/05 09:13/care/vets_sdakota.html
45 29/Sep/05 03:12/health/vhd-ny-dec2001.html
44 28/Sep/05 23:19/caregerman/klokiste.html
44 29/Sep/05 20:11/rabbit-center/retail/haychowS.jpg
44 29/Sep/05 17:56/rabbit-center/volunteer/
44 0.01%29/Sep/05 22:07/rabbit-center/hayward_rescue/hayward_graphics/cleaning_pen.JPG
44 29/Sep/05 06:17/easter/flyer/flyer3.doc
44 29/Sep/05 19:15/graphics/fun/netbunnies/bunnies.gif
44 29/Sep/05 15:52/rabbit-center/hayward_rescue/hayward_graphics/girls_dine.jpg
44 29/Sep/05 15:52/rabbit-center/hayward_rescue/hayward_graphics/Boys_relax.jpg
44 28/Sep/05 23:31/journal/current-issue.html
44 29/Sep/05 16:48/translations/portugese/special-rabbit.html
44 29/Sep/05 23:44/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Massage_1.JPG
44 28/Sep/05 18:21/rabbit-center/adoptables/images/Benito.jpg
44 29/Sep/05 11:28/care/vets_arkansas.html
44 28/Sep/05 17:20/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Garden_variety.JPG
43 28/Sep/05 23:19/adoptiongerman/hrsueberbev.html
43 29/Sep/05 19:19/translations/japanese/trouble-with-ears-j.txt
43 29/Sep/05 21:37/journal/3-10/graphics/ears.gif
43 29/Sep/05 04:33/graphics/mine/toby-izzy/toby-best.jpg
43 28/Sep/05 17:36/translations/japanese/medical-leads-j.txt
43 29/Sep/05 21:37/chapters/san-diego/behavior/quiz/q2answer_true.html
43 29/Sep/05 05:56/chapters/oregon/newsletter99_5.html
43 29/Sep/05 12:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Backpack.JPG
43 29/Sep/05 18:40/chapters/michigan/jeremy13.jpg
43 28/Sep/05 05:02/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/CRM_booth.JPG
43 29/Sep/05 16:35/rabbit-center/fair_share/south_bay/index.htm
43 29/Sep/05 23:44/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Raffle_table.JPG
43 29/Sep/05 04:02/rabbit-center/events/classes/reiki/Reiki Flyer.htm
43 29/Sep/05 02:48/adoptiongerman/
43 29/Sep/05 03:12/links/pasteurella-study.html
43 28/Sep/05 19:39/care/vets_alaska.html
42 29/Sep/05 23:36/easter/hrs_easter_release_2005.pdf
42 28/Sep/05 18:54/rabbit-center/adoptables/images/eileen_big.jpg
42 29/Sep/05 02:01/rabbit-center/retail/food.jpg
42 29/Sep/05 12:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Candy_dish.jpg
42 0.01%26/Sep/05 22:08/adopt-a-rabbit-month/ShelterPosterfinal.pdf
42 29/Sep/05 18:40/chapters/michigan/daisy01.jpg
42 29/Sep/05 18:40/chapters/michigan/alex01.gif
42 28/Sep/05 05:02/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/T-Touch_demo_1.JPG
41 29/Sep/05 07:55/easter/next.html
41 29/Sep/05 17:56/foster-homes/burrow-inn/images/leap2.gif
41 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Girl_pink-nose.JPG
41 29/Sep/05 13:28/rabbit-center/hayward_rescue/hayward_rabbits_adopt-benton.html
41 29/Sep/05 16:09/translations/japanese/fear-into-play-j.txt
41 28/Sep/05 05:02/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Book_signing.JPG
41 28/Sep/05 16:45/graphics/easter/anti-big-gabriella.jpg
41 0.01%29/Sep/05 11:29/rabbit-center/adoptables/graphics/big/dantesiliconvalley.JPG
41 29/Sep/05 18:50/chapters/san-diego/aboutus/bunnyfest/bunnyfest_2001_photos.html
41 28/Sep/05 20:12/journal/3-8/graphics/couple-circle.gif
41 29/Sep/05 07:15/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/HRS_Premiums_booth3.JPG
41 29/Sep/05 00:34/hrs-info/aug00survey-results.html
41 25/Sep/05 21:08/rabbit-center/graphics/icon_servicespage.gif
41 27/Sep/05 23:24/chapters/san-diego/diet/hayrack.html
41 29/Sep/05 14:08/chapters/san-diego/products/graphics/smbookcover.jpg
41 29/Sep/05 17:56/foster-homes/burrow-inn/images/run2.gif
41 29/Sep/05 18:02/graphics/mine/foo/1-baby-foo-25.jpg
41 28/Sep/05 19:25/rabbit-center/fair_share/
41 29/Sep/05 17:56/foster-homes/burrow-inn/images/SF_Sparky_2_Feb05.jpg
40 28/Sep/05 05:02/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/T-Touch_demo_2.JPG
40 29/Sep/05 00:36/hrs-info/vet-conference/hornblower3.gif
40 29/Sep/05 00:36/hrs-info/vet-conference/CAROLYNN.gif
40 29/Sep/05 10:11/chapters/san-diego/products/books.html
40 29/Sep/05 20:17/chapters/san-diego/aboutus/bunnyfest/bfest_volunteer.html
40 28/Sep/05 23:15/journal/4-5/seeking-shelters.html
40 28/Sep/05 05:02/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Bunny_demo.JPG
40 29/Sep/05 22:19/journal/3-7/graphics/rabbit-sketch.gif
40 28/Sep/05 05:02/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Kids_Korner_1.JPG
40 29/Sep/05 00:36/hrs-info/vet-conference/hornblower2.gif
40 26/Sep/05 22:26/rabbit-center/adoptables/eva.htm
40 29/Sep/05 17:41/chapters/san-diego/diet/5325.pdf
40 29/Sep/05 00:41/rabbit-center/memorial_fund/
40 29/Sep/05 10:26/chapters/oakland/josie.html
40 29/Sep/05 10:25/chapters/oakland/hall.html
40 28/Sep/05 15:47/journal/2-7/graphics/hollyk.gif
40 28/Sep/05 23:18/easter/yahooligansindex.html
40 29/Sep/05 15:14/graphics/calendars/0763149349.jpg
39 29/Sep/05 17:39/chapters/oakland/poster.jpg
39 29/Sep/05 07:55/hrs-info/tenth-leap/rsvp.html
39 29/Sep/05 03:55/chapters/san-francisco/garden/
39 28/Sep/05 05:02/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/ed_booth.jpg
39 28/Sep/05 17:43/rabbit-center/adoptables/images/jenny_big.jpg
39 28/Sep/05 05:02/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/T-Touch_demo_3.JPG
39 29/Sep/05 07:15/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/HRS_Info_Booth2.JPG
39 29/Sep/05 10:55/hrs-info/rhn.html
39 29/Sep/05 03:12/health/vhd-utah-aug2001.html
39 27/Sep/05 01:26/chapters/cu/
39 0.01%29/Sep/05 08:25/rabbit-center/adoptables/images/mr_missy_big.gif
38 29/Sep/05 17:39/chapters/oakland/tshirt.gif
38 29/Sep/05 17:36/rabbit-center/adoptables/images/Roman_000.jpg
38 29/Sep/05 09:54/graphics/fun/netbunnies/barley1.gif
38 29/Sep/05 17:39/chapters/oakland/aboutush.gif
38 29/Sep/05 02:55/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Fitz_Floyd_Bowl.JPG
38 28/Sep/05 20:31/chapters/oakland/resource.html
38 28/Sep/05 23:22/hrs-info/tenth-leap/auction-thanks.html
38 28/Sep/05 17:12/graphics/mine/zowie6-crop.jpg
38 28/Sep/05 23:23/hrs-info/tenth-leap/invite.html
38 29/Sep/05 05:57/chapters/oregon/newsletter99_2.html
38 28/Sep/05 21:38/care/tips00.html
38 29/Sep/05 17:18/rabbit-center/samosa-update.html
38 29/Sep/05 13:27/care/north-carolina-vets.txt
38 29/Sep/05 22:45/links/sections/_old/
38 29/Sep/05 07:55/chapters/san-diego/aboutus/volunteer_handout.html
37 28/Sep/05 05:02/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Dr_Loudis.JPG
37 29/Sep/05 10:26/chapters/oakland/elmo.html
37 27/Sep/05 19:03/rabbit-center/rabbit_ofthe_month/images/_baks/
37 29/Sep/05 23:21/rabbit-center/retail/bokvidS.jpg
37 29/Sep/05 03:15/hrs-info/bookmark-hrs.html
37 28/Sep/05 05:02/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Bfest_view.JPG
37 29/Sep/05 17:33/translations/japanese/litter-j.html
37 28/Sep/05 05:02/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Bunny_tech.JPG
37 28/Sep/05 17:00/rabbit-center/adoptables/graphics/big/duncan23sml.jpg
37 29/Sep/05 23:04/translations/japanese/tools-of-the-trade-j.txt
36 28/Sep/05 20:47/chapters/oregon/images/sanctuary_b.jpg
36 28/Sep/05 05:02/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Ask-a-Vet_3.JPG
36 29/Sep/05 22:35/rabbit-center/adoptables/images/stockton01sml.jpg
36 29/Sep/05 23:21/rabbit-center/retail/hr-book.jpg
36 16/Sep/05 13:28/foster-homes/burrow-inn/adoptables/adoptables_img/kelly_kyle.jpg
36 29/Sep/05 16:55/chapters/oregon/newsletter99_3.html
36 29/Sep/05 06:59/graphics/fun/netbunnies/c1.JPG
36 28/Sep/05 20:01/rabbit-center/graphics/adoption-center-banner.gif
36 28/Sep/05 20:47/chapters/oregon/images/sanctuary_c.jpg
36 28/Sep/05 05:02/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Pottery_vendor.JPG
36 29/Sep/05 12:38/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Cabbage_Bun_Planter.JPG
36 16/Sep/05 13:28/foster-homes/burrow-inn/adoptables/adoptables_img/taylor2.jpg
36 29/Sep/05 16:25/easter/oldindex.html
36 28/Sep/05 20:47/chapters/oregon/images/sanctuary_a.jpg
36 28/Sep/05 05:02/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Ask-a-Vet_2.JPG
36 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Silver_lop.JPG
36 29/Sep/05 17:44/chapters/oakland/nietzche.html
36 28/Sep/05 16:45/graphics/fun/netbunnies/ukkurt.JPG
36 29/Sep/05 14:44/rabbit-center/header.gif
35 28/Sep/05 23:32/cgi-bin/search
35 28/Sep/05 05:02/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/kw_cages.jpg
35 16/Sep/05 13:28/foster-homes/burrow-inn/adoptables/adoptables_img/taylor1.jpg
35 29/Sep/05 23:21/rabbit-center/retail/1st-bunV.jpg
35 28/Sep/05 21:25/rabbit-center/hayward_rescue/hayward_rabbits_adopt-johanna.html
35 28/Sep/05 16:36/hrs-info/chapter_pledge.doc
35 28/Sep/05 18:30/journal/2-7/graphics/basset-circle.gif
35 29/Sep/05 17:31/easter/thanks98.html
35 27/Sep/05 03:55/rabbit-center/lucky_hearing.html
35 28/Sep/05 21:20/rabbit-center/hayward_rescue/hayward_rabbits_adopt-danny.html
35 29/Sep/05 07:15/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Cottontail_Cafe.JPG
35 29/Sep/05 11:42/hrs-info/chapter pledge.doc
34 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/2_white_bunnies.JPG
34 28/Sep/05 05:02/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Boy_spotted_bunny.JPG
34 29/Sep/05 22:35/rabbit-center/adoptables/images/yasur146417sml_000.jpg
34 29/Sep/05 17:30/easter/thanks99.html
34 28/Sep/05 23:18/easter/yahoo.html
34 28/Sep/05 05:02/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/blk-wht_dutch-bunny.JPG
34 28/Sep/05 20:27/chapters/san-francisco/rainbow/
34 29/Sep/05 23:21/rabbit-center/retail/introV.jpg
34 29/Sep/05 10:25/chapters/oakland/behr.html
34 29/Sep/05 08:56/hrs-info/stats/day.html
34 28/Sep/05 18:53/journal/2-7/graphics/greta-circle-2.gif
34 28/Sep/05 21:22/rabbit-center/hayward_rescue/hayward_rabbits_adopt-frankie.html
34 28/Sep/05 18:30/journal/2-7/graphics/sach-circle.gif
34 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/White_mini-lop_2.JPG
34 28/Sep/05 23:18/easter/press-release.html
33 29/Sep/05 02:55/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/PotteryDish.jpg
33 29/Sep/05 23:21/rabbit-center/retail/spayV.jpg
33 29/Sep/05 10:55/press-kit/background-info.html
33 29/Sep/05 09:15/chapters/san-diego/aboutus/Membership_Form.rtf
33 29/Sep/05 13:29/rabbit-center/rabbit_ofthe_month/images/_baks/_notes/
33 29/Sep/05 23:21/rabbit-center/retail/examV.jpg
33 29/Sep/05 23:52/chapters/san-francisco/graphics/adoptables/feb02/emma.jpg
33 29/Sep/05 03:56/links/letter.html
33 29/Sep/05 02:55/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/LgRiceBowls.jpg
33 29/Sep/05 10:26/chapters/oakland/hershey.html
33 29/Sep/05 07:15/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Bfest_Massage2.JPG
33 29/Sep/05 18:36/links/sections/ally_application.doc
33 28/Sep/05 23:19/care/vhd-letter.html
33 28/Sep/05 19:57/chapters/san-diego/behavior/quiz/q3answer_false.html
33 28/Sep/05 21:16/rabbit-center/hayward_rescue/hayward_rabbits_adopt-baxter.html
32 29/Sep/05 16:25/chapters/oakland/cuddles.html
32 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/abby.jpg
32 29/Sep/05 22:27/hrs-info/chapter-contract.doc
32 29/Sep/05 23:21/rabbit-center/retail/routeCD.jpg
32 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/black_baby_bun.JPG
32 29/Sep/05 06:58/graphics/fun/netbunnies/stonebunny.JPG
32 28/Sep/05 18:26/journal/3-8/graphics/rabbit-for-sale.gif
32 29/Sep/05 17:57/foster-homes/burrow-inn/care/index.htm
32 28/Sep/05 22:15/rabbit-center/retail/store2L.jpg
32 29/Sep/05 23:21/rabbit-center/retail/spaceCD.jpg
32 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Fat_orange_rex.JPG
32 28/Sep/05 07:22/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/White_bunny_basket.JPG
32 29/Sep/05 17:47/graphics/fun/netbunnies/cashew.gif
32 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Big_agouti_bun_2.JPG
32 29/Sep/05 17:32/rabbit-center/adoption/adoptpolicies.html
32 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/brown_spot_bun.JPG
32 29/Sep/05 23:21/rabbit-center/retail/exerVCD.jpg
32 29/Sep/05 16:24/rabbit-center/hayward_rescue/hayward_rabbits_adopt-lance.html
32 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Grey_bunny_face.JPG
32 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Brown_lop.JPG
32 25/Sep/05 02:26/rabbit-center/adoptables/penelope.htm
32 27/Sep/05 06:17/graphics/easter/rabbit.gif
31 29/Sep/05 17:51/rabbit-center/fair_share/north_bay/index.htm
31 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/White_bunny_pink-leash.JPG
31 28/Sep/05 21:18/rabbit-center/hayward_rescue/hayward_rabbits_adopt-bernie.html
31 29/Sep/05 03:21/chapters/san-diego/products/poster.html
31 28/Sep/05 19:27/easter/grail.mid
31 29/Sep/05 02:55/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Japanese_Rice_Bowls.JPG
31 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Brown_white_dutch.jpg
31 28/Sep/05 21:21/rabbit-center/hayward_rescue/hayward_rabbits_adopt-gigi.html
31 28/Sep/05 21:03/rabbit-center/adoptables/graphics/big/valentino02sml.jpg
31 28/Sep/05 21:38/hrs-info/yesterdays-news.html
31 29/Sep/05 02:55/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Sterling_Bunny_Pin.JPG
31 29/Sep/05 07:15/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Lagomorph_lounge.JPG
31 29/Sep/05 23:40/links/sections/unaffiliated_rescuer_app.doc
31 29/Sep/05 02:55/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/ResinBunAngle.jpg
31 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Bunnies_all.JPG
31 28/Sep/05 21:15/rabbit-center/hayward_rescue/hayward_rabbits_adopt-angel.html
31 29/Sep/05 02:26/resources/
31 29/Sep/05 07:15/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/CRM_booth.JPG
31 28/Sep/05 23:18/easter/yahooligans.html
31 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/White_bunny_harness.JPG
31 29/Sep/05 10:26/chapters/oakland/ceci.html
31 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Spotted_bunny.JPG
31 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Big_white_bunny.JPG
30 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Dk_brn_bunny-on-leash.jpg
30 29/Sep/05 23:35/rabbit-center/rabbit_ofthe_month/images/_notes/
30 28/Sep/05 19:52/rabbit-center/adoptables/images/Spot_000.jpg
30 27/Sep/05 13:45/graphics/banners/full-banner-short.jpg
30 29/Sep/05 07:15/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Kids_corner2.JPG
30 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Sarah_S_bunny.JPG
30 29/Sep/05 21:14/foster-homes/burrow-inn/adoptables/adoptables_img/SF_Mo_2_Mar04.jpg
30 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/dk_brown_lop.JPG
30 0.01%29/Sep/05 02:55/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Tapestry_Throw.JPG
30 29/Sep/05 16:25/hrs-info/tenth-leap/text.html
30 29/Sep/05 17:55/chapters/oakland/ana.html
30 29/Sep/05 10:26/chapters/oakland/kiri.html
30 29/Sep/05 19:22/chapters/san-diego/aboutus/bunnyfest/bunnyfest_2005.html
30 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/man_nd.jpg
30 29/Sep/05 06:56/graphics/fun/netbunnies/bunnyinbowl.JPG
30 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/brn_wht_spot_bunny.JPG
30 29/Sep/05 07:15/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Rabbit_rescue_booth.JPG
30 29/Sep/05 18:34/rabbit-center/rabbit_ofthe_month/_baks/_notes/
30 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Guy_sealpoint_rex.JPG
30 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/White_baby_bun.JPG
30 29/Sep/05 07:15/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Kids_corner3.JPG
30 28/Sep/05 15:44/rabbit-center/retail/store1L.jpg
30 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Tri-color_lop_2.JPG
30 27/Sep/05 17:05/chapters/oakland/events.html
30 28/Sep/05 07:06/easter/hrs2004prnewswire.html
30 29/Sep/05 07:15/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Kids_corner1.JPG
30 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Tri-color_lop.jpg
29 28/Sep/05 16:03/graphics/easter/anti-victoria.jpg
29 29/Sep/05 16:24/rabbit-center/hayward_rescue/hayward_rabbits_adopt-nancy.html
29 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Red_lady_spot_bunny.jpg
29 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Seal-point_lop_red-leash.JPG
29 28/Sep/05 17:25/graphics/calendars/0763149349_l.jpg
29 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Old_lop_bunny.JPG
29 29/Sep/05 17:57/foster-homes/burrow-inn/events/index.htm
29 28/Sep/05 20:25/rabbit-center/adoptables/graphics/big/julie03sml.jpg
29 29/Sep/05 18:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Info_Premium_Booths_small.JPG
29 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Sarah_S_bunny_2.JPG
29 28/Sep/05 21:19/rabbit-center/hayward_rescue/hayward_rabbits_adopt-francine.html
29 28/Sep/05 22:24/easter/after-easter.txt
29 28/Sep/05 17:41/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/hotot-in-arms.jpg
29 29/Sep/05 10:24/easter/flyer/flyer4.pdf
29 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Bunny_and_basket.jpg
29 29/Sep/05 17:38/chapters/oregon/images/bunnymascot3.jpg
29 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/English_spot.JPG
29 28/Sep/05 19:16/foster-homes/burrow-inn/promotion/index.htm
29 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Grey_bunny_basket.JPG
29 28/Sep/05 23:31/journal/3-7/3-7-toc.html
29 29/Sep/05 18:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Bfest_Spirit_small.JPG
29 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Lop_bunny_harness.JPG
29 29/Sep/05 06:56/graphics/fun/netbunnies/bunnyday.JPG
29 29/Sep/05 02:55/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Zodiac_Pendant.jpg
29 28/Sep/05 18:53/graphics/easter/gabriella.jpg
29 29/Sep/05 07:15/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Bfest_Massage.JPG
29 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Dutch_in_grass.JPG
29 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/sarah_s.jpg
28 28/Sep/05 23:18/easter/flyer/flyers.html
28 29/Sep/05 02:55/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Cottontail_Plate.JPG
28 29/Sep/05 19:28/chapters/oakland/maya.html
28 28/Sep/05 16:41/rabbit-center/adoptables/graphics/big/basil46sml.jpg
28 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Mixed_bunny_pair.JPG
28 29/Sep/05 02:48/graphics/breeds/summer-dutch-dc.jpg
28 29/Sep/05 09:15/chapters/san-diego/aboutus/Membership_Form.pdf
28 29/Sep/05 11:00/journal/4-5/graphics/snuggle-habitat.jpg
28 29/Sep/05 23:07/journal/3-6/graphics/rabbitat.gif
28 27/Sep/05 19:53/chapters/san-diego/aboutus/bunny_cottage.html
28 28/Sep/05 15:28/rabbit-center/adoptables/graphics/big/ichiro12sml.jpg
28 29/Sep/05 18:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Cottontail_Cafe_small.jpg
28 29/Sep/05 02:41/rabbit-center/fair_share/contact/index.htm
28 29/Sep/05 02:55/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/HarmonyKingdom_netsuke.JPG
28 29/Sep/05 07:15/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/HRS_Premiums_booth.JPG
28 29/Sep/05 07:15/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/vet_talk.jpg
28 29/Sep/05 11:00/journal/4-5/graphics/door.jpg
28 29/Sep/05 07:15/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Basket_of_toys.JPG
28 28/Sep/05 20:52/graphics/fun/netbunnies/rabbit2.tif
28 29/Sep/05 10:20/hrs-info/tenth-leap/invite.txt
28 29/Sep/05 02:55/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Blue_white_vase.JPG
28 29/Sep/05 07:15/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Vet_talk2.JPG
28 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/brown_white_bunny-pair.JPG
28 28/Sep/05 20:47/chapters/oregon/images/bunnymascot4.jpg
28 29/Sep/05 02:55/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Pat-the-bunny_tin.JPG
28 29/Sep/05 17:57/foster-homes/burrow-inn/contact/images/mm_spacer.gif
28 29/Sep/05 10:25/chapters/oakland/brandy.html
28 29/Sep/05 17:31/links/sections/orphan_files/
27 29/Sep/05 16:10/translations/japanese/bibliography-j.html
27 29/Sep/05 10:26/chapters/oakland/buttersc.html
27 28/Sep/05 17:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/two_siamese_lops.JPG
27 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Man-agouti_lop.JPG
27 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Lisa_Ronco.JPG
27 29/Sep/05 19:13/graphics/fun/netbunnies/harley.jpeg
27 29/Sep/05 07:15/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/group-lecture.jpg
27 29/Sep/05 11:00/journal/4-5/graphics/habitat.jpg
27 29/Sep/05 11:00/journal/4-5/graphics/bunz.jpg
27 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/White_bunny_small.JPG
27 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Sleepy_Casey.JPG
27 29/Sep/05 02:55/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/magazine_rack.jpg
27 29/Sep/05 07:15/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/CRM_booth_2.JPG
27 28/Sep/05 17:55/rabbit-center/adoptables/images/venus06sml.jpg
27 29/Sep/05 10:26/chapters/oakland/daisy.html
27 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/quentin.jpg
27 0.01%28/Sep/05 18:52/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/HRS_Info_Booth.JPG
27 29/Sep/05 10:27/chapters/oakland/rorschach.html
27 28/Sep/05 15:38/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Bunnies_under_table.JPG
27 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/lady_spot_bunny.JPG
27 29/Sep/05 02:55/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Cottontail_cottage.jpg
27 29/Sep/05 07:16/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/himalyan.jpg
27 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Big_agouti_bun.JPG
27 29/Sep/05 10:26/chapters/oakland/macey.html
27 29/Sep/05 19:21/chapters/oakland/maybel.html
27 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/mamas_shoulder.JPG
27 29/Sep/05 10:27/chapters/oakland/queen.html
27 29/Sep/05 11:00/journal/4-5/graphics/map.jpg
27 29/Sep/05 10:26/chapters/oakland/george.html
27 29/Sep/05 03:49/translations/japanese/age-related-behavior-j.html
27 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/lady_eng_spot.JPG
26 29/Sep/05 10:25/chapters/oakland/baby.jpg
26 29/Sep/05 19:08/rabbit-center/rabbit_ofthe_month/sept05/images/John Coltrane 002.jpg
26 29/Sep/05 06:28/journal/3-4/
26 28/Sep/05 17:55/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Girl_himmi_lop.jpg
26 29/Sep/05 00:13/chapters/san-diego/products/graphics/mens-t_clock_ylw_blu.JPG
26 29/Sep/05 00:13/chapters/san-diego/products/graphics/Caffeine_ladies-t_aqua.JPG
26 27/Sep/05 14:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2003/Lop_bunny_redhead.JPG
26 29/Sep/05 18:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/CRM_Booth_small.JPG
26 29/Sep/05 03:04/chapters/san-diego/aboutus/bunnyfest/bunnyfest_2003.html
26 28/Sep/05 17:51/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Red_wagon_2.JPG
26 28/Sep/05 18:53/graphics/fun/netbunnies/cookie.gif
26 29/Sep/05 10:26/chapters/oakland/gracie.html
26 29/Sep/05 02:55/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/CountryPrints.jpg
26 27/Sep/05 06:21/chapters/oakland/winky.html
26 28/Sep/05 17:36/graphics/easter/anti-gabriella.jpg
26 29/Sep/05 05:13/graphics/fun/netbunnies/lazy.gif
26 29/Sep/05 06:50/graphics/mine/toby-izzy/izzy-best.jpg
26 29/Sep/05 15:13/chapters/san-diego/adoption/Adoption_Photos/Butterscotch_adoption_Apr04.jpg
26 29/Sep/05 07:15/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/eng-spot-climbing-out.jpg
26 26/Sep/05 19:34/rabbit-center/adoptables/Flop.htm
26 28/Sep/05 20:12/chapters/san-diego/feedback.html
26 28/Sep/05 16:25/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Red_wagon_1.JPG
25 29/Sep/05 00:13/chapters/san-diego/products/graphics/Rabbit_house_babydoll_tshirt.jpg
25 29/Sep/05 19:07/rabbit-center/adoption/adopt-procedures.html
25 28/Sep/05 17:55/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Sarah_Sedgewick.JPG
25 29/Sep/05 17:50/rabbit-center/castro_valley_media_alert.html
25 29/Sep/05 00:13/chapters/san-diego/products/graphics/Abbys_Rose_peach.JPG
25 28/Sep/05 18:18/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/white-buns-on-grass.jpg
25 29/Sep/05 11:44/help/hrs-sherlock-plugin.hqx
25 29/Sep/05 00:13/chapters/san-diego/products/graphics/Established_t_wht_ss.JPG
25 28/Sep/05 15:55/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/people_1.jpg
25 29/Sep/05 03:50/chapters/oakland/wookie.html
25 29/Sep/05 09:57/webmail/images/last.gif
25 29/Sep/05 16:25/chapters/oakland/join.html
25 28/Sep/05 18:14/chapters/oakland/wallace.html
25 28/Sep/05 21:59/graphics/fun/netbunnies/bunny1.tif
25 28/Sep/05 17:23/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Little_girl &Jean.jpg
25 29/Sep/05 22:26/chapters/san-diego/donations.html
25 29/Sep/05 00:13/chapters/san-diego/products/graphics/Established_t_ls_green.JPG
25 29/Sep/05 05:33/rabbit-center/lucky_media.html
25 28/Sep/05 23:22/hrs-info/tenth-leap/individual-thanks.html
25 29/Sep/05 10:25/chapters/oakland/baby2.jpg
25 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/domirudy.jpg
25 28/Sep/05 17:53/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/Red_wagon_3.JPG
25 28/Sep/05 18:56/rabbit-center/adoptables/graphics/big/hazel55sml.jpg
25 27/Sep/05 08:35/chapters/san-diego/health/mosquito.html
25 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/heidi.jpg
24 28/Sep/05 16:00/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/shuttle-sign.jpg
24 29/Sep/05 21:28/journal/3-3/
24 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/gillian.jpg
24 29/Sep/05 00:13/chapters/san-diego/products/graphics/grey_clock_tshirt_small.gif
24 26/Sep/05 19:36/chapters/michigan/ac.html
24 29/Sep/05 03:53/chapters/san-diego/volunteer_ops.html
24 28/Sep/05 18:21/graphics/fun/netbunnies/doe.gif
24 29/Sep/05 09:59/translations/japanese/head-tilt-j.html
24 28/Sep/05 12:17/chapters/san-diego/aboutus/bunnyfest/bfest_auction.html
24 29/Sep/05 00:13/chapters/san-diego/products/graphics/ladies-t_clock_ylw-blu_2.JPG
24 28/Sep/05 12:24/volunteers/graphics/header-internal.gif
24 28/Sep/05 18:39/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2002/red-wagon.jpg
24 29/Sep/05 00:13/chapters/san-diego/products/graphics/Herman_jr-raglan_tee.jpg
24 28/Sep/05 18:05/rabbit-center/adoptables/graphics/big/r1017mini81sml.jpg
24 29/Sep/05 10:26/chapters/oakland/scooter.html
24 29/Sep/05 03:42/chapters/san-diego/member.html
24 28/Sep/05 16:58/graphics/fun/netbunnies/rexspike.gif
24 28/Sep/05 18:20/graphics/fun/netbunnies/fuzzball1.gif
24 29/Sep/05 00:13/chapters/san-diego/products/graphics/Caffeine_beefy-t_purple.JPG
24 29/Sep/05 16:25/chapters/oakland/buffy.html
23 29/Sep/05 02:55/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/HouseRabbitPuzzle.jpg
23 28/Sep/05 20:15/chapters/san-diego/hay_elf.html
23 29/Sep/05 06:57/graphics/fun/netbunnies/spencer-profile.JPG
23 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/molly.jpg
23 28/Sep/05 18:18/hrs-info/image003.gif
23 28/Sep/05 20:54/graphics/fun/netbunnies/cadbury1.tif
23 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/cory.jpg
23 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/thad.jpg
23 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/tabit.jpeg
23 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/panda.jpeg
23 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/nim.jpg
23 25/Sep/05 17:23/chapters/oakland/skylark.html
23 29/Sep/05 18:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/mvc-002f_small.jpg
23 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/blondi.jpeg
23 29/Sep/05 18:15/rabbit-center/adoptables/graphics/big/juliette32sml.jpg
23 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/toby.jpg
23 29/Sep/05 18:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Garden_Art_small.JPG
23 29/Sep/05 14:52/graphics/mine/foo/foo-digi.gif
23 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/stuart.jpg
23 27/Sep/05 07:40/rabbit-center/lucky_letter-writing.html
23 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/darby.jpeg
23 25/Sep/05 17:23/chapters/oakland/siouxsie.html
23 29/Sep/05 01:17/translations/japanese/pellet-info-j.html
23 29/Sep/05 00:13/chapters/san-diego/products/graphics/Herman_ash_grey.jpg
23 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/SF_Frankie_2_Feb05.jpg
22 29/Sep/05 18:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Kids_Corner_1_small.JPG
22 28/Sep/05 09:05/chapters/san-diego/bunnyfest/bunnyfest_2001_photos.html
22 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/benjamin-1.gif
22 29/Sep/05 18:45/easter/flyer/title.gif
22 28/Sep/05 15:41/chapters/san-diego/products/accessories.html
22 29/Sep/05 03:15/chapters/san-diego/aboutus/bunnyfest/bfest_raffle.html
22 29/Sep/05 03:49/translations/japanese/digestibility-j.html
22 29/Sep/05 19:11/graphics/fun/netbunnies/jet.JPG
22 29/Sep/05 18:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/pewter_small.jpg
22 28/Sep/05 15:57/graphics/calendars/calcom.gif
22 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/marcus-1.gif
22 29/Sep/05 13:56/rabbit-center/graphics/hurt-rabbit/2.jpg
22 29/Sep/05 20:49/rabbit-center/fair_share/north_bay/
22 29/Sep/05 07:02/graphics/fun/netbunnies/hc1.JPG
22 29/Sep/05 16:25/graphics/fun/netbunnies/gidget.bmp
22 25/Sep/05 18:02/journal/3-4/graphics/
22 28/Sep/05 17:19/journal/3-5/graphics/margo-pen-primary.gif
22 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/nico.jpeg
22 29/Sep/05 10:25/chapters/oakland/ben.html
22 29/Sep/05 18:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Chare_Massage_small.JPG
22 29/Sep/05 18:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Many_Hands_Booth_small.JPG
22 29/Sep/05 19:54/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/Boyds_Bunny_Raffle-item.JPG
22 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/k-agouti-i.gif
22 29/Sep/05 18:45/easter/flyer/logo-w-name.gif
22 29/Sep/05 10:27/chapters/oakland/rusty.html
22 29/Sep/05 16:24/chapters/oakland/vetlist.html
22 29/Sep/05 13:56/rabbit-center/graphics/hurt-rabbit/3.jpg
22 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/jeremiah.gif
22 29/Sep/05 18:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Exoticare_small.JPG
22 28/Sep/05 12:37/cgi-bin/suid/~rabbit2/email-article.cgi
22 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/SF_Rocky_1_Feb05.jpg
22 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/SF_Amelie_2_Feb05.jpg
21 29/Sep/05 00:45/rabbit-center/updates/cupertino_buns.htm
21 29/Sep/05 02:55/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/Dedham_jewelry.JPG
21 28/Sep/05 18:49/translations/japanese/emergencies-j.html
21 29/Sep/05 03:54/rabbit-center/lucky_media_release.html
21 29/Sep/05 18:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Lisa_Goldie_Booth_small.JPG
21 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/alaska1.gif
21 28/Sep/05 15:47/journal/3-5/graphics/margo-pen.gif
21 29/Sep/05 18:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Info_Booth3_small.jpg
21 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/coleen-meleny-5.gif
21 29/Sep/05 02:55/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2002/RadioRabbit.jpg
21 29/Sep/05 02:25/chapters/oakland/scotia.html
21 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/d-gray-2-i.gif
21 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/maggie-1.gif
21 29/Sep/05 19:54/chapters/san-diego/aboutus/bunnyfest/Auction_Photos_2003/White_Bunny_Bowl_Raffle-Item.JPG
21 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/whitney-3.gif
21 28/Sep/05 21:42/store/
21 29/Sep/05 13:19/journal/3-8/graphics/bunny-w-stethascope.gif
21 29/Sep/05 18:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Premium_Booth_small.JPG
21 28/Sep/05 18:16/rabbit-center/adoptables/graphics/big/r1180anabelle40sml.jpg
21 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/d-tort-2-i.gif
21 29/Sep/05 18:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Info_Booth_small.JPG
21 28/Sep/05 15:38/rabbit-center/adoptables/graphics/big/adam r1432 32sml.jpg
21 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/k-white-i.gif
21 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/hugo-1.gif
21 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/gilbert-3.gif
21 29/Sep/05 23:52/chapters/san-francisco/adopt.jpeg
21 29/Sep/05 19:24/chapters/san-diego/aboutus/bunnyfest/bunnyfest_2002.html
21 29/Sep/05 04:01/rabbit-center/fair_share/south_bay/
21 29/Sep/05 06:59/graphics/fun/netbunnies/harvey2.JPG
21 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/d-black-lop-i.gif
21 29/Sep/05 18:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Cottontail_Cafe2_small.JPG
21 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/dolly-1.gif
21 28/Sep/05 15:44/rabbit-center/adoptables/graphics/big/berklee03sml.jpg
21 29/Sep/05 13:22/rabbit-center/adoptables/images/reducedsize.jpg
21 28/Sep/05 19:27/easter/solong-edit.mid
21 29/Sep/05 23:52/chapters/san-francisco/graphics/adopted/cody-3.gif
20 29/Sep/05 18:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Jodi_Jensen_Booth_small.JPG
20 29/Sep/05 18:50/chapters/san-diego/aboutus/bunnyfest/Images_Bfest_2001/Auction_browsing2_small.JPG
20 0.01%29/Sep/05 06:07